NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F098794

Metagenome / Metatranscriptome Family F098794

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098794
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 110 residues
Representative Sequence MIPKTLRGALNQIERMLSGRPYSGDLWDIMSCVRGPDSRNKRIKHATTTIIRSAAFPSRPCEERSFYGEDSAKRAEIRKRLFKNKEDFNHFRQHCEAAFDALDLKLFEEN
Number of Associated Samples 52
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 52.43 %
% of genes near scaffold ends (potentially truncated) 38.83 %
% of genes from short scaffolds (< 2000 bps) 84.47 %
Associated GOLD sequencing projects 43
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (52.427 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(47.573 % of family members)
Environment Ontology (ENVO) Unclassified
(93.204 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(94.175 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.38%    β-sheet: 0.00%    Coil/Unstructured: 53.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF00782DSPc 36.89
PF02945Endonuclease_7 3.88
PF00535Glycos_transf_2 1.94
PF04488Gly_transf_sug 0.97
PF07460NUMOD3 0.97
PF10263SprT-like 0.97
PF05593RHS_repeat 0.97
PF01762Galactosyl_T 0.97
PF02709Glyco_transf_7C 0.97
PF01398JAB 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG3209Uncharacterized conserved protein RhaS, contains 28 RHS repeatsGeneral function prediction only [R] 0.97
COG3774Mannosyltransferase OCH1 or related enzymeCell wall/membrane/envelope biogenesis [M] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms66.99 %
UnclassifiedrootN/A33.01 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004152|Ga0062386_101732561Not Available521Open in IMG/M
3300006893|Ga0073928_10006773All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium15261Open in IMG/M
3300009518|Ga0116128_1063347All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1142Open in IMG/M
3300009518|Ga0116128_1071921All Organisms → Viruses → Predicted Viral1054Open in IMG/M
3300009518|Ga0116128_1074644Not Available1030Open in IMG/M
3300009519|Ga0116108_1015595All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2699Open in IMG/M
3300009519|Ga0116108_1065373All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon1132Open in IMG/M
3300009519|Ga0116108_1103280All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium861Open in IMG/M
3300009519|Ga0116108_1211993All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium568Open in IMG/M
3300009519|Ga0116108_1214463Not Available564Open in IMG/M
3300009547|Ga0116136_1007664All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4198Open in IMG/M
3300009547|Ga0116136_1026020All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1841Open in IMG/M
3300009548|Ga0116107_1029487All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2046Open in IMG/M
3300009548|Ga0116107_1057347All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1295Open in IMG/M
3300009548|Ga0116107_1075375All Organisms → Viruses → Predicted Viral1063Open in IMG/M
3300009616|Ga0116111_1038418All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1466Open in IMG/M
3300009617|Ga0116123_1021478All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2054Open in IMG/M
3300009618|Ga0116127_1008950All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3727Open in IMG/M
