| Basic Information | |
|---|---|
| Family ID | F098673 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 41 residues |
| Representative Sequence | FQGKPVKIEPLINSKTPKNNEKTKKELTTFLGFEIIKQKVANP |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 97.09 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (15.534 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.165 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.320 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.58% β-sheet: 0.00% Coil/Unstructured: 70.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF02130 | YbeY | 74.76 |
| PF02562 | PhoH | 13.59 |
| PF04055 | Radical_SAM | 1.94 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0319 | ssRNA-specific RNase YbeY, 16S rRNA maturation enzyme | Translation, ribosomal structure and biogenesis [J] | 74.76 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 13.59 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 13.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000237|SI34jun09_150mDRAFT_1006263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1751 | Open in IMG/M |
| 3300000251|LPjun08P16500mDRAFT_1032455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 562 | Open in IMG/M |
| 3300001354|JGI20155J14468_10067581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1399 | Open in IMG/M |
| 3300001966|GOS2245_1011408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1068 | Open in IMG/M |
| 3300005606|Ga0066835_10225152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 638 | Open in IMG/M |
| 3300005838|Ga0008649_10283764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 622 | Open in IMG/M |
| 3300007681|Ga0102824_1135472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 647 | Open in IMG/M |
| 3300007692|Ga0102823_1094903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 792 | Open in IMG/M |
| 3300007862|Ga0105737_1069475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 868 | Open in IMG/M |
| 3300007862|Ga0105737_1076607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 830 | Open in IMG/M |
| 3300007957|Ga0105742_1024649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 719 | Open in IMG/M |
| 3300007992|Ga0105748_10041278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1774 | Open in IMG/M |
| 3300008012|Ga0075480_10556826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 546 | Open in IMG/M |
| 3300009058|Ga0102854_1194951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 581 | Open in IMG/M |
| 3300009071|Ga0115566_10185196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1280 | Open in IMG/M |
| 3300009193|Ga0115551_1081865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1533 | Open in IMG/M |
| 3300009449|Ga0115558_1398987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 537 | Open in IMG/M |
| 3300009497|Ga0115569_10299981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 709 | Open in IMG/M |
| 3300009498|Ga0115568_10220225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 867 | Open in IMG/M |
| 3300009593|Ga0115011_12228378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 506 | Open in IMG/M |
| 3300012954|Ga0163111_11272272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 721 | Open in IMG/M |
| 3300017714|Ga0181412_1110066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 642 | Open in IMG/M |
| 3300017717|Ga0181404_1077222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 824 | Open in IMG/M |
| 3300017720|Ga0181383_1122188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 699 | Open in IMG/M |
| 3300017725|Ga0181398_1149437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 554 | Open in IMG/M |
| 3300017731|Ga0181416_1133368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 597 | Open in IMG/M |
