| Basic Information | |
|---|---|
| Family ID | F098635 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 43 residues |
| Representative Sequence | ETKTHAKASGAAKKAVNVAIQYNVWCGGTVHTKTQFTK |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.12 % |
| % of genes from short scaffolds (< 2000 bps) | 82.52 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (82.524 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (42.718 % of family members) |
| Environment Ontology (ENVO) | Unclassified (73.786 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (73.786 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.85% β-sheet: 0.00% Coil/Unstructured: 65.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF12728 | HTH_17 | 3.88 |
| PF12705 | PDDEXK_1 | 2.91 |
| PF02467 | Whib | 0.97 |
| PF01930 | Cas_Cas4 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003277|JGI25908J49247_10000950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9087 | Open in IMG/M |
| 3300003277|JGI25908J49247_10078104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 820 | Open in IMG/M |
| 3300003277|JGI25908J49247_10171227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 502 | Open in IMG/M |
| 3300003388|JGI25910J50241_10112932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
| 3300003404|JGI25920J50251_10064950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
| 3300003411|JGI25911J50253_10011040 | All Organisms → Viruses → Predicted Viral | 3424 | Open in IMG/M |
| 3300005517|Ga0070374_10386304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
| 3300005580|Ga0049083_10145122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
| 3300005805|Ga0079957_1046013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2715 | Open in IMG/M |
| 3300008111|Ga0114344_1125969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
| 3300008114|Ga0114347_1095100 | All Organisms → Viruses → Predicted Viral | 1164 | Open in IMG/M |
| 3300008116|Ga0114350_1194496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300008259|Ga0114841_1126985 | All Organisms → Viruses → Predicted Viral | 1055 | Open in IMG/M |
| 3300008448|Ga0114876_1173189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 761 | Open in IMG/M |
| 3300009159|Ga0114978_10579141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300009165|Ga0105102_10310231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
| 3300009181|Ga0114969_10040696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3156 | Open in IMG/M |
| 3300009183|Ga0114974_10791579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 509 | Open in IMG/M |
| 3300010354|Ga0129333_10636442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 922 | Open in IMG/M |
| 3300010885|Ga0133913_12188249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1364 | Open in IMG/M |
| 3300011010|Ga0139557_1008337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2091 | Open in IMG/M |
| 3300011010|Ga0139557_1023314 | All Organisms → Viruses → Predicted Viral | 1121 | Open in IMG/M |
| 3300011010|Ga0139557_1084259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300011010|Ga0139557_1087148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10234672 | All Organisms → Viruses → Predicted Viral | 1126 | Open in IMG/M |
| 3300013372|Ga0177922_11052516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10294415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
| 3300017701|Ga0181364_1006172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2065 | Open in IMG/M |
| 3300017701|Ga0181364_1037885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