3300009618|Ga0116127_1049542All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1212Open in IMG/M
3300009618|Ga0116127_1052975All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1160Open in IMG/M
3300009618|Ga0116127_1054353All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1141Open in IMG/M
3300009618|Ga0116127_1132455Not Available634Open in IMG/M
3300009618|Ga0116127_1183849Not Available510Open in IMG/M
3300009629|Ga0116119_1072328All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium875Open in IMG/M
3300009634|Ga0116124_1137256All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium685Open in IMG/M
3300009636|Ga0116112_1034124All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1589Open in IMG/M
3300009636|Ga0116112_1042833All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1370Open in IMG/M
3300009636|Ga0116112_1060927Not Available1099Open in IMG/M
3300009636|Ga0116112_1073163Not Available983Open in IMG/M
3300009636|Ga0116112_1097279Not Available832Open in IMG/M
3300009637|Ga0116118_1043232All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1620Open in IMG/M
3300009637|Ga0116118_1200788Not Available625Open in IMG/M
3300009640|Ga0116126_1241358Not Available569Open in IMG/M
3300009641|Ga0116120_1068003All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1202Open in IMG/M
3300009646|Ga0116132_1014034All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3037Open in IMG/M
3300009646|Ga0116132_1058926All Organisms → Viruses → Predicted Viral1219Open in IMG/M
3300010341|Ga0074045_10648397Not Available672Open in IMG/M
3300010343|Ga0074044_10014557All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5828Open in IMG/M
3300014162|Ga0181538_10002418All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium19436Open in IMG/M
3300016702|Ga0181511_1298365All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium7731Open in IMG/M
3300017925|Ga0187856_1155466All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium858Open in IMG/M
3300017925|Ga0187856_1330985Not Available519Open in IMG/M
3300017925|Ga0187856_1343202Not Available506Open in IMG/M
3300017929|Ga0187849_1007383All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium8050Open in IMG/M
3300017931|Ga0187877_1056101All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1775Open in IMG/M
3300017931|Ga0187877_1058968All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua → unclassified Candidatus Scalindua → Candidatus Scalindua sp.1716Open in IMG/M
3300017931|Ga0187877_1133273All Organisms → Viruses → Predicted Viral1010Open in IMG/M
3300017931|Ga0187877_1274190Not Available647Open in IMG/M
3300017938|Ga0187854_10210126All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium857Open in IMG/M
3300017938|Ga0187854_10225329All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes820Open in IMG/M
3300017941|Ga0187850_10163547Not Available1037Open in IMG/M
3300017996|Ga0187891_1008369All Organisms → cellular organisms → Bacteria5809Open in IMG/M
3300017996|Ga0187891_1094999All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1137Open in IMG/M
3300017996|Ga0187891_1106522All Organisms → Viruses → Predicted Viral1050Open in IMG/M
3300017996|Ga0187891_1240979Not Available604Open in IMG/M
3300017996|Ga0187891_1305834Not Available518Open in IMG/M
3300017998|Ga0187870_1190454Not Available726Open in IMG/M
3300018003|Ga0187876_1101453All Organisms → Viruses → Predicted Viral1067Open in IMG/M
