| Basic Information | |
|---|---|
| Family ID | F098626 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MELGLDQAIMDTPVAREIQRQLQEWLRSRCPDHLGAIMEKMKN |
| Number of Associated Samples | 63 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.61 % |
| % of genes near scaffold ends (potentially truncated) | 28.16 % |
| % of genes from short scaffolds (< 2000 bps) | 76.70 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.233 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (19.417 % of family members) |
| Environment Ontology (ENVO) | Unclassified (89.320 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (42.718 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.30% β-sheet: 0.00% Coil/Unstructured: 50.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF00226 | DnaJ | 22.33 |
| PF00012 | HSP70 | 16.50 |
| PF01909 | NTP_transf_2 | 14.56 |
| PF01934 | HepT-like | 6.80 |
| PF01556 | DnaJ_C | 4.85 |
| PF00684 | DnaJ_CXXCXGXG | 4.85 |
| PF00575 | S1 | 2.91 |
| PF13411 | MerR_1 | 0.97 |
| PF00962 | A_deaminase | 0.97 |
| PF09360 | zf-CDGSH | 0.97 |
| PF00216 | Bac_DNA_binding | 0.97 |
| PF00009 | GTP_EFTU | 0.97 |
| PF14489 | QueF | 0.97 |
| PF01809 | YidD | 0.97 |
| PF13701 | DDE_Tnp_1_4 | 0.97 |
| PF13620 | CarboxypepD_reg | 0.97 |
| PF01424 | R3H | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 16.50 |
| COG0484 | DnaJ-class molecular chaperone with C-terminal Zn finger domain | Posttranslational modification, protein turnover, chaperones [O] | 9.71 |
| COG2361 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 6.80 |
| COG2445 | Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family | General function prediction only [R] | 6.80 |
| COG0759 | Membrane-anchored protein YidD, putatitve component of membrane protein insertase Oxa1/YidC/SpoIIIJ | Cell wall/membrane/envelope biogenesis [M] | 0.97 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.97 |
| COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 0.97 |
| COG1847 | Predicted RNA-binding protein Jag (SpoIIIJ-associated), conains KH and R3H domains | General function prediction only [R] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.23 % |
| Unclassified | root | N/A | 7.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004152|Ga0062386_100314353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1251 | Open in IMG/M |
| 3300004401|Ga0068980_1134981 | Not Available | 680 | Open in IMG/M |
| 3300004470|Ga0068967_1255187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1018 | Open in IMG/M |
| 3300004601|Ga0068934_1233931 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300008786|Ga0103639_1003954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300009518|Ga0116128_1035365 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300009518|Ga0116128_1035545 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300009518|Ga0116128_1044135 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300009518|Ga0116128_1045525 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300009519|Ga0116108_1037555 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300009547|Ga0116136_1011276 | All Organisms → cellular organisms → Bacteria | 3248 | Open in IMG/M |