| 3300017732|Ga0181415_1111016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 618 | Open in IMG/M |
| 3300017741|Ga0181421_1194590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 519 | Open in IMG/M |
| 3300017742|Ga0181399_1059936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 980 | Open in IMG/M |
| 3300017745|Ga0181427_1153442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 558 | Open in IMG/M |
| 3300017758|Ga0181409_1124619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 760 | Open in IMG/M |
| 3300017762|Ga0181422_1253117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 521 | Open in IMG/M |
| 3300017767|Ga0181406_1102053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 868 | Open in IMG/M |
| 3300017771|Ga0181425_1238938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 563 | Open in IMG/M |
| 3300017781|Ga0181423_1290661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 604 | Open in IMG/M |
| 3300017786|Ga0181424_10269260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 710 | Open in IMG/M |
| 3300017786|Ga0181424_10306768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 658 | Open in IMG/M |
| 3300017824|Ga0181552_10620388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 500 | Open in IMG/M |
| 3300018416|Ga0181553_10395835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 751 | Open in IMG/M |
| 3300018417|Ga0181558_10422912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 703 | Open in IMG/M |
| 3300018428|Ga0181568_11400992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 519 | Open in IMG/M |
| 3300019459|Ga0181562_10567413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 533 | Open in IMG/M |
| 3300020185|Ga0206131_10194493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1004 | Open in IMG/M |
| 3300020191|Ga0181604_10392610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 600 | Open in IMG/M |
| 3300020194|Ga0181597_10104663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1553 | Open in IMG/M |
| 3300020347|Ga0211504_1093607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 680 | Open in IMG/M |
| 3300020352|Ga0211505_1022125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1639 | Open in IMG/M |
| 3300020377|Ga0211647_10047095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1597 | Open in IMG/M |
| 3300020378|Ga0211527_10052144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1272 | Open in IMG/M |
| 3300020431|Ga0211554_10391966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 644 | Open in IMG/M |
| 3300020455|Ga0211664_10025299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2930 | Open in IMG/M |
| 3300020462|Ga0211546_10406656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 684 | Open in IMG/M |
| 3300020468|Ga0211475_10402231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 664 | Open in IMG/M |
| 3300020469|Ga0211577_10221237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1235 | Open in IMG/M |
| 3300020475|Ga0211541_10356498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 715 | Open in IMG/M |
| 3300021087|Ga0206683_10515003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 587 | Open in IMG/M |
| 3300021335|Ga0213867_1203859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 656 | Open in IMG/M |
| 3300021371|Ga0213863_10132256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1155 | Open in IMG/M |
| 3300021378|Ga0213861_10518946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 561 | Open in IMG/M |
| 3300021959|Ga0222716_10426803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 763 | Open in IMG/M |
| 3300021960|Ga0222715_10379443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 779 | Open in IMG/M |