3300018004|Ga0187865_1106611All Organisms → Viruses → Predicted Viral1023Open in IMG/M
3300018004|Ga0187865_1118175Not Available956Open in IMG/M
3300018004|Ga0187865_1173074Not Available746Open in IMG/M
3300018004|Ga0187865_1215619Not Available650Open in IMG/M
3300018005|Ga0187878_1046667All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1981Open in IMG/M
3300018005|Ga0187878_1063400Not Available1613Open in IMG/M
3300018008|Ga0187888_1179575All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium850Open in IMG/M
3300018013|Ga0187873_1002604All Organisms → cellular organisms → Bacteria13518Open in IMG/M
3300018013|Ga0187873_1089915All Organisms → Viruses → Predicted Viral1231Open in IMG/M
3300018013|Ga0187873_1126206All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium992Open in IMG/M
3300018013|Ga0187873_1147221Not Available902Open in IMG/M
3300018013|Ga0187873_1297956Not Available592Open in IMG/M
3300018013|Ga0187873_1341094Not Available548Open in IMG/M
3300018015|Ga0187866_1135139All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium975Open in IMG/M
3300018016|Ga0187880_1100368All Organisms → Viruses → Predicted Viral1428Open in IMG/M
3300018016|Ga0187880_1259132Not Available763Open in IMG/M
3300018019|Ga0187874_10100293Not Available1262Open in IMG/M
3300018019|Ga0187874_10333378Not Available615Open in IMG/M
3300018019|Ga0187874_10350806Not Available597Open in IMG/M
3300018022|Ga0187864_10065605All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1979Open in IMG/M
3300018022|Ga0187864_10081828All Organisms → Viruses → Predicted Viral1717Open in IMG/M
3300018022|Ga0187864_10099123All Organisms → cellular organisms → Archaea1519Open in IMG/M
3300018022|Ga0187864_10131911Not Available1257Open in IMG/M
3300018023|Ga0187889_10526595Not Available502Open in IMG/M
3300018026|Ga0187857_10081069All Organisms → Viruses → Predicted Viral1601Open in IMG/M
3300018026|Ga0187857_10129777All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1209Open in IMG/M
3300018026|Ga0187857_10152480All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1098Open in IMG/M
3300018026|Ga0187857_10257708Not Available802Open in IMG/M
3300018057|Ga0187858_10160584All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1492Open in IMG/M
3300018057|Ga0187858_10283199All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1055Open in IMG/M
3300022557|Ga0212123_10001591All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium62155Open in IMG/M
3300025419|Ga0208036_1013694All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1807Open in IMG/M
3300025419|Ga0208036_1040639All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium828Open in IMG/M
3300025446|Ga0208038_1039657Not Available961Open in IMG/M
3300025448|Ga0208037_1009210All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2828Open in IMG/M
3300025469|Ga0208687_1052977All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium982Open in IMG/M
3300025480|Ga0208688_1029269All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1330Open in IMG/M
3300025480|Ga0208688_1100043All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium558Open in IMG/M
3300025498|Ga0208819_1000541All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium26561Open in IMG/M
3300025501|Ga0208563_1028406All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1373Open in IMG/M