| 3300009548|Ga0116107_1068149 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300009549|Ga0116137_1057917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1233 | Open in IMG/M |
| 3300009615|Ga0116103_1026093 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
| 3300009617|Ga0116123_1120781 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300009618|Ga0116127_1079564 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300009621|Ga0116116_1052812 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300009629|Ga0116119_1035802 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300009629|Ga0116119_1108884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300009636|Ga0116112_1153206 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300009760|Ga0116131_1234120 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300009839|Ga0116223_10038729 | All Organisms → cellular organisms → Bacteria | 3184 | Open in IMG/M |
| 3300010339|Ga0074046_10160412 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| 3300010339|Ga0074046_10899885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300011080|Ga0138568_1064986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300011089|Ga0138573_1202903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300014156|Ga0181518_10159741 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300014156|Ga0181518_10518157 | Not Available | 563 | Open in IMG/M |
| 3300014158|Ga0181521_10380360 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300014164|Ga0181532_10780023 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300014638|Ga0181536_10515194 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300017823|Ga0187818_10295392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300017925|Ga0187856_1021764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3248 | Open in IMG/M |
| 3300017925|Ga0187856_1067160 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300017925|Ga0187856_1229826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300017929|Ga0187849_1067276 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300017929|Ga0187849_1067973 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
| 3300017931|Ga0187877_1306257 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300017931|Ga0187877_1336718 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300017934|Ga0187803_10413438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300017935|Ga0187848_10263956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 724 | Open in IMG/M |
| 3300017941|Ga0187850_10036600 | All Organisms → cellular organisms → Bacteria | 2630 | Open in IMG/M |
| 3300017943|Ga0187819_10460267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300017955|Ga0187817_10073780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2126 | Open in IMG/M |
| 3300017961|Ga0187778_10381979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 922 | Open in IMG/M |
| 3300017972|Ga0187781_10273299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1197 | Open in IMG/M |
| 3300017975|Ga0187782_10048934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3078 | Open in IMG/M |
| 3300017975|Ga0187782_10250534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1331 | Open in IMG/M |
| 3300017975|Ga0187782_10354637 | Not Available | 1111 | Open in IMG/M |