| 3300021964|Ga0222719_10053182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3077 | Open in IMG/M |
| 3300021964|Ga0222719_10475703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 756 | Open in IMG/M |
| 3300021964|Ga0222719_10773621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 531 | Open in IMG/M |
| 3300022909|Ga0255755_1280491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 590 | Open in IMG/M |
| (restricted) 3300022920|Ga0233426_10308497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 612 | Open in IMG/M |
| 3300022927|Ga0255769_10111370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1367 | Open in IMG/M |
| 3300022927|Ga0255769_10169029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1001 | Open in IMG/M |
| 3300024191|Ga0228636_1057354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 919 | Open in IMG/M |
| (restricted) 3300024260|Ga0233441_1184395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 636 | Open in IMG/M |
| 3300024296|Ga0228629_1148107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 613 | Open in IMG/M |
| 3300024297|Ga0228658_1006406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3129 | Open in IMG/M |
| 3300024319|Ga0228670_1050164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 946 | Open in IMG/M |
| 3300024328|Ga0228635_1122357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 568 | Open in IMG/M |
| 3300024329|Ga0228631_1059846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 996 | Open in IMG/M |
| 3300024420|Ga0228632_1065788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 848 | Open in IMG/M |
| 3300025458|Ga0209559_1021347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1471 | Open in IMG/M |
| 3300025685|Ga0209095_1063521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1272 | Open in IMG/M |
| 3300025685|Ga0209095_1119899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 801 | Open in IMG/M |
| 3300025685|Ga0209095_1136333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 730 | Open in IMG/M |
| 3300025694|Ga0209406_1189717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 624 | Open in IMG/M |
| 3300025707|Ga0209667_1104766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 896 | Open in IMG/M |
| 3300025822|Ga0209714_1119698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 705 | Open in IMG/M |
| 3300025879|Ga0209555_10185542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 846 | Open in IMG/M |
| 3300027553|Ga0208947_1027511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1496 | Open in IMG/M |
| 3300027906|Ga0209404_10151957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1409 | Open in IMG/M |
| 3300027906|Ga0209404_10284265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1051 | Open in IMG/M |
| 3300028129|Ga0228634_1089276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 695 | Open in IMG/M |
| 3300028135|Ga0228606_1089406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 795 | Open in IMG/M |
| 3300028177|Ga0257122_1061780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1157 | Open in IMG/M |
| 3300028194|Ga0257106_1145023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 837 | Open in IMG/M |
| 3300028196|Ga0257114_1097996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1198 | Open in IMG/M |
| 3300028277|Ga0257116_1074351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 944 | Open in IMG/M |
| 3300028397|Ga0228639_1029572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1696 | Open in IMG/M |
| 3300031766|Ga0315322_10855284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 557 | Open in IMG/M |
| 3300031773|Ga0315332_10662485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 645 | Open in IMG/M |