3300025506|Ga0208937_1069237All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium808Open in IMG/M
3300025576|Ga0208820_1035547All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1486Open in IMG/M
3300029817|Ga0247275_1086917All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium840Open in IMG/M
3300032562|Ga0316226_1148332Not Available1031Open in IMG/M
3300032675|Ga0316225_1090338All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1049Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland47.57%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland43.69%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater1.94%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.94%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.94%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.97%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300016702Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018005Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025419Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025446Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025448Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025469Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025480Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025498Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025501Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025506Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300032562Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017EnvironmentalOpen in IMG/M
3300032675Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062386_10173256113300004152Bog Forest SoilMIPKTLRGALNQIQRMLTKQSYSADLWDILSAIRGPDSRNRKIKHATTTIIRSAAFPNRPCEERSFYGEDSAKRAEIRTRLFKSKGDQNHFRQHVEAAFSALGLSLFEENVWNR*
Ga0073928_10006773103300006893Iron-Sulfur Acid SpringVTPKTLRGALDQIERLLTKQPYSGDLWDVLSAIRGPDSRNRKLKHATTTIIRSAAFPNRPCEERSFYGEDSAKRAEIRTRLFKSKGDQNHFRQHIRDAFKSLGLSLYEENVWSK*
Ga0116128_106334723300009518PeatlandMLTKQSYSADLWDILSAIRGPDSRNKTLKHATTTVIRSVAFPSRPCEERSFYSDDSEKKSEIRKRLFKNKEDFNHFRQHCEAAFDALDLKLFEEN*
Ga0116128_107192113300009518PeatlandKTLRGALQQIERMLDKQPYSADLWDILSAVRGPDSRKWGIKDATTTIIRSAAFPSHPCEERSFYGEDSAEKAETRKRLFKKKQDHRHFRTHVFDAFAALQLSLYELNPKA*
Ga0116128_107464433300009518PeatlandMIPKTLRGALNQIERMLRGRPYSGDLWDIMSCVRGPDSRNKRIKHATTTIIRSAAFPSRPCEERSFYGEDSAKRAEIRKRLFKNKEDFNHFRQHCEAAFDALDLKLFEEN*
Ga0116108_101559543300009519PeatlandVRAPKTLRGALRQIEQMLTKQKYSEDLWAVLTCLRGPDSRNRKLKFATTTVIRSAAFPSRPCETLSYFGTDTAKKAARRKQMFKNKEDFNHFRQHCEAAFDALDLRLFEEN*
Ga0116108_106537323300009519PeatlandMKTPKTLRGALQQIERMLDKQPYSADLWDILSAVRGPDSRKWGIKDATTTIIRSAAFPSHPCEERSFYGEDSAEKAETRKRLFKKKQDHRHFRTHVFDAFAALQLSLYELNPKA*
Ga0116108_110328013300009519PeatlandQPYSADLWDILSAIRGPDSRKWGIKDATTTIIRSEAFPKHPCEERSFYGWDNKRKVTVRKRLFKNKEDSYHFRMHVEEAFNALGLKLFEEN*
Ga0116108_121199323300009519PeatlandLPKTLRGALRQIERMLTKQPYSADLWDVLSAIRGPDSRNKRLKYATTTIIRTAAFPERPCEERSFYGEDSAKKAEVRKQLFKNKEDNNHFREHVADAFASLGLSLFEENVWNK*
Ga0116108_121446323300009519PeatlandMLTKQSYSADLWDILSAIRGPDSRNKKIKHATTTIIRSFAFPSRPCEERSFYGEDSAKRAEIRKRLFKNKEDFNHFRQHCEAAFDALGLKLFEE
Ga0116136_100766463300009547PeatlandMKTPKTLRGALQQIERMLNKQPYSADLWDILSAIRGPDSRKWGIKDATTTIIRSEAFPKHPCEERSFYGWDNKRKVTVRKRLFKNKEDSYHFRMHVEEAFNALGLKLFEEN*
Ga0116136_102602013300009547PeatlandIRGPDSRKWGIKDATTTIIRSEAFPKHPCEERSFYGTDSKKKAAIRRKLFKKKKDHYHFRMHIEDAFDALGLKLFEVNPKA*