| 3300017975|Ga0187782_11646811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300018004|Ga0187865_1298370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300018005|Ga0187878_1248677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300018005|Ga0187878_1375364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300018008|Ga0187888_1249574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300018017|Ga0187872_10183368 | Not Available | 977 | Open in IMG/M |
| 3300018018|Ga0187886_1254380 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300018030|Ga0187869_10115228 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300018033|Ga0187867_10074725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1998 | Open in IMG/M |
| 3300018040|Ga0187862_10868659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300018057|Ga0187858_10142273 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300018057|Ga0187858_10351195 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300018085|Ga0187772_10582899 | Not Available | 794 | Open in IMG/M |
| 3300018086|Ga0187769_10294065 | Not Available | 1213 | Open in IMG/M |
| 3300018086|Ga0187769_10380643 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300018086|Ga0187769_11397977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300018088|Ga0187771_10104813 | All Organisms → cellular organisms → Bacteria | 2283 | Open in IMG/M |
| 3300018088|Ga0187771_10290404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1369 | Open in IMG/M |
| 3300018088|Ga0187771_10324754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1291 | Open in IMG/M |
| 3300018088|Ga0187771_11030485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300018090|Ga0187770_11026988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300018090|Ga0187770_11179781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300019275|Ga0187798_1207489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300019284|Ga0187797_1297281 | Not Available | 857 | Open in IMG/M |
| 3300019284|Ga0187797_1299071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300025459|Ga0208689_1094915 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300025469|Ga0208687_1032019 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300025507|Ga0208188_1005964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4316 | Open in IMG/M |
| 3300027854|Ga0209517_10150351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1491 | Open in IMG/M |
| 3300027896|Ga0209777_10348851 | Not Available | 1128 | Open in IMG/M |
| 3300032069|Ga0315282_10012547 | All Organisms → cellular organisms → Bacteria | 12954 | Open in IMG/M |
| 3300032893|Ga0335069_10267478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 2048 | Open in IMG/M |
| 3300033402|Ga0326728_10003387 | All Organisms → cellular organisms → Bacteria | 49746 | Open in IMG/M |
| 3300033402|Ga0326728_10014955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 16294 | Open in IMG/M |
| 3300033402|Ga0326728_10017025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 14671 | Open in IMG/M |
| 3300033402|Ga0326728_10026250 | All Organisms → cellular organisms → Bacteria | 10330 | Open in IMG/M |