| 3300031851|Ga0315320_10586468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 735 | Open in IMG/M |
| 3300032011|Ga0315316_10877687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 736 | Open in IMG/M |
| 3300032032|Ga0315327_10435951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 818 | Open in IMG/M |
| 3300032047|Ga0315330_10232782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1181 | Open in IMG/M |
| 3300032047|Ga0315330_10761531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 558 | Open in IMG/M |
| 3300032073|Ga0315315_11673958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 545 | Open in IMG/M |
| 3300032134|Ga0315339_1062862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1314 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 15.53% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 12.62% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.68% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 9.71% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 9.71% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 8.74% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 5.83% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.85% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.88% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 3.88% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 2.91% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.91% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.94% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.97% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.97% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.97% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.97% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.97% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.97% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000237 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 150m | Environmental | Open in IMG/M |
| 3300000251 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P16 500m | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300001966 | Marine microbial communities from Roca Redonda, Equador - GS030 | Environmental | Open in IMG/M |
| 3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
| 3300005838 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNA | Environmental | Open in IMG/M |
| 3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
| 3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300007957 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_3.0um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
| 3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
| 3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
| 3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
| 3300020455 | Marine microbial communities from Tara Oceans - TARA_B100000965 (ERX555917-ERR599081) | Environmental | Open in IMG/M |
| 3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
| 3300021087 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022909 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG | Environmental | Open in IMG/M |
| 3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300024191 | Seawater microbial communities from Monterey Bay, California, United States - 45D | Environmental | Open in IMG/M |
| 3300024260 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_135_MG | Environmental | Open in IMG/M |
| 3300024296 | Seawater microbial communities from Monterey Bay, California, United States - 36D | Environmental | Open in IMG/M |
| 3300024297 | Seawater microbial communities from Monterey Bay, California, United States - 71D | Environmental | Open in IMG/M |