| 3300017722|Ga0181347_1017345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2293 | Open in IMG/M |
| 3300017722|Ga0181347_1156950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 618 | Open in IMG/M |
| 3300017723|Ga0181362_1008120 | All Organisms → Viruses → Predicted Viral | 2249 | Open in IMG/M |
| 3300017723|Ga0181362_1019365 | All Organisms → Viruses → Predicted Viral | 1462 | Open in IMG/M |
| 3300017723|Ga0181362_1125247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300017736|Ga0181365_1000611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8137 | Open in IMG/M |
| 3300017736|Ga0181365_1074486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED43 | 835 | Open in IMG/M |
| 3300017761|Ga0181356_1061085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1281 | Open in IMG/M |
| 3300017761|Ga0181356_1156771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 702 | Open in IMG/M |
| 3300017774|Ga0181358_1049708 | All Organisms → Viruses → Predicted Viral | 1590 | Open in IMG/M |
| 3300017774|Ga0181358_1093212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED43 | 1087 | Open in IMG/M |
| 3300017774|Ga0181358_1138595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 840 | Open in IMG/M |
| 3300017777|Ga0181357_1003741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 6135 | Open in IMG/M |
| 3300017777|Ga0181357_1007796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 4286 | Open in IMG/M |
| 3300017777|Ga0181357_1013535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3250 | Open in IMG/M |
| 3300017777|Ga0181357_1093732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1142 | Open in IMG/M |
| 3300017777|Ga0181357_1279824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 572 | Open in IMG/M |
| 3300017778|Ga0181349_1041813 | All Organisms → Viruses → Predicted Viral | 1816 | Open in IMG/M |
| 3300017778|Ga0181349_1151315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 834 | Open in IMG/M |
| 3300017780|Ga0181346_1051946 | All Organisms → Viruses → Predicted Viral | 1657 | Open in IMG/M |
| 3300017780|Ga0181346_1105746 | All Organisms → Viruses → Predicted Viral | 1089 | Open in IMG/M |
| 3300017780|Ga0181346_1275996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 578 | Open in IMG/M |
| 3300017785|Ga0181355_1280267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300017785|Ga0181355_1367866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300017785|Ga0181355_1396773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 500 | Open in IMG/M |
| 3300018868|Ga0187844_10351629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300019784|Ga0181359_1036290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1910 | Open in IMG/M |
| 3300020172|Ga0211729_10138708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
| 3300020542|Ga0208857_1038832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300021424|Ga0194117_10552784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300021962|Ga0222713_10817885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 518 | Open in IMG/M |
| 3300022407|Ga0181351_1189178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300023179|Ga0214923_10371487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
| 3300027141|Ga0255076_1058563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300027153|Ga0255083_1063023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300027563|Ga0209552_1119175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 696 | Open in IMG/M |
| 3300027608|Ga0208974_1063315 | All Organisms → Viruses → Predicted Viral | 1038 | Open in IMG/M |
| 3300027621|Ga0208951_1174525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 548 | Open in IMG/M |