| 3300033402|Ga0326728_10032109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8768 | Open in IMG/M |
| 3300033402|Ga0326728_10097452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3584 | Open in IMG/M |
| 3300033402|Ga0326728_10988398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300033405|Ga0326727_10379852 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300033405|Ga0326727_10945074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300033977|Ga0314861_0000637 | All Organisms → cellular organisms → Bacteria | 53065 | Open in IMG/M |
| 3300033977|Ga0314861_0000786 | All Organisms → cellular organisms → Bacteria | 46225 | Open in IMG/M |
| 3300033977|Ga0314861_0000943 | All Organisms → cellular organisms → Bacteria | 41390 | Open in IMG/M |
| 3300033977|Ga0314861_0000997 | All Organisms → cellular organisms → Bacteria | 39971 | Open in IMG/M |
| 3300033977|Ga0314861_0003835 | All Organisms → cellular organisms → Bacteria | 13898 | Open in IMG/M |
| 3300033977|Ga0314861_0003964 | All Organisms → cellular organisms → Bacteria | 13521 | Open in IMG/M |
| 3300033977|Ga0314861_0005709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10269 | Open in IMG/M |
| 3300033977|Ga0314861_0019670 | All Organisms → cellular organisms → Bacteria | 4309 | Open in IMG/M |
| 3300033977|Ga0314861_0083910 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
| 3300033977|Ga0314861_0133831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1227 | Open in IMG/M |
| 3300033977|Ga0314861_0398760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300033977|Ga0314861_0480712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300033982|Ga0371487_0315590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 19.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 18.45% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 15.53% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 14.56% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 9.71% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.80% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.88% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.94% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.97% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.97% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.97% |
| Wetland Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004401 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 77 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004470 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004601 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 22 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300008786 | Microbial communities from wetland soil in Czech Republic - M3_cDNA | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009615 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 | Environmental | Open in IMG/M |
| 3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300011080 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011089 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025469 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062386_1003143531 | 3300004152 | Bog Forest Soil | MELGLDQAIMDSPAAREIQHQLQEWLRSRCPDHLGAILEKMKN* |
| Ga0068980_11349812 | 3300004401 | Peatlands Soil | MELGLDQAIMDSPAAQEIQHQLQEWLRSRCPDHLGAILEKMKN* |