| 3300024319 | Seawater microbial communities from Monterey Bay, California, United States - 85D | Environmental | Open in IMG/M |
| 3300024328 | Seawater microbial communities from Monterey Bay, California, United States - 44D | Environmental | Open in IMG/M |
| 3300024329 | Seawater microbial communities from Monterey Bay, California, United States - 39D | Environmental | Open in IMG/M |
| 3300024420 | Seawater microbial communities from Monterey Bay, California, United States - 40D | Environmental | Open in IMG/M |
| 3300025458 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_110m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025694 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025707 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300025879 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027553 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028129 | Seawater microbial communities from Monterey Bay, California, United States - 42D | Environmental | Open in IMG/M |
| 3300028135 | Seawater microbial communities from Monterey Bay, California, United States - 7D | Environmental | Open in IMG/M |
| 3300028177 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_120 | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300028277 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_120m | Environmental | Open in IMG/M |
| 3300028397 | Seawater microbial communities from Monterey Bay, California, United States - 50D | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032134 | Ammonia-oxidizing marine archaeal communities from Pacific Ocean, United States - ASW #17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SI34jun09_150mDRAFT_10062633 | 3300000237 | Marine | IDPLINSKIPKNNEKEKKELTVFLGFEIMKHKVTNP* |
| LPjun08P16500mDRAFT_10324551 | 3300000251 | Marine | PLINSKIPKNNEKEKKELTVFLGFEIMKHKVTNP* |
| JGI20155J14468_100675811 | 3300001354 | Pelagic Marine | PVKIEPLINSKTPKNNEKTRKELTIFLDFEIIKQKVTNP* |
| GOS2245_10114083 | 3300001966 | Marine | KIEPLINSKTPKNNAKTKKELTTFLEFEIIKQKVANP* |
| Ga0066835_102251522 | 3300005606 | Marine | IEPLINSKTPKNNTKTKKELTTFLEFEIIKQKVANP* |
| Ga0008649_102837641 | 3300005838 | Marine | IEPLINSKTPRNNEKTKKELNNFFGFEIIKQKVANP* |
| Ga0102824_11354722 | 3300007681 | Estuarine | FQGKPVKIEPLINSKTPRNNEKIKKELTTFLDFEIIKQKVASP* |
| Ga0102823_10949032 | 3300007692 | Estuarine | KIEPLINSKTPKNNVKTKKQLTTFLEFEIIKQKVANP* |
| Ga0105737_10694752 | 3300007862 | Estuary Water | IKFQGKPVKIEPLINSKIPKINEKTKNELTTFFGFIIIKHKVTTP* |
| Ga0105737_10766072 | 3300007862 | Estuary Water | KIEPLINSKTPKNNEKTRKELTIFLDFEIIKQKVTNP* |
| Ga0105742_10246491 | 3300007957 | Estuary Water | GKPVKIEPLINSKTPKNNEKTKKELNNFIGFEIIKQKVTNP* |
| Ga0105748_100412783 | 3300007992 | Estuary Water | KPVKIEPLINSKTPKNNEKTRKELTIFLDFEIIKQKVTNP* |
| Ga0075480_105568262 | 3300008012 | Aqueous | GKPVKIEPLINSNTPKNNAKTKKELTTFLEFEIIKQKVANP* |
| Ga0102854_11949512 | 3300009058 | Estuarine | KIEPLINSKIPRNNEKTKKELTTFLGFEIKKQKVANP* |
| Ga0115566_101851961 | 3300009071 | Pelagic Marine | AIKFQGKPVKIEPLKNSKIAKIKEKTKKEIIIFSDFKIIKTRVIIP* |
| Ga0115551_10818653 | 3300009193 | Pelagic Marine | EPLINSKIPRNNEKTKKELTTFLGFEIIKQNVANP* |
| Ga0115558_13989871 | 3300009449 | Pelagic Marine | AIKFQGKPVKIEPLINSKTPKNNAKTKKELTTLLEFEIIKQKVANP* |
| Ga0115569_102999812 | 3300009497 | Pelagic Marine | FQGKPVKIEPLINSKTPKNNEKTRKELTIFLDFEITKQKVNNP* |
| Ga0115568_102202252 | 3300009498 | Pelagic Marine | IKFQGKPVKIDPLINSIIPKIRVKTKNELIIFLGFRIKKRYETNP* |
| Ga0115011_122283782 | 3300009593 | Marine | KIEPLINSKTPKDNEKTKKELTVFLGFEIIKQKVVNP* |
| Ga0163111_112722721 | 3300012954 | Surface Seawater | KFHGKPVKIVPLKNSRTPKSNENRKKQLTIFFGFKIIKKYEIKP* |
| Ga0181412_11100662 | 3300017714 | Seawater | PVKIEPLINSKTPKNNAKTKKELTTFLEFEIIKQKVANP |