Ga0116107_102948733300009548PeatlandMTKQPYSADLWDVLSAIRGPDSRNKRLKYATTTIIRTAAFPERPCEERSFYGEDSAKKAEVRKQLFKNKEDNNHFREHVADAFASLGLSLFEENVWNK*
Ga0116107_105734733300009548PeatlandMLTKQKYSGDLWDVISAIRGPDSRNKRLKHATTTVIRSAAFPSRPCEERSFYGEDSAKRAEIRKRLFKNKEDFNHFRQHCEAAFDALDLRLFEEN*
Ga0116107_107537513300009548PeatlandHMKTPKTLRGALQQIERMLDKQPYSADLWDILSAVRGPDSRKWGIKDATTTIIRSAAFPSHPCEERSFYGEDSAEKAETRKRLFKKKQDHRHFRTHVFDAFAALQLSLYELNPKA*
Ga0116111_103841833300009616PeatlandMLTKQPYSADLWDVLSAIRGPDSRNKRLKYATTTIIRTAAFPERPCEERSFYGEDSAKKAEVRKQLFKNKEDFNHFRQHVEAAFASLGLSLMEENLCMKKS*
Ga0116123_102147853300009617PeatlandYSADLWDILSAIRGPDSRKWGIKDATTTIIRSEAFPKHPCEERSFYGWDNKRKVTVRKRLFKNKEDSYHFRMHVEEAFNALGLKLFEEN*
Ga0116127_100895063300009618PeatlandMRTPKTLRGALDHIQHLLTKQPYSADLWDILSAIRGPDSRNRRLKHATTTIIRSAAFPKRPCEERSFYGEDSAKRAEIRKRVFNSKGDQNHFRQHVAAAFDSLGLKIFEVNHGA*
Ga0116127_104954213300009618PeatlandVIRNVGGGSVRVPKTLRKALDNIQEMLTKQPYSASLWDILSAIRGPDSRNKKYKHATTTIIRSAAFPSRPCEERSFYGDDSAEKAEIRTRLFKSGADLDHFRQHVWDAFDALDLKIFEENCGDHKTPLRRRGRAIRKGKG*
Ga0116127_105297533300009618PeatlandMIPKTLRGALNQIERMLSGRPYSGDLWDIMSCVRGPDSRNKRIKHATTTIIRSAAFPSRPCEERSFYGEDSAKRAEIRKRLFKNKEDFNHFRQHCEAAFDALDLKLFEEN*
Ga0116127_105435313300009618PeatlandVIRNVGGGSVRVPKTLRKALDNIQEMLTKQSYSADLWDILSAIRGPDSRNKTLKHATTTVIRSVAFPSRPCEERSFYSDDSEKKSEIRKRLFKNKEDFNHFRQHCEAAFDALDLKLFEEN
Ga0116127_113245513300009618PeatlandMSLPRTLRGALKQVERMLTNQSYSANLWDIMSCVRGPDSRNKRIKHATTTVIRSAAFPSRPCEKRSFYGEDSAKRAEIRKRLFKNKEDFNHFRQHCEAAFDALDLDCLRRTDGTGDIEFICRRRQRRT*
Ga0116127_118384923300009618PeatlandMLTKQPYSASLWDILSAIRGPDSRNKKYKHATTTIIRSAAFPSRPCEERSFYGEDSAKSAEIRTRLFKSGADLDHFRQHVFDAFDALDLKIFEENCGNHKTPLRRRGRAIRKGKG*
Ga0116119_107232813300009629PeatlandRGALNQIERMLSGRPYSGDLWDIMSCVRGPDSRNKRIKHATTTIIRSAAFPSRPCEERSFYGEDSAKRAEIRKRLFKNKEDFNHFRQHCEAAFDALDLKLFEEN*
Ga0116124_113725613300009634PeatlandSADLWDILSAIRGPDSRKWGIKDATTTIIRSEAFPKHPCEERSFYGTDSKKKAAIRRKLFKKKKDHYHFRMHIEDAFDALGLKLFEVNPKA*
Ga0116112_103412423300009636PeatlandMLTKQPYSANLWEVLSAIRGPDSRNKRLKHATTTIIRTAAFPKRPCEERSFYGEDSAKKAEVRKQLFKNKEDFNHFRQHVEAAFASLGLSLMEENLCMKKS*
Ga0116112_104283343300009636PeatlandNCIQQLLTKQPYSADLWDVLSAIRGPDSRNKRLKYATTTIIRTAAFPERPCEERSFYGEDSAKKAEVRKQLFKNKEDNNHFREHVADAFASLGLSLFEENVWNK*
Ga0116112_106092713300009636PeatlandMSLPRTLRGALKQVERMLTNQSYSANLWDIMSCVRGPDSRNKRIKHATTTIIRSAAFPSRPCEERSFYGEDSAKRAEIRKRLFKNKEDFNHFRQHCEAAFDALDLKLFEEN*
Ga0116112_107316323300009636PeatlandMTPSTLRGALRAIEKMLSGQSYSAQLWDIMSCVRGPDSRNKRIKHATTTIIRSAAFPSRPCEERSFYGNDSRERAETRKKLFKNKEDFNHFRQHCKDAFDALDLRLFEEN*
Ga0116112_109727913300009636PeatlandMKLPVSLRGALRQIERMLTKQSYSADLWDILSAIRGPDSRNKTLKHATTTVIRSVAFPSRPCEERSFYSDDSEKKSEIRKRLFKNKEDFNHFRQHCEAAFDALDLKLFEEN*
Ga0116118_104323223300009637PeatlandMIPKTLRGALNQIERMLRGRPYSGDLWDIMSCVRGPDSRNKRIKHATTTIIRSAAFPSRPCEERSFYGEDSAKRAEIRKRLFKNKEDFNHFRQHCEAAFDALDLRLFEEN*
Ga0116118_120078813300009637PeatlandVIRNVGGGSVRVPKTLRKALDNIQEMLTKQPYSASLWDILSAIRGPDSRNKKYKHATTTIIRSAAFPSRPCEERSFYGDDSAEKAEIRTRLFKSGADLDHFRQHVWDAFDALDLKIFEENCGDHKTPLRRRRRAIRKGKG*
Ga0116126_124135813300009640PeatlandVIRNVGGGSVRVPKTLRKALDNIQEMLTKQPYSASLWDILSAIRGPDSRNKKYKHATTTIIRSAAFPSRPCEERSFYGDDSAEKAEIRTRLFKSGADLDHFRQHVFDAFDALDLKIFEENCGNHKTPLRRRGRAIRKGKG*
Ga0116120_106800313300009641PeatlandLWDILSAIRGPDSRKWGIKDATTTIIRSEAFPKHPCEERSFYGTDSKKKAAIRRKLFKKKKDHYHFRMHIEDAFDALGLKLFEVNPKA*
Ga0116132_101403443300009646PeatlandMTPSTLRGALRVIEKMLSGQSYSAQLWDIMSCVRGPDSRNKRIKHATTTIIRSAAFPSRPCEERSFYGNDSKERAKTRKKLFRNKEDFNHFRQHCEAAFDALDLKLFEEN*