| Ga0068967_12551872 | 3300004470 | Peatlands Soil | MELGLDQAIMDSPAAREIQHQLEEWLRSRCPDHLGAIMEKMKN* |
| Ga0068934_12339312 | 3300004601 | Peatlands Soil | MELMEQTIMDTPVAREIQRQLQEWLRSRCPDHLGAIMEKMKN* |
| Ga0103639_10039542 | 3300008786 | Wetland Soil | MELGLDQAIMDTPVAREIQHQLQEWLRSRCPDHLGAIMEKMKN* |
| Ga0116128_10353651 | 3300009518 | Peatland | MELGLDQAIMDTPVAREIQHHLQEWLRSRCPDHLDPIMEKMKN* |
| Ga0116128_10355451 | 3300009518 | Peatland | MELGLDQAIMDTPVAREIQHQLQEWLRSRCPDHLGPIMAKMKN* |
| Ga0116128_10441353 | 3300009518 | Peatland | MELGLDQAIMDTPVAREIQRQLQEWLRSRCPDHLGPIMAKMRN* |
| Ga0116128_10455251 | 3300009518 | Peatland | MELGLEQAIMDTPVAREIQHHLQEWLRSRCPDHLDPIMAKMKN* |
| Ga0116108_10375551 | 3300009519 | Peatland | QAIMDTPVAREIQHHLQEWLRSRCPDHLDPIMEKMKN* |
| Ga0116136_10112762 | 3300009547 | Peatland | VELGLEQAIMDTPMAREIQRQLQEWLCSRCPDHLNLILEKMKN* |
| Ga0116107_10681492 | 3300009548 | Peatland | MELGLDQAILDTPVAREIQRQLQEWLRSRCPDHLGAIMEKMKN* |
| Ga0116137_10579173 | 3300009549 | Peatland | MELSLDQAIMDSPMAREIQRQLQEWLRSRCPDHLGAIMEKMKN* |
| Ga0116103_10260931 | 3300009615 | Peatland | MELGLEQAIMDTPVAREIQHHLQEWLRSRCTDHLDPIMEKMKN* |
| Ga0116123_11207811 | 3300009617 | Peatland | MELGLDQAILDTPVAREIQRQLQEWLRSRFPDHLGAIMEKMKN* |
| Ga0116127_10795643 | 3300009618 | Peatland | IMDTPVAREIQHHLQEWLRSRCPDHLDPIMAKMKN* |
| Ga0116116_10528121 | 3300009621 | Peatland | QAIMDTPVAREIQHHLQEWLRSRCPDHLDPIMAKMKN* |
| Ga0116119_10358021 | 3300009629 | Peatland | WRQFVELGLEQAIMDTPMAREIQRQLQEWLCSRCPDHLNLILEKMKN* |
| Ga0116119_11088842 | 3300009629 | Peatland | VELGLEQAIMDTPMAREIQRQLQEWLCSRCPDHLN |
| Ga0116112_11532061 | 3300009636 | Peatland | QAIMDTPVAREIQRQLQEWLRSRCPDHLGAIMEKMKN* |
| Ga0116131_12341201 | 3300009760 | Peatland | ELGLEQAIMDTPMAREIQRQLQEWLCSRCPDHLGPIMEKMKN* |
| Ga0116223_100387292 | 3300009839 | Peatlands Soil | MELGLDQAILDTPAAREIQRALQEWLRSRCPDHLGAIMEKMKN* |
| Ga0074046_101604122 | 3300010339 | Bog Forest Soil | MELSLDQAIMDSPVAREIQRQLQEWLRSRCPDHLGAIMEKMEN* |
| Ga0074046_108998852 | 3300010339 | Bog Forest Soil | MELSLDQAIMDSPMAREIQRQLQEWLRSRCPDHLNAIMETMKN* |
| Ga0138568_10649862 | 3300011080 | Peatlands Soil | MELGLDQAIMDSPAAREIQHQLEEWLRSRCPDHLGAIMEKM |
| Ga0138573_12029032 | 3300011089 | Peatlands Soil | MELSLDQKIMDSPMAREIQHELQEWLRSRCPDHLGAIMDKMK |
| Ga0181518_101597412 | 3300014156 | Bog | MELGLDLAIMDTPVAREIQHQLQEWLRSRCPDHLGPIMEKMKN* |
| Ga0181518_105181571 | 3300014156 | Bog | DQAIMDSPAAQEIQHQLQEWLRSRCPDHLGAILEKMKN* |
| Ga0181521_103803603 | 3300014158 | Bog | MELGLDQDIMDTPEAREIHRQLQEWLRSRCPDHLGAIMEKMKN* |
| Ga0181532_107800231 | 3300014164 | Bog | SIMETPEAREIQHQLQEWLRSRCPDHLGEIMAKMKN* |
| Ga0181536_105151942 | 3300014638 | Bog | GLDQDIMDTPEAREIHRQLQEWLRSRCPDHLGAIMEKMKN* |
| Ga0187818_102953922 | 3300017823 | Freshwater Sediment | MELSLDQAIMDTPAAREIQRQLQEWLRARCPDHLGAIMEKMKN |
| Ga0187856_10217642 | 3300017925 | Peatland | VELGLEQAIMDTPMAREIQRQLQEWLCSRCPDHLNLILEKMKN |
| Ga0187856_10671602 | 3300017925 | Peatland | MELGLEQAIMDTPVAREIQHHLQEWLRSRCPDHLDPIMAKMKN |
| Ga0187856_12298261 | 3300017925 | Peatland | MELGLDLAIMDTPVAREIQHQLQEWLRSRCPDHLGP |
| Ga0187849_10672761 | 3300017929 | Peatland | MELGLDQAIMDTPVAREIQHQLQEWLRSRCPDHLGPIMAKMKN |