| 3300027679|Ga0209769_1258612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 528 | Open in IMG/M |
| 3300027720|Ga0209617_10381611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1168206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
| 3300027785|Ga0209246_10017032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2710 | Open in IMG/M |
| 3300027785|Ga0209246_10038475 | All Organisms → Viruses → Predicted Viral | 1831 | Open in IMG/M |
| 3300027785|Ga0209246_10363917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300027798|Ga0209353_10028223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2616 | Open in IMG/M |
| 3300027798|Ga0209353_10110156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1240 | Open in IMG/M |
| 3300027808|Ga0209354_10092290 | All Organisms → Viruses → Predicted Viral | 1234 | Open in IMG/M |
| 3300027956|Ga0209820_1186454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300028392|Ga0304729_1047590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1628 | Open in IMG/M |
| 3300028393|Ga0304728_1129675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 935 | Open in IMG/M |
| (restricted) 3300028557|Ga0247832_1179346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
| 3300031746|Ga0315293_10303334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1281 | Open in IMG/M |
| 3300031772|Ga0315288_10955822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300031857|Ga0315909_10629607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300031857|Ga0315909_10848470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 570 | Open in IMG/M |
| 3300031951|Ga0315904_10386212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1274 | Open in IMG/M |
| 3300031951|Ga0315904_10652267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 894 | Open in IMG/M |
| 3300031997|Ga0315278_11779426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300032050|Ga0315906_10015107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8773 | Open in IMG/M |
| 3300032116|Ga0315903_10022643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6922 | Open in IMG/M |
| 3300032116|Ga0315903_10037653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5076 | Open in IMG/M |
| 3300032116|Ga0315903_10627104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
| 3300032116|Ga0315903_11068153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 557 | Open in IMG/M |
| 3300032397|Ga0315287_12564081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300033816|Ga0334980_0063577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1552 | Open in IMG/M |
| 3300033994|Ga0334996_0097016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1724 | Open in IMG/M |
| 3300034012|Ga0334986_0567796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 545 | Open in IMG/M |
| 3300034092|Ga0335010_0414508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300034101|Ga0335027_0111978 | All Organisms → Viruses → Predicted Viral | 2062 | Open in IMG/M |
| 3300034104|Ga0335031_0254971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1161 | Open in IMG/M |
| 3300034106|Ga0335036_0221515 | All Organisms → Viruses → Predicted Viral | 1298 | Open in IMG/M |
| 3300034112|Ga0335066_0712159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300034122|Ga0335060_0372256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