Ga0116132_105892623300009646PeatlandMKTPKTLRGALQQIERMLDKQPYSADLWDILSAVRGPDSRKWGIKDATTTIIRSAAFPSHPCEERSFYGEDSAEKAETRKRLFKKKQDHRHFRTHVFDAFAALQLSLYEVNPKA*
Ga0074045_1064839713300010341Bog Forest SoilMTPSTLRGALRAIEKMLTKQSYSADLWDILSAIRGPDSRVRKVKHATTTVIRSAAFPSRPCEERSFYSEDSAEKVEIRKKLFKNKEDLNHFRQHVEAAFDSLGLKLFEENHGTGNHESVG
Ga0074044_1001455713300010343Bog Forest SoilSGGENDMTPSTLRGALRAIEKMLTKQSYSADLWDILSAIRGPDSRVRKVKHATTTVIRSAAFPSRPCEERSFYSEDSAEKVEIRKKLFKNKEDLNHFRQHVEAAFDSLGLKLFEENHGTGNHESVGRRR*
Ga0181538_10002418123300014162BogVTPKTLRGALNQIQRMLTKQPYSGDLWDILSAIRGPDSRNKRLKHATTTIIRTAAFPKRPCEERSFYGEDSAKKAEVRKRLFKNKEDFNHFRQHVEAAFASLGLSLMEENLCMKKS*
Ga0181511_1298365113300016702PeatlandVTPKTLRGALNQIQRMLTKQPYSGDLWDILSAIRGPDSRNKRLKHATTTIIRTAAFPKRPCEERSFYGEDSAKKAEVRKRLFKNKEDFNHFRQHVEAAFASLGLSLMEENLCMKKS
Ga0187856_115546613300017925PeatlandQPYSADLWDILSAIRGPDSRKWGIKDATTTIIRSEAFPKHPCEERSFYGWDNKRKVTVRKRLFKNKEDSYHFRMHVEEAFNALGLKLFEEN
Ga0187856_133098513300017925PeatlandRTSPKKNGTGFSNRRRNVTPRTLRGALNQIERMLNKQPYSASLWDILSAIRGPDSRNRKYKHATTTIIRSAAFPSRPCEERSFYGEDSAKSAEIRTRLFKNKEDFNHFRQHCEAAFDALDLKLFEEN
Ga0187856_134320223300017925PeatlandMLTKQKYSEDLWAVLTCLRGPDSRNRKLKFATTTVIRSAAFPSRPCETLSYFGTDTAKKAARRKQMFKNKEDFNHFRQHCEAAFDALDLRLFEEN
Ga0187849_100738373300017929PeatlandMKTPKTLRGALQQIERMLNKQPYSADLWDILSAIRGPDSRKWGIKDATTTIIRSEAFPKHPCEERSFYGWDNKRKVTVRKRLFKNKEDSYHFRMHVEEAFNALGLKLFEEN
Ga0187877_105610133300017931PeatlandMTPSTLRGALRAIEKMLSGQSYSAQLWDIMSCVRGPDSRNKRIKHATTTIIRSAAFPSRPCEERSFYGNDSRERAETRKKLFKNKEDFNHFRQHCKDAFDALDLRLFEEN
Ga0187877_105896823300017931PeatlandMIPKTLRGALNQIERMLRGRPYSGDLWDIMSCVRGPDSRNKRIKHATTTIIRSAAFPSRPCEERSFYGEDSAKRAEIRKRLFKNKEDFNHFRQHCEAAFDALDLKLFEEN
Ga0187877_113327333300017931PeatlandKQPYSADLWDILSAVRGPDSRKWGIKDATTTIIRSAAFPSHPCEERSFYGEDSAEKAETRKRLFKKKQDHRHFRTHVFDAFAALQLSLYELNPKA
Ga0187877_127419023300017931PeatlandVRAPKTLRGALRQIEQMLTKQKYSEDLWAVLTCLRGPDSRNRKLKFATTTVIRSAAFPSRPCETLSYFGTDTAKKAARRKQMFKNKEDFNHFRQHCEAAFDALDLRLFEEN
Ga0187854_1021012633300017938PeatlandYSASLWDILSAIRGPDSRNRKYKHATTTIIRSAAFPSRPCEERSFYGEDSAKSAEIRTRLFKSGADLDHFRQHVFDAFDALDLKIFEENCGNHKTPLRRRGRAIRKGKG
Ga0187854_1022532913300017938PeatlandVRVPKTLRKALDNIQEMLTKQSYSADLWDILSAIRGPDSRDKTLKHATTTVIRSVAFPSRPCEERSFYSDDSEKKSEIRKRLFKNKEDFNHFRQHCEAAFDALDLKLFEEN
Ga0187850_1016354713300017941PeatlandMTPSTLRGALRAIEKMLSGQSYSAQLWDIMSCVRGPDSRNKRIKHATTTIIRSAAFPSRPCEERSFYGNDSRERAETRKKLFKNKEDFNHF
Ga0187891_1008369123300017996PeatlandMRTPRTLRGALDQIQQLLTKQPYSANLWEVLSAIRGPDSRNKRLKHATTTVIRTAAFPKRPCEERSFYGEDSAKKAEVRKQLFKNKEDFNHFRQHVEAAFASLGLSLMEENLCMKKS
Ga0187891_109499933300017996PeatlandVRVPKTLRKALDNIQEMLTKQSYSADLWDILSAIRGPDSRNKTLKHATTTVIRSVAFPSRPCEERSFYSDDSEKKSEIRKRLFKNKEDFNHFRQHCEAAFDALDLKLFEEN
Ga0187891_110652213300017996PeatlandLRGALQQIERMLDKQPYSADLWDILSAVRGPDSRKWGIKDATTTIIRSAAFPSHPCEERSFYGEDSAEKAETRKRLFKKKQDHRHFRTHVFDAFAALQLSLYELNPKA
Ga0187891_124097933300017996PeatlandMIPKTLRGALNQIERMLSGRPYSGDLWDIMSCVRGPDSRNKRIKHATTTIIRSAAFPSRPCEERSFYGEDSAKRAEIRKRLFKNKEDFN
Ga0187891_130583423300017996PeatlandMSLPRTLRGALKQVERMLTNQSYSANLWDIMSCVRGPDSRNKRIKHATTTVIRSAAFPSRPCEERSFYGEDSAKRAEIRKRLFKNKEDFNHF
Ga0187870_119045423300017998PeatlandMTPSTLRGALRAIEKMLSGQSYSAQLWDIMSCVRGPDSRNKRIKHATTTIIRSAAFPSRPCEERSFYGNDSRERAETRKKLFKNKEDFNHFRQHCKDAFDALQLSLYEVNPKA
Ga0187876_110145333300018003PeatlandHMKTPKTLRGALQQIERMLDKQPYSADLWDILSAVRGPDSRKWGIKDATTTIIRSAAFPSHPCEERSFYGEDSAEKAETRKRLFKKKQDHRHFRTHVFDAFAALQLSLYELNPKA