| Ga0187849_10679732 | 3300017929 | Peatland | MELGLDQAIMDTPVAREIQHHLQEWLRSRCPDHLDPIMEKMKN |
| Ga0187877_13062571 | 3300017931 | Peatland | AIMDTPMAREIQRQLQEWLCSRCPDHLNLILEKMKN |
| Ga0187877_13367182 | 3300017931 | Peatland | MELGLDQAILDTPVAREIQRQLQEWLRSRCPDHLGAIMEKMKN |
| Ga0187803_104134382 | 3300017934 | Freshwater Sediment | MELSLDQAIMDTPVAGEIQRELQEWLRSRCPDHLGAIMEKMKN |
| Ga0187848_102639562 | 3300017935 | Peatland | MELGLDQAIMDSPAAREIQHQLEEWLRSRCPDHLGAIMEKMKN |
| Ga0187850_100366003 | 3300017941 | Peatland | MELGLDQAIMDTPVAREIQRQLQEWLRSRCPDHLGPIMAKMRN |
| Ga0187819_104602671 | 3300017943 | Freshwater Sediment | IMDTPAAREIQRQLQEWLRSRCPDHLGAIMEKMKN |
| Ga0187817_100737802 | 3300017955 | Freshwater Sediment | MELSLDQGIMDTPVAREIQRQLQEWLRSRCPDHLGAIMEKMKN |
| Ga0187778_103819792 | 3300017961 | Tropical Peatland | MELSLDQAIMDTPVAREIQRELQEWLRSRCPDHLGALLQKMKN |
| Ga0187781_102732991 | 3300017972 | Tropical Peatland | MELGLDQAIMESPMAKEIQHQLQEWLRSRCPDHLGAIMEKMKN |
| Ga0187782_100489342 | 3300017975 | Tropical Peatland | MELGLDQAIMDTPVAKEIQRQLQEWLRSRCPDHLGALLQKMKN |
| Ga0187782_102505342 | 3300017975 | Tropical Peatland | MELGIDQAIMESPVAKEIQRQLQEWLRSRCPDHLGEIMEKMKN |
| Ga0187782_103546372 | 3300017975 | Tropical Peatland | MELGLDKAILDSPVAREIQRELQEWLRSRCPDHLGALLEKMKN |
| Ga0187782_116468111 | 3300017975 | Tropical Peatland | MELGLEQAIMDTPVAREIQHQLQEWLRSRCPDHLGAIMEKMKN |
| Ga0187865_12983701 | 3300018004 | Peatland | MELGLDLAIMDTPVAREIQHQLQEWLRSRCPDHLGAIMEKMKN |
| Ga0187878_12486772 | 3300018005 | Peatland | MELNLDQGIMDTPVAREIQRQLQEWLRSRCPDHLGAIMEKMKN |
| Ga0187878_13753641 | 3300018005 | Peatland | QAIMDTPVAREIQHHLQEWLRSRCPDHLDPIMEKMKN |
| Ga0187888_12495743 | 3300018008 | Peatland | MELSLDQGIMASPEAKEIQRQLQEWLRSRCPDHLNLILEKMKN |
| Ga0187872_101833683 | 3300018017 | Peatland | MELGLDLAIMDTPVAREIQHQLQEWLRSRCPDHLGPIMEKMKN |
| Ga0187886_12543803 | 3300018018 | Peatland | ELGLDQAIMDTPVAREIQHHLQEWLRSRCPDHLDPIMEKMKN |
| Ga0187869_101152281 | 3300018030 | Peatland | IMDTPVAREIQHHLQEWLRSRCPDHLDPIMEKMKN |
| Ga0187867_100747252 | 3300018033 | Peatland | MELGLDQAIMDSPAAQEIQHQLQEWLRSRCPDHLGAILEKMKN |
| Ga0187862_108686591 | 3300018040 | Peatland | MELGLDLAIMDTPVAREIQHQLQEWLRSRCPDHLGSIMEKMRN |
| Ga0187858_101422731 | 3300018057 | Peatland | MELGLDQAIMDTPVAREIQHQLQEWLRSRCPDRLGPIMAKMKN |
| Ga0187858_103511953 | 3300018057 | Peatland | FVELGLEQAIMDTPMAREIQRQLQEWLCSRCPDHLNLILEKMKN |
| Ga0187772_105828991 | 3300018085 | Tropical Peatland | LGLDQAIMESPEAQEIQRQLQEWLRSRCPDHLGEIMEKMKN |
| Ga0187769_102940651 | 3300018086 | Tropical Peatland | MELSLDQAIMDTPVASEIQRQLQEWLRSRCPDHLGALLQKMKN |
| Ga0187769_103806432 | 3300018086 | Tropical Peatland | MELSLDQAIMDTPAAREIQRQLQEWLRSRCPDHLGAIMEKMKN |
| Ga0187769_113979771 | 3300018086 | Tropical Peatland | MELSFDQAIMDSPAAKEIQRQLQEWLRSRCPDHLGAIM |
| Ga0187771_101048131 | 3300018088 | Tropical Peatland | IMDSPAAKEIQRQLQEWLRSRCPDHLGAIMEKMKN |
| Ga0187771_102904042 | 3300018088 | Tropical Peatland | MELGLDQAIMDTPVASEIQRELQEWLRSRCPDHLGALLQKMKN |
| Ga0187771_103247542 | 3300018088 | Tropical Peatland | MELGLDQAIMESPMAKEIQRQLQEWLRSRCPDHLGAIMEKMKN |
| Ga0187771_110304852 | 3300018088 | Tropical Peatland | MELSLDQAIMDSPMAREIQRQLQEWLRSRCPDHLGAIMEHMKN |
| Ga0187770_110269882 | 3300018090 | Tropical Peatland | MELSLDTAIMDTPVAREIQRELQEWLRSRCPDHLGALMEK |