| 3300034122|Ga0335060_0513994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 42.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.83% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.88% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 3.88% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.91% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.94% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.94% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.97% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.97% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.97% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.97% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020542 | Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300027153 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25908J49247_100009505 | 3300003277 | Freshwater Lake | MMETETKTHAKASGAAKKAVHVAIQYNVWCGGPVYTKTQFTK* |
| JGI25908J49247_100781041 | 3300003277 | Freshwater Lake | LALGAIATMENEIKTHAKATSAAKKAIAIAIQYNIWCGGSINVKTQFTK* |
| JGI25908J49247_101712272 | 3300003277 | Freshwater Lake | LAMMETETKTHAKASGAAKKAINVAVQYNVWCGGPVHTKTQFTK* |
| JGI25910J50241_101129323 | 3300003388 | Freshwater Lake | ETEVKTHAKATSAAKKAVNIAIQYNIWCGGTANVKTQFTK* |
| JGI25920J50251_100649501 | 3300003404 | Freshwater Lake | GLALGALAMMEXETKTHAKASGAAKKAVHVAIQYNIWCGGPVHTKTQFTK* |
| JGI25911J50253_100110408 | 3300003411 | Freshwater Lake | TETITHTKATSAAKKAINIAIQYNVWCGGTPSIKTQFTK* |
| Ga0070374_103863041 | 3300005517 | Freshwater Lake | THAKASGAAKKAVNVAIQYNVWCGGPDHTKTQFTK* |
| Ga0049083_101451221 | 3300005580 | Freshwater Lentic | ETKTHAKASGAAKKAVHVAIQYNVWCGGPVYTKTQFTK* |
| Ga0079957_10460131 | 3300005805 | Lake | LGALAALESETKTHAKASGAAKKAINIAIQYNVWCGGTATVKTQFTK* |
| Ga0114344_11259691 | 3300008111 | Freshwater, Plankton | DTKTHAKAASAAKKAINIAIQYNIWCGGTVSIKTQFTK* |
| Ga0114347_10951001 | 3300008114 | Freshwater, Plankton | AMESETKTHAKASSAAKKAVNIAIQYNVWCGGAVNVKTQFTK* |
| Ga0114350_11944963 | 3300008116 | Freshwater, Plankton | KTHAKASSAAKKAINIAIQYNIWCGGTVSVKTQFTK* |
| Ga0114841_11269853 | 3300008259 | Freshwater, Plankton | GALSAMESETKTHAKASGAAKKAINIAIQYNVWCGGTANVKTQFTK* |
| Ga0114876_11731891 | 3300008448 | Freshwater Lake | ALVALDGDTKTHAKASSAAKKAINIAIQYNIWCGGTVSVKTQFTK* |
| Ga0114978_105791412 | 3300009159 | Freshwater Lake | DAETKTHTKATSAAKKAVNIAIQYNVWCGGTPSIKTQFTK* |
| Ga0105102_103102311 | 3300009165 | Freshwater Sediment | TETRTHAKAASAAKKAINIAIQYNVWCGGVANIKTQFTK* |
| Ga0114969_100406963 | 3300009181 | Freshwater Lake | LGALVSMETETKTHARATGAAKKAINIAIQYNIWCGGTANIKTQFTK* |
| Ga0114974_107915791 | 3300009183 | Freshwater Lake | MMETETKTHAKASGAAKKAVNIAIQYNVWCGGPVHTKTQFTK* |
| Ga0129333_106364424 | 3300010354 | Freshwater To Marine Saline Gradient | ALGALAAMDMERRTHAKAASAAKKAVNIAIQYNVWCGGTANVKTQFTK* |
| Ga0133913_121882493 | 3300010885 | Freshwater Lake | LASMEIETKTHAKATSAAKKAIGVAIQYNIWCGGTINIKTQFTK* |
| Ga0139557_10083371 | 3300011010 | Freshwater | LALGALAMMETETKTHAKASGAAKKAVNVAIQYNVWCGGPVHTKTQFTK* |
| Ga0139557_10233143 | 3300011010 | Freshwater | THAKASGAAKKAVHVAIQYNVWCGGPVYTKTQFTK* |
| Ga0139557_10842591 | 3300011010 | Freshwater | LALGALAMMETETKTHAKASGAAKKAVHVAIQYNIWCGGPVHTKTQFTK* |
| Ga0139557_10871482 | 3300011010 | Freshwater | LALGALAMMETETKTHAKASGAAKKAVHVAIQYNVWCGGTVHVKTQFTK* |
| (restricted) Ga0172367_102346721 | 3300013126 | Freshwater | HAKASAAAKKAINISIEYNVWCGGTANVKTQFTK* |
| Ga0177922_110525162 | 3300013372 | Freshwater | GLALGALAMMETETKTHAKASGAAKKAVNVAIQYNIWCGGPVYTKTQFTK* |
| (restricted) Ga0172376_102944151 | 3300014720 | Freshwater | TRTHAKAASAAKKAINIAIQYNVWCGGTASVKTQFTK* |
| Ga0181364_10061723 | 3300017701 | Freshwater Lake | TLCALAMMETETKTHAKASGAAKKAINVAIQYNVWCGGPVHTKTQFTK |
| Ga0181364_10378851 | 3300017701 | Freshwater Lake | LGALSAMEIETKTHAKASSAAKKAVSIAIQYNIWCGGPVHTKTQFTK |
| Ga0181347_10173451 | 3300017722 | Freshwater Lake | ETKTHAKASGAAKKAVHVAIQYNIWCGGPVHTKTQFTK |