| Ga0181404_10772222 | 3300017717 | Seawater | KIDPLKNSKIPKNNEKEKKELTVFLGFEIMKHKVNNP |
| Ga0181383_11221881 | 3300017720 | Seawater | PVKIEPLKNSKIPRNSEKTKKELTTFLGFEIKKQKVANP |
| Ga0181398_11494372 | 3300017725 | Seawater | SNXLEKLYAIKFQGKPVKIEPLINSKVPKINEKNKNEITIFFCLKIIKK |
| Ga0181416_11333682 | 3300017731 | Seawater | EPLINSKTTKNNAKTKKELTTFLEFEIIKQKVANP |
| Ga0181415_11110162 | 3300017732 | Seawater | REPLINSKIPKIREKVKKELIIFFGFRIKKNKETKP |
| Ga0181421_11945902 | 3300017741 | Seawater | GKPVRIEPLKNSKTPRNNEKTKKELTTFLDFEIIKQKVANP |
| Ga0181399_10599361 | 3300017742 | Seawater | PVKIEPLINSKTPKNNAKTKKELTTFLEFEIIKQKVTNP |
| Ga0181427_11534421 | 3300017745 | Seawater | AIKFQGKPVKIEPLINSKTPKNNEKTKKELTAFLEFEIIKQKVANP |
| Ga0181409_11246191 | 3300017758 | Seawater | PVKIEPLINSKTPKNNAKTKKELTTFLDFEIIKQRVANP |
| Ga0181422_12531171 | 3300017762 | Seawater | AIKFQGKPVKIEPLINSKTPKNNAKTKKELTTFLEFEIIKQKVANP |
| Ga0181406_11020531 | 3300017767 | Seawater | TIKFHGKPVKIEPLINSKIPKITEKIRKQLVTLFCFKSIKKQETNP |
| Ga0181425_12389382 | 3300017771 | Seawater | PVKIEPLKNSKIPRNSEKTKKELTTFLGFKIKKQKVANP |
| Ga0181423_12906612 | 3300017781 | Seawater | GKPVKIEPLKNSQTPRNNEKTKKELTIFFGFEVIKQKIANP |
| Ga0181424_102692601 | 3300017786 | Seawater | GKPVKIEPLINSKIPKNNEKEKKELTVFLGFEIIKQKVANP |
| Ga0181424_103067681 | 3300017786 | Seawater | LEKLYAIKFQGKHVKIEPLIYSKIPKVNEKIKNDLTIFLGLNIIKIKETNP |
| Ga0181552_106203881 | 3300017824 | Salt Marsh | IKFHGKPVKIEPLINSKTPKNNAKTKKELTTFLDLEIIKQRVANP |
| Ga0181553_103958351 | 3300018416 | Salt Marsh | IEPLINSKIPKNNAKTKKELTTFLEFEIIKQKVANP |
| Ga0181558_104229122 | 3300018417 | Salt Marsh | VKIEPLINSKIPKNNAKNKKELTTFLEFEIIKQKVANP |
| Ga0181568_114009921 | 3300018428 | Salt Marsh | KFQGKPVKIEPLINSKTPKNNAKTKNELTTFLEFEIIKQKVANP |
| Ga0181562_105674131 | 3300019459 | Salt Marsh | KIEPLINSKTPKNNEKTKKELTTFLDFEIIKQRVANP |
| Ga0206131_101944931 | 3300020185 | Seawater | VKIEPLINSKTPKNNEKTKKELTTFLGFEIIKQNVANP |
| Ga0181604_103926102 | 3300020191 | Salt Marsh | AIKFQEKPVKIEPLINSKTPKNNEKTKKELTTFLEFEIIKQKVTNP |
| Ga0181597_101046633 | 3300020194 | Salt Marsh | IKFQGKPVKIEPLINSNTPKNNAKTKKELTTFLEFEIIKQKVTNP |
| Ga0211504_10936072 | 3300020347 | Marine | AIKFQGKPVKIEPLINSKIPRNNEKTKKELTTFLGFEIKKQKVANP |
| Ga0211505_10221251 | 3300020352 | Marine | GKPVKIEPLINSKTPKNNAKTKKELTTFLDFEIIKQRVANP |
| Ga0211647_100470953 | 3300020377 | Marine | VKIEPLINSKTPKNNAKTKKELTTFLEFEIIKQKVANP |
| Ga0211527_100521441 | 3300020378 | Marine | IKFQGKPVKIEPLINSKIPKNNAKTKKELTTFLEFKIIKQKVANP |
| Ga0211554_103919661 | 3300020431 | Marine | EPLINSKTPKNNEKTRKELTIFLDFEIIKQKVNNP |
| Ga0211664_100252994 | 3300020455 | Marine | KIEPLINSKIPKNSEKAKKEGIIFFCFEIIKHRVKHP |
| Ga0211546_104066562 | 3300020462 | Marine | KFHGKPVKIEPLINSKIPKIREKVKKELIIFFGFVSKKKKETKP |
| Ga0211475_104022311 | 3300020468 | Marine | IKFQGKPVKIKPLINSKIPKINEKIKNELITFLDLKIIKK |
| Ga0211577_102212373 | 3300020469 | Marine | VNIEPLINSKIPKIKEKTRKELTIFFGFKILKHKETIP |
| Ga0211541_103564982 | 3300020475 | Marine | LNAIKFQGKPVKIEPLINSKIPKNNEKVKKEGIIFFGFEIIKHRVKHP |
| Ga0206683_105150032 | 3300021087 | Seawater | KFQGKPVKIEPLINSKIPKTNEKVRNELTIFFGFKITKHKEINP |
| Ga0213867_12038592 | 3300021335 | Seawater | EPLKNSKIPRNSEKTKKELTTFLGFEIKKQKVANP |
| Ga0213863_101322561 | 3300021371 | Seawater | IKFQGKPVKIEPLINSNTPKNNAKTKKELTTFLEFEIIKQKVANP |
| Ga0213861_105189461 | 3300021378 | Seawater | GKPVKIEPLINSKTPKNNAKTKKELTTFLEFEIIKQKVANP |
| Ga0222716_104268031 | 3300021959 | Estuarine Water | IQEKPVKIEPLINSKTPKNNEKIKKELTTFLEFEIIKQKVTNP |
| Ga0222715_103794431 | 3300021960 | Estuarine Water | KIEPLINSKTPKNNEKTKKELTTFLDFEIIKQKVANP |
| Ga0222719_100531824 | 3300021964 | Estuarine Water | KPVKIDPLINSKTPNNNEKIKKELTIFXGFEIIKQKVTNP |
| Ga0222719_104757032 | 3300021964 | Estuarine Water | VKIEPLINSKTPKNNEKTKKELTTFLDFEIIKQRVANP |