| Ga0187770_111797811 | 3300018090 | Tropical Peatland | MELSLDQAIMDSPVAREIQRQLQEWLRSRCPDHLGAIMEKMKN |
| Ga0187798_12074892 | 3300019275 | Peatland | MELGLDQAIMESPVAKEIQRQLQEWLRSRCPDHLGAIMEKMKN |
| Ga0187797_12972811 | 3300019284 | Peatland | MELSLDQAIMDTPVAREIQRQLQEWLRSRCPDHLGAIMEKMKN |
| Ga0187797_12990712 | 3300019284 | Peatland | MELGLDTAIMDSPAAREIQHQLQEWLRSRCPDHLGAIMEKMKN |
| Ga0208689_10949152 | 3300025459 | Peatland | AILDTPVAREIQRQLQEWLRSRCPDHLGAIMEKMKN |
| Ga0208687_10320195 | 3300025469 | Peatland | GLDQAIMDTPVAREIQHHLQEWLRSRCPDHLDPIMEKMKN |
| Ga0208188_10059642 | 3300025507 | Peatland | MELGLDQAIMDSPAAREIQHQLQEWLRSRCPDHLGAIMEKMKN |
| Ga0209517_101503512 | 3300027854 | Peatlands Soil | MELGLDQAILDTPAAREIQHELQEWLRSRCPDHLGAIMEKMKN |
| Ga0209777_103488512 | 3300027896 | Freshwater Lake Sediment | MELGLDQAIMDTPVAREIQHHLQEWLRSRCPDHLDPVMEKMKN |
| Ga0315282_1001254713 | 3300032069 | Sediment | MELNLDLAIMDTPVAREIQRELEEWLRSRCPDHLGSIMEKMKN |
| Ga0335069_102674782 | 3300032893 | Soil | MELGMDQPIMDTPAAREIQRQLQEWLLLRCPDHLGAIMEKVKN |
| Ga0326728_1000338713 | 3300033402 | Peat Soil | MELGLDQAIMDTPAAREIQRQLQEWLRTRCPDHLGAIMEKMKN |
| Ga0326728_1001495511 | 3300033402 | Peat Soil | MELGLDQALMDSPAAREIQRELQEWLRSRCPDHLGASMEKMKN |
| Ga0326728_100170255 | 3300033402 | Peat Soil | MELGLDQDIMDTPAAREIQRQLQEWLRSRCPDHLSAIMETMKN |
| Ga0326728_100262504 | 3300033402 | Peat Soil | MELGLDQAIMDTPVAREIQRQLQEWLRSRCPDHLGAIMEKMKN |
| Ga0326728_100321096 | 3300033402 | Peat Soil | MEMGLDQAIMDSPAAQEIQHQLQEWLRSRCPDHLGAILEKMKN |
| Ga0326728_100974522 | 3300033402 | Peat Soil | MELGLDQAIMDSPAAREIQHQLQEWLRSRCPDHLGAILEKMKN |
| Ga0326728_109883981 | 3300033402 | Peat Soil | DQDIMDTPAAREIQRQLQEWLRSRCPDHLSAVMETMKN |
| Ga0326727_103798521 | 3300033405 | Peat Soil | MELSLDQAIMDSPVAREIQRQLQEWLRSRCPDHLGAIMEKMK |
| Ga0326727_109450742 | 3300033405 | Peat Soil | MELSLDQAIMDSPMAREIQRELQEWLRSRCPDHLGAIMEKMKN |
| Ga0314861_0000637_24798_24929 | 3300033977 | Peatland | MELSLESAIMDTPMAKEIQRELQEWLRSRCPDHLGALMEKMKN |
| Ga0314861_0000786_17462_17593 | 3300033977 | Peatland | MELGLDQAIMDTPVAREIQRELQEWLRSRCPDHLGAIMETMKN |
| Ga0314861_0000943_4314_4445 | 3300033977 | Peatland | MELGLDQAVMDTPVAREIQRQLQEWLRSRCPDHLGVIMETMKN |
| Ga0314861_0000997_26046_26177 | 3300033977 | Peatland | MELGLDQAIMDTPVAREIQRHLQEWVRSRCPDHLGAIMEQMKN |
| Ga0314861_0003835_2183_2314 | 3300033977 | Peatland | MELGLDQAIMDTPVAREIQHQLQEWLRSRCPDHLGEIMEKMKN |
| Ga0314861_0003964_872_1003 | 3300033977 | Peatland | MELSLDQAIMDSPMATEIQRQLQEWLRSRCPDHLGAIMEKMKN |
| Ga0314861_0005709_3239_3370 | 3300033977 | Peatland | MELSLDQAIMDTPVARQIQHELQEWLRSRCPDHLGAIMEHMKN |
| Ga0314861_0019670_445_576 | 3300033977 | Peatland | MELSLDQAIMDSPMAKEIQRQLQEWLRSRCPDHLNAIMETMKN |
| Ga0314861_0083910_1475_1606 | 3300033977 | Peatland | MELGLDEAIMDTPVAREIQHQLQEWLRSRCPDHLGEIMEKMRN |
| Ga0314861_0133831_864_995 | 3300033977 | Peatland | MELSSDQAIMDTPVAREIQRELQEWLRSRCPDHLGALLQKMKN |
| Ga0314861_0398760_121_252 | 3300033977 | Peatland | MELGLDQAIMDTPVAREIQHQLQEWLRSRCPDHLGAVMEKMKN |
| Ga0314861_0480712_346_477 | 3300033977 | Peatland | MELSLDQAIMDSPMAKEIQHQLEEWLRSRCPDHLGAIMEKMKN |
| Ga0371487_0315590_421_552 | 3300033982 | Peat Soil | MELSLDQAIMDSPMAREIQRQLQEWLRSRCPDHLGAIMEKMKN |
| ⦗Top⦘ |