| Ga0181347_11569503 | 3300017722 | Freshwater Lake | ETKTHAKATSAAKKAVTVAIQYNVWCGGPIHIKTQFTK |
| Ga0181362_10081203 | 3300017723 | Freshwater Lake | LGALAMMETETKTHAKASGAAKKAVHVAIQYNVWCGGPVHVKTQFTK |
| Ga0181362_10193651 | 3300017723 | Freshwater Lake | GLALGALAMMETETKTHAKASGAAKKAVHVAIQYNVWCGGPVHVKTQFTK |
| Ga0181362_11252472 | 3300017723 | Freshwater Lake | LALGALAIMENEVKTHAKATSAAKKAVNIAIQYNVWCGGTASVKTQFTK |
| Ga0181365_10006115 | 3300017736 | Freshwater Lake | MEIETKTHAKASGAAKKAVHVAIQYNIWCGGPVHTKTQFTK |
| Ga0181365_10744863 | 3300017736 | Freshwater Lake | KKGAHAKATAAAKKAINIAIQYNIWCGGTVNVKTQFTK |
| Ga0181356_10610851 | 3300017761 | Freshwater Lake | TKTHAKASGAAKKAVNVAIQYNVWCGGPVYTKTQFTK |
| Ga0181356_11567711 | 3300017761 | Freshwater Lake | MEIETKTHTKATSAAKKAVNIAIQYNVWCGGTPSIKTQFTK |
| Ga0181358_10497081 | 3300017774 | Freshwater Lake | ETETKTHAKASGAAKKAVHVAIQYNVWCGGTIHTKTQFTK |
| Ga0181358_10932121 | 3300017774 | Freshwater Lake | KTHAKASGAAKKAVHVANQYNVWCGGPVYTKTQFTK |
| Ga0181358_11385951 | 3300017774 | Freshwater Lake | GALAAMDMERRTHAKATSVAKKAINIAIQYNIWCGGTANIKTQFTK |
| Ga0181357_10037415 | 3300017777 | Freshwater Lake | ALGALAMMETETKTHAKASGAAKKAINVAVQYNVWCGGPVHTKTQFTK |
| Ga0181357_10077961 | 3300017777 | Freshwater Lake | TKTHAKATSAAKKAINIAIQYNVWCGGTVNIKTQFTK |
| Ga0181357_10135351 | 3300017777 | Freshwater Lake | ETKTHAKASGAAKKAVNVAIQYNVWCGGTVHTKTQFTK |
| Ga0181357_10937321 | 3300017777 | Freshwater Lake | GLALGALAMMETETKTHAKASGAAKKAVHVAIQYNVWCGGPVYTKTQFTK |
| Ga0181357_12798242 | 3300017777 | Freshwater Lake | ENEIKTHAKATSAAKKAIAIAIQYNIWCGGSINVKTQFTK |
| Ga0181349_10418133 | 3300017778 | Freshwater Lake | GALAMMETETKTHAKASGAAKKAVHVAIQYNVWCGGPVYTKTQFTK |
| Ga0181349_11513151 | 3300017778 | Freshwater Lake | KTHAKASGAAKKAVNVAIQYNVWCGGPVHTKTQFTK |
| Ga0181346_10519461 | 3300017780 | Freshwater Lake | GTLALGALVALESETKTHAKASGAAKKAINIAIEYNVWCGGTATVKTQFTK |
| Ga0181346_11057461 | 3300017780 | Freshwater Lake | IETETKTHAKASGAAKKAVHVAIQYNVWCGGTIHTKTQFTK |
| Ga0181346_12759962 | 3300017780 | Freshwater Lake | GGLALGALAMMEVETKTHAKASGAAKKAVHVAIQYNIWCGGPVHTKTQFTK |
| Ga0181355_12802673 | 3300017785 | Freshwater Lake | DTKTHAKAASAAKKAINIAIQYNIWCGGTVSIKTQFTK |
| Ga0181355_13678662 | 3300017785 | Freshwater Lake | LGALAVIEIETKTHAKASGAAKKAVNVAIQYNVWCGGTVHTKTQFTK |
| Ga0181355_13967731 | 3300017785 | Freshwater Lake | GGGLALGALAMMETETKTHAKASGAAKKAVHVAIQYNVWCGGPVHVKTQFTK |
| Ga0187844_103516293 | 3300018868 | Freshwater | KTHAKATSAAKKAINVAIQYNIWCGGTANIKTQFTK |
| Ga0181359_10362901 | 3300019784 | Freshwater Lake | IKTHAKATSAAKKAVNIAIQYNVWCGGTASVKTQFTK |
| Ga0211729_101387083 | 3300020172 | Freshwater | LAMGALVALDNDTKTHAKATSAAKKAINIAIQYNIWCGGTVSVKTQFTK |
| Ga0208857_10388321 | 3300020542 | Freshwater | THTKATSAAKKAVNIAIAYNVWCGGTPSIKTQFTK |
| Ga0194117_105527842 | 3300021424 | Freshwater Lake | LTRHARAASVAKKAINIAIQYNVWCGGTPNIKTQFRK |
| Ga0222713_108178851 | 3300021962 | Estuarine Water | KTHAKASSAAKKAVNAAIQYNIWCGGPVNVKTQFTK |
| Ga0181351_11891783 | 3300022407 | Freshwater Lake | VETKTHAKASGAAKKAVNVAIQYNVWCGGPVHTKTQFTK |
| Ga0214923_103714873 | 3300023179 | Freshwater | ETKTHAKASSAAKKAVNIAIQYNVWCGGAVNVKTQFTK |
| Ga0255076_10585633 | 3300027141 | Freshwater | SLGALVALDNDTKTHAKATSAAKKAINIAIQYNIWCGGTVSVKTQFTK |
| Ga0255083_10630233 | 3300027153 | Freshwater | LVALDNDTKTHAKATSAAKKAINIAIQYNIWCGGTVSVKTQFTK |
| Ga0209552_11191753 | 3300027563 | Freshwater Lake | MMETETKTHAKASGAAKKAVHVAIQYNVWCGGPVYTKTQFTK |
| Ga0208974_10633154 | 3300027608 | Freshwater Lentic | MENEVKTHAKATSAAKKAVNIAIQYNVWCGGTASVKTQFTK |
| Ga0208951_11745251 | 3300027621 | Freshwater Lentic | ALGALAMMEVETKTHAKASGAAKKAVHVAIQYNIWCGGPVHTKTQFTK |