Ga0187865_110661123300018004PeatlandVTPRTLRGALNQIERMLNKQPYSASLWDILSAIRGPDSRNRKYKHATTTIIRSAAFPSRPCEERSFYGEDSAKSAEIRTRLFKSGADLDHFRQHVFDAFDALGLKIFEENCGAGNHESVGRRRQRRT
Ga0187865_111817513300018004PeatlandVAPRTLRGALRQIERMLTKQLYSASLWDILSAIRGPDSRNKKYKHATTTIIRSAAFPSRPCEERSFYGDDSAEKAEIRTRLFKSGADLDHFRQHVWDAFDALDLKIFEENCGTSDHEFVG
Ga0187865_117307423300018004PeatlandMKLPVSLRGALRQIERMLTKQSYSADLWDILSAIRGPDSRNKTLKHATTTVIRSVAFPSRPCEERSFYSDDSEKKSEIRKRLFKNKEDFNHFRQHCEAAFDALDLKLFEEN
Ga0187865_121561913300018004PeatlandMRTPKTLRGALDHIQHLLTKQPYSADLWDILSAIRGPDSRNRRLKHATTTIIRSAAFPKRPCEECSFYGEDSAKRAEIRKRVFNSKGDQNHFRQHVAAAFDSLGLKIFEVNHGA
Ga0187878_104666743300018005PeatlandMIPKTLRGALNQIERMLSGRPYSGDLWDIMSCVRGPDSRNKRIKHATTTIIRSAAFPSRPCEERSFYGEDSAKRAEIRKRLFKNKEDFNHFRQHCEAAFDALDLKLFEEN
Ga0187878_106340043300018005PeatlandMKTPKTLRGALQQIERMLDKQPYSADLWDILSAVRGPDSRKWGIKDATTTIIRSAAFPSHPCEERSFYGEDSAEKAETRKRLFKKKQDHRHFRTHVFDAFAALQLSLYELNPKA
Ga0187888_117957523300018008PeatlandMRLPKTLRGALRQIERMLTKQPYSADLWDVLSAIRGPDSRNKRLKYATTTIIRTAAFPERPCEERSFYGEDSAKKAEVRKQLFKNKEDNNHFREHVADAFASLGLSLFEENVWNK
Ga0187873_1002604183300018013PeatlandMRTPRTLRGALDQIQQLLTKQPYSANLWEVLSAIRGPDSRNKRLKHATTTIIRTAAFPKRPCEERSFYGDDSAKKAEIRKRLFKNKEDNNHFREHVRDAFSSLGLSLFEENVCSK
Ga0187873_108991513300018013PeatlandVAPRTLRGALRQIERMLTKQSYSADLWDILSAIRGPDSRNKTLKHATTTVIRSVAFPSRPCEERSFYSDDSEKKSEIRKRLFKNKEDFNHFRQHCEAAFDALDLKLFEEN
Ga0187873_112620623300018013PeatlandMRLPKTLRGALRQIERMLTKQPYSANLWEVLSAIRGPDSRNKRLKHATTTIIRTAAFPKRPCEERSFYGEDSAKKAEVRKQLFKNKEDFNHFRQHVEAAFASLGLSLFEENVWNK
Ga0187873_114722123300018013PeatlandVRVPKTLRGALRQLERMLTKQTYSGDLWDVISAIRGPDSRNKRLKHATTTVIRRAAFPSRPCEERSFYGEDSAKRAEIRKRLFKNKEDFNHFRQHCEAAFDALQLSLYEVNPKA
Ga0187873_129795623300018013PeatlandVRVPKTLRGALRQIEQMLTKKKYSGDLWDVLSAIRGPDSRNKRLKHATTTVIRSAAFPSRPCEERSFYSDDSKKKAEIRKRLFKNKEDFNHYRQHIEAAFDALDLKLFEEN
Ga0187873_134109423300018013PeatlandMLNKQPYSASLWDILSAIRGPDSRNRKYKHATTTIIRSAAFPSRPCEERSFYGEDSAKSAEIRTRLFKSGADLDHFRQHVFDAFDALGLKIFEENCGAGNHESVGRRR
Ga0187866_113513923300018015PeatlandMTPSTLRGALRVIEKMLSGQSYSAQLWDIMSCVRGPDSRNKRIKHATTTIIRSAAFPSRPCEERSFYGNDSRERAETRKKLFKNKEDFNHFRQHCKDAFDALDLRLFEEN
Ga0187880_110036823300018016PeatlandMRTPKTLRGALDHIQHLLTKQPYSADLWDILSAIRGPDSRNKTLKHATTTVIRSVAFPSRPCEERSFYSDDSEKKSEIRKRLFKNKEDFNHFRQHCEAAFDALDLKLFEEN
Ga0187880_125913223300018016PeatlandMTPSTLRGALRAIEKMLSGQSYSASLWDILSAIRGPDSRNKKYKHATTTIIRSAAFPSRPCEERSFYGDDSAEKAEIRTRLFKSGADLDHFRQHVWDAFDALDLKIFEENCGDHKTPLRRWGRAIRKGKG
Ga0187874_1010029313300018019PeatlandVRVPKTLRKALDNIQEMLTKQPYSASLWDILSAIRGPDSRNKKYKHATTTIIRSAAFPSRPCEERSFYGDDSAEKAEIRTRLFKSGADLDHFRQHVWDAFDALDLKIFEENCGTSDHEFVGRRRQRR
Ga0187874_1033337813300018019PeatlandVRVPKTLRGALRQLERMLTKQTYSGDLWDVISAIRGPDSRNKRLKHATTTVIRRAAFPSRPCEERSFYGEDSAKRAEIRKRLFKNKEDFNHFRQHCEAAFDALDLKLFEEN
Ga0187874_1035080613300018019PeatlandKSGIEFLTRRRNVTPRTLRGALRSIEKMLTNQSYSASLWDILSAIRGPDSRNQKFKHATTTIIRSAAFPNRPCEERSFYGDDSAEKAEIRTRLFKSGADLNHFRQHVFDAFDALDLKIFEENCGDHKTPLRRWGRAIRKGKG
Ga0187864_1006560543300018022PeatlandVRVPKTLRGALRQLERMLTKQTYSGDLWDVISAIRGPDSRNKRLKHATTTVIRRAAFPSRPCEERSFYGEDSAKRAEIRKRLFKNKEDSNHFRQHCEAAFDALQLSLYEVNPKA
Ga0187864_1008182843300018022PeatlandMRTPKTLRGALDHIQHLLTKQPYSADLWDILSAIRGPDSRNRRLKHATTTIIRSAAFPKRPCEERSFYGEDSAKRAEIRKRVFNSKGDQNHFRQHVAAAFDSLGLKIFEVNHGA
Ga0187864_1009912323300018022PeatlandMIPKTLRGALNQIERMLRGRPYSGDLWDIMSCVRGPDSRNKRIKHATTTIIRSAAFPSRPCEERSFYGEDSAKRAEIRKRLFKNKEDFNHFRQHCEAAFDALQLSLYEVNPKA