| Ga0222719_107736212 | 3300021964 | Estuarine Water | KPVKIEPLINSNTPKNNAKTKKELTTFLEFEIIKQKVANP |
| Ga0255755_12804911 | 3300022909 | Salt Marsh | PVKIEPLINSKIPKNNAKNKKELTTFLEFEIIKQKVANP |
| (restricted) Ga0233426_103084971 | 3300022920 | Seawater | IEPLINSKTPKNNEKTRKELTIFLDFEIIKQKVTNP |
| Ga0255769_101113703 | 3300022927 | Salt Marsh | VKIEPLINSNTPKNNAKTKKELTTFLEFEIIKQKVANP |
| Ga0255769_101690293 | 3300022927 | Salt Marsh | IEPLINSKTPKNNEKTKKELTTFLEFEIIKQRVANP |
| Ga0228636_10573541 | 3300024191 | Seawater | VKIEPLKNSKIPRNSEKTKKELTTFLGFEIKKQKVANP |
| (restricted) Ga0233441_11843951 | 3300024260 | Seawater | KIEPLINSKTPKNNEKTRKELTIFLDFEIIKQKVTNP |
| Ga0228629_11481071 | 3300024296 | Seawater | QGKPVNIEPLINSKIPKITEKTRKELTIFFGFKILKHKETIQ |
| Ga0228658_10064061 | 3300024297 | Seawater | KPVKIEPLINSKTPKNNAKTKNELTTFLEFEILKQKVANP |
| Ga0228670_10501642 | 3300024319 | Seawater | GKPVKIDPLINSKTPNNNEKIKKELTIFWGFEIIKQKVTNP |
| Ga0228635_11223571 | 3300024328 | Seawater | VKIEPLINSKTPKNNEKTRKELTIFLDFEIIKQKVTNP |
| Ga0228631_10598463 | 3300024329 | Seawater | FQGKPVKIEPLINSKTPKNNEKTRKELTIFLDFEIIKQKVTNP |
| Ga0228632_10657881 | 3300024420 | Seawater | IEPLINSKTPKNNAKTKKELTTFLDFEIIKQRVANP |
| Ga0209559_10213471 | 3300025458 | Marine | KPVKIDPLINSKIPKNNEKEKKELTVFLGFEIMKHKVTNP |
| Ga0209095_10635211 | 3300025685 | Pelagic Marine | AIKFHGKPVKIDPLINSKTPNNNEKIKKELTIFRGFEIIKQKVTNP |
| Ga0209095_11198992 | 3300025685 | Pelagic Marine | FQGKPVKIEPLMNSKIPKINEKTKNELTTFFGFIIIKHKVTTP |
| Ga0209095_11363331 | 3300025685 | Pelagic Marine | AIKFHGKPVKIDPLINSKTPNNNEKIKKELTIFRGFEIIKQKATNP |
| Ga0209406_11897172 | 3300025694 | Pelagic Marine | LTKLYAIKFQGKPVKIEPLINSKTPKNNEKTRKELTIFLDFEITKQKVNNP |
| Ga0209667_11047662 | 3300025707 | Marine | FQGKPVKIEPLINSKTPRNNEKTKKELNNFFGFEIIKQKVANP |
| Ga0209714_11196982 | 3300025822 | Pelagic Marine | KIEPLINSKTPKNNEKTRKELTIFLDFEITKQKVNNP |
| Ga0209555_101855422 | 3300025879 | Marine | VKIEPLINSKIPKNNEKTKKELTTFLEFEIIKKRVANP |
| Ga0208947_10275111 | 3300027553 | Marine | IEPLINSKTAKNNEKTKKELTTFLEFEIIKQKVANP |
| Ga0209404_101519573 | 3300027906 | Marine | AIKFQGKPVKIEPLINSKTPKNNEKTKKELTIFLGFEIIKQKVANP |
| Ga0209404_102842653 | 3300027906 | Marine | IEPLINSKIPKNNEKEKKELTVFLGFEIIKHKVTNP |
| Ga0228634_10892762 | 3300028129 | Seawater | VKIEPLINSKTPKNNAKTKKELTTFLDFEIIKQRVANP |
| Ga0228606_10894061 | 3300028135 | Seawater | KFQGKPVKIEPLINSKTPKNNEKTRKELTIFLDFEIIKQKVTNP |
| Ga0257122_10617803 | 3300028177 | Marine | RFQGKPVKIEPLINSKIPKNNEKEKKELTIFLGFEIKKHKLTNP |
| Ga0257106_11450231 | 3300028194 | Marine | ANKFQGKPVKIEPLINSKTPKNNEKTKKELTIFIGFEIIKQKVANP |
| Ga0257114_10979963 | 3300028196 | Marine | IKFQGKPVKIEPLINSKTPKNNEKTRKELTIFLDFEIIKQKVTNP |
| Ga0257116_10743511 | 3300028277 | Marine | QGKPVKIDPLINSKIPKNNEKEKKELTVFLGFEIIKHKVTNP |
| Ga0228639_10295721 | 3300028397 | Seawater | VKIEPLINSKTPKNNEKTKKELTTFLDFEIIKQKVTNP |
| Ga0315322_108552842 | 3300031766 | Seawater | QGKPVNIEPLINSKIPKIKEKTRKELTIFFGFKILKHKETIP |
| Ga0315332_106624851 | 3300031773 | Seawater | IEPLINSKIPKNNEKEKKELTVFFVFKITKHKVTNP |
| Ga0315320_105864682 | 3300031851 | Seawater | FQGKPVKIEPLINSKIPKNNEKEKKELTIFLGFEIKKHKLTNP |
| Ga0315316_108776872 | 3300032011 | Seawater | KLCAIKFQGKPVKIEPLINSQTPRNNEKTKKELTIFFGFEIIKQKIANP |
| Ga0315327_104359511 | 3300032032 | Seawater | IKFQGKPVKIEPLINSKIPKNNEKEKKELTVFLGFEIIKHKVTNP |
| Ga0315330_102327823 | 3300032047 | Seawater | AIKFQGKPVKIEPLINSKTPKNNEKTKKELTTFLDFEIIKQKVTNP |
| Ga0315330_107615311 | 3300032047 | Seawater | VKIEPLINSKTPKNNAKTKNELTTFLEFEIIKQKVANP |
| Ga0315315_116739581 | 3300032073 | Seawater | FQGKPVKIEPLINSKTPKNNEKTKKELTTFLGFEIIKQKVANP |
| Ga0315339_10628623 | 3300032134 | Seawater | IKFQGKPVKIEPLINSKIPKNNEKEKKELTIFLGFETIKHKVTNP |
| ⦗Top⦘ |