| Ga0209769_12586121 | 3300027679 | Freshwater Lake | MEVETKTHAKASGAAKKAVHVAIQYNIWCGGPVHTKTQFTK |
| Ga0209617_103816112 | 3300027720 | Freshwater And Sediment | TKTHAKASGAVKKAVHVAIQYNVWCGGPVHVKTQFTK |
| (restricted) Ga0247833_11682064 | 3300027730 | Freshwater | DTKTHAKASSAAKKAINIAIQYNIWCGGTVSVRTQFTK |
| Ga0209246_100170321 | 3300027785 | Freshwater Lake | AMMETETKTHAKASGAAKKAINVAIQYNVWCGGPVHTKTQFTK |
| Ga0209246_100384753 | 3300027785 | Freshwater Lake | EIKTHAKATSAAKKAIAVAIQYNIWCGGTINVKTQFTK |
| Ga0209246_103639172 | 3300027785 | Freshwater Lake | LGALAMMETETKTHAKASGAAKKAVNVAIQYNVWCGGPVYTKTQFTK |
| Ga0209353_100282231 | 3300027798 | Freshwater Lake | MMETETKTHAKASGAAKKAVHVAIQYNVWCGGTVHVKTQFTK |
| Ga0209353_101101563 | 3300027798 | Freshwater Lake | VETKTHAKASGAAKKAVHVAIQYNIWCGGPVHTKTQFTK |
| Ga0209354_100922901 | 3300027808 | Freshwater Lake | GGLALGALAMMEVEIKTHAKASGAAKKAVNVAIQYNVWCGGPVHTKTQFTK |
| Ga0209820_11864542 | 3300027956 | Freshwater Sediment | THAKAASAAKKAINIAIQYNVWCGGTPSIKTQFTK |
| Ga0304729_10475903 | 3300028392 | Freshwater Lake | LGALVSMEIETKTHARATGAAKKAINVAIQYNIWCGGTANIKTQFTK |
| Ga0304728_11296753 | 3300028393 | Freshwater Lake | LALGALASMEIETKTHAKATSAAKKAIGVAIQYNIWCGGTINIKTQFTK |
| (restricted) Ga0247832_11793461 | 3300028557 | Freshwater | LAMGALVALDGDTKTHAKASSAAKKAINIAIQYNIWCGGTVSVRTQFTK |
| Ga0315293_103033341 | 3300031746 | Sediment | LALGALAMMETETKTHAKASGAAKKAVNIAIQYNVWCGGPVHTKTQFTK |
| Ga0315288_109558223 | 3300031772 | Sediment | LGALAMMETETKTHAKASGAAKKAVNVAIQYNVWCGGPVHTKTQFTK |
| Ga0315909_106296071 | 3300031857 | Freshwater | ALENDTKTHTKATGAAKKAINIAIQYNVWCGGTASIKTQFTK |
| Ga0315909_108484704 | 3300031857 | Freshwater | LDGDTKTHAKASSAAKKAINIAIQYNIWCGGTVSVKTQFTK |
| Ga0315904_103862124 | 3300031951 | Freshwater | IALGALASMDTEIKTHAKASSAAKKSINIAIQYNIWCGGTANVKTQFTK |
| Ga0315904_106522671 | 3300031951 | Freshwater | GTLALGALAAMESEVKTHAKASGAVKKAINIAIEYNVWCGGTANIKTQFTK |
| Ga0315278_117794261 | 3300031997 | Sediment | LGALVAMDAETKTHTKATSAAKKAVNIAIQYNVWCGGTPSIKTQFTK |
| Ga0315906_100151071 | 3300032050 | Freshwater | THAKASGAVKKAINIAIEYNVWCGGTANIKTQFTK |
| Ga0315903_100226431 | 3300032116 | Freshwater | ALAAMESETRTHAKASSAAKKAVNIAIQYNVWCGGAVNVKTQFTK |
| Ga0315903_100376531 | 3300032116 | Freshwater | LALGALAAMESEVKTHAKASGAVKKAINIAIEYNVWCGGTANIKTQFTK |
| Ga0315903_106271041 | 3300032116 | Freshwater | LAAMESEVKTHAKASGAVKKAINIAIEYNVWCGGTANIKTQFTK |
| Ga0315903_110681531 | 3300032116 | Freshwater | SMESEVKTHAKASGAAKKAINIAIEYNVWCGGTANVKTQFTK |
| Ga0315287_125640812 | 3300032397 | Sediment | ALAMMEIEIKTHAKATGAAKKAVNIAIQYNVWCGGTVHTKTQFTK |
| Ga0334980_0063577_1439_1552 | 3300033816 | Freshwater | TKTHAKAASAAKKAINIAIQYNVWCGGTPSIKTQFTK |
| Ga0334996_0097016_2_127 | 3300033994 | Freshwater | LESETKTHAKAASAAKKAINIAIQYNVWCGGTPSIKTQFTK |
| Ga0334986_0567796_391_534 | 3300034012 | Freshwater | MGALVALDGDTKTHAKASSAAKKAINIAIQYNIWCGGTVSIKTQFTK |
| Ga0335010_0414508_3_125 | 3300034092 | Freshwater | DGDTKTHAKASSAAKKAINIAIQYNIWCGGTVSVKTQFTK |
| Ga0335027_0111978_1917_2042 | 3300034101 | Freshwater | MESETKAHAKASGAAKKAINIAIQYNVWCGGTANVKTQFTK |
| Ga0335031_0254971_1027_1152 | 3300034104 | Freshwater | MELETKTHAKASSAAKKAVNIAIQYNIWCGGPVHIKTQFTK |
| Ga0335036_0221515_3_146 | 3300034106 | Freshwater | LGALVALDNDTKTHAKAASAAKKAVNIAIQYNIWCGGTVSVKTQFTK |
| Ga0335066_0712159_1_108 | 3300034112 | Freshwater | THAKASGAAKKAINIAIQYNVWCGGTANVKTQFTK |
| Ga0335060_0372256_640_762 | 3300034122 | Freshwater | ELETKTHAKASGAAKKAINIAIQYNVWCGGTANVKTQFTK |
| Ga0335060_0513994_461_613 | 3300034122 | Freshwater | TLALGALAALESETKTHAKASGAAKKAINIAIQYNVWCGGTATVKTQFTK |
| ⦗Top⦘ |