Ga0187864_1013191133300018022PeatlandVAPRTLRGALRQIERMLTKQPYSASLWDILSAIRGPDSRNKKYKHATTTIIRSAAFPSRPCEERSFYGDDSAEKAEIRTRLFKSGADLDHFRQHVWDAFDALDLKIFEENCGTSDHEFVGRRRQRRT
Ga0187889_1052659513300018023PeatlandMRTPKTLRGALDHIQHLLTKQPYSADLWDILSAIRGPDSRNRRLKHATTTIIRSAAFPKRPCEERSFYGEDSAKRAEIRKRVFNSKGDQNHFRQHVSAAFYSLGLKIFEVNHGA
Ga0187857_1008106913300018026PeatlandPRTLRGALRQIERMLTKQTYSASLWDILSAIRGPDSRNKKYKHATTTIIRSAAFPSRPCEERSFYGDDSAEKAEIRTRLFKSGADLDHFRQHVWDAFDALDLKIFEENCGTSDHEFVGRRRQRRT
Ga0187857_1012977733300018026PeatlandMRLPKTLRGALRQIERMLTKQPYSANLWEVLSAIRGPDSRNKRLKHATTTIIRTAAFPKRPCEERSFYGEDSAKKAEVRKQLFKNKEDFNHFRQHVEAAFASLGLSLMEENLCMKKS
Ga0187857_1015248043300018026PeatlandMTPKTLRGALNLIQGMLNKQSYSADLWDILSAIRGPDSRNRKLKRATTAIIRQAAFPMRPCEDRSIFGNDDKAIVVRRRQAFKNKEDNNHFREHVRDAFESLGLSLFEENVWKK
Ga0187857_1025770843300018026PeatlandMIPKTLRGALNQIERMLRGRPYSGDLWDIMSCVRGPDSRNKRIKHATTTIIRSAAFPSRPCEERSFYGEDSAKRAEIRKRLFKNKEDFNHF
Ga0187858_1016058413300018057PeatlandVHKPKTLRGALNCIQQLLTKQPYSADLWDVLSAIRGPDSRNKRLKYATTTIIRTAAFPERPCEERSFYGEDSAKKAEVRKQLFKNKEDNNHFREHVADAFASLGLSLFEENVWNK
Ga0187858_1028319923300018057PeatlandVRVPKTLRKALDNIQEMLTKQSYSADLWDILSAIRGPDSRNRKYKHATTTIIRSAAFPSRPCEERSFYGEDSAKSAEIRTRLFKSGADLDHFRQHVFDAFDALDLKIFEENCGNHKTPLRRRGRAIRKGKG
Ga0212123_10001591563300022557Iron-Sulfur Acid SpringVTPKTLRGALDQIERLLTKQPYSGDLWDVLSAIRGPDSRNRKLKHATTTIIRSAAFPNRPCEERSFYGEDSAKRAEIRTRLFKSKGDQNHFRQHIRDAFKSLGLSLYEENVWSK
Ga0208036_101369443300025419PeatlandKQPYSADLWDILSAIRGPDSRKWGIKDATTTIIRSEAFPKHPCEERSFYGTDSKKKAAIRRKLFKKKKDHYHFRMHIEDAFDALGLKLFEVNPKA
Ga0208036_104063923300025419PeatlandKQPYSADLWDILSAIRGPDSRKWGIKDATTTIIRSEAFPKHPCEERSFYGWDNKRKVTVRKRLFKNKEDSYHFRMHVEEAFNALGLKLFEEN
Ga0208038_103965723300025446PeatlandMIPKTLRGALNQIERMLRGRPYSGDLWDIMSCVRGPDSRNKRLKHATTTIIRSAAFPSRPCEERSFYGEDSAKRAEIRKRLFKNKEDFNHFRQHCEAAFDALDLKLFEEN
Ga0208037_100921013300025448PeatlandMKTPKTLRGALQQIERMLNKQPYSADLWDILSAIRGPDSRKWGIKDATTTIIRSEAFPKHPCEERSFYGTDSKKKAAIRRKLFKKKKDHYHFRMHIEDAFDALGL
Ga0208687_105297723300025469PeatlandMRLPKTLRGALRQIERMLTKQPYSADLWDVLSAVRGPDSRNKRLKYATTTIIRTAAFPERPCEERSFYGEDSAKKAEVRKQLFKNKEDNNHFREHVADAFASLGLSLFEENVWNK
Ga0208688_102926933300025480PeatlandVRAPKTLRGALRQIEQMLTKQKYSGDLWDVISAIRGPDSRNKRLKHATTTVIRSAAFPSRPCEERSFYGEDSAKRAEIRKRLFKNKEDFNHFRQHCEAAFDALDLRLFEEN
Ga0208688_110004323300025480PeatlandLPKTLRGALRQIERMLTKQPYSADLWDVLSAIRGPDSRNKRLKYATTTIIRTAAFPERPCEERSFYGEDSAKKAEVRKQLFKNKEDNNHFREHVADAFASLGLSLFEENVWNK
Ga0208819_1000541333300025498PeatlandLWDILSAIRGPDSRKWGIKDATTTIIRSEAFPKHPCEERSFYGTDSKKKAAIRRKLFKKKKDHYHFRMHIEDAFDALGLKLFEVNPKA
Ga0208563_102840633300025501PeatlandMTPSTLRGALRVIEKMLSGQSYSAQLWDIMSCVRGPDSRNKRIKHATTTIIRSAAFPSRPCEERSFYGNDSKERAKTRKKLFRNKEDFNHFRQHCEAAFDALDLKLFEEN
Ga0208937_106923713300025506PeatlandSADLWDILSAIRGPDSRKWGIKDATTTIIRSEAFPKHPCEERSFYGTDSKKKAAIRRKLFKKKKDHYHFRMHIEDAFDALGLKLFEVNPKA
Ga0208820_103554713300025576PeatlandPYSADLWDILSAIRGPDSRKWGIKDATTTIIRSEAFPKHPCEERSFYGTDSKKKAAIRRKLFKKKKDHYHFRMHIEDAFDALGLKLFEVNPKA
Ga0247275_108691733300029817SoilTKQSYSADLWDILSAIRGPDSRNKTLKHATTTVIRSVAFPSRPCEERSFYSDDSEKKSEIRKRLFKNKEDFNHFRQHCEAAFDALDLKLFEEN
Ga0316226_114833243300032562FreshwaterMKTPKTLRGALQQIERMLDKQPYSADLWDILSAVRGPDSRKWGIKDATTTIIRSEAFPKHPCEERSFYGWDNKRKVTVRKRLFKNKEDSYHFRMHVEEAFNA
Ga0316225_109033813300032675FreshwaterTKQPYSADLWDVLSAIRGPDSRNKRLKYATTTIIRTAAFPERPCEERSFYGEDSAKKAEVRKQLFKNKEDNNHFREHTRDAFASLGLSLFEENVWNK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.