NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F098569

Metagenome / Metatranscriptome Family F098569

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098569
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 50 residues
Representative Sequence ETTSDAVQRGVLAPMQEVSAVIAGMRAGLEFLFSRRRTTSVSEAAQDEQLFI
Number of Associated Samples 76
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.88 %
% of genes near scaffold ends (potentially truncated) 93.20 %
% of genes from short scaffolds (< 2000 bps) 93.20 %
Associated GOLD sequencing projects 74
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.641 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(31.068 % of family members)
Environment Ontology (ENVO) Unclassified
(80.583 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(56.311 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 58.75%    β-sheet: 0.00%    Coil/Unstructured: 41.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF03054tRNA_Me_trans 22.33
PF09837DUF2064 21.36
PF12543DUF3738 0.97
PF01751Toprim 0.97
PF12686DUF3800 0.97
PF00282Pyridoxal_deC 0.97
PF12732YtxH 0.97
PF13683rve_3 0.97
PF02470MlaD 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 22.33
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.64 %
UnclassifiedrootN/A21.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009039|Ga0105152_10136925All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1001Open in IMG/M
3300009518|Ga0116128_1021990All Organisms → cellular organisms → Bacteria → Acidobacteria2162Open in IMG/M
3300009522|Ga0116218_1553083All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300009549|Ga0116137_1033370All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1788Open in IMG/M
3300009549|Ga0116137_1057878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1233Open in IMG/M
3300009549|Ga0116137_1117327All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2762Open in IMG/M
3300009617|Ga0116123_1154517Not Available591Open in IMG/M
3300009641|Ga0116120_1295992All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2501Open in IMG/M
3300009643|Ga0116110_1044199All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius1618Open in IMG/M
3300009644|Ga0116121_1049874Not Available1316Open in IMG/M
3300009645|Ga0116106_1048726Not Available1417Open in IMG/M
3300009645|Ga0116106_1078584All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21077Open in IMG/M
3300009760|Ga0116131_1057359All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1239Open in IMG/M
3300009760|Ga0116131_1067360All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1118Open in IMG/M
3300010341|Ga0074045_10298910All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300010343|Ga0074044_10670753Not Available677Open in IMG/M
3300010343|Ga0074044_10962435Not Available559Open in IMG/M
3300010379|Ga0136449_101423566All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1068Open in IMG/M
3300011269|Ga0137392_10335263All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1252Open in IMG/M
3300014151|Ga0181539_1313290All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2573Open in IMG/M
3300014153|Ga0181527_1408691All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2518Open in IMG/M
3300014155|Ga0181524_10034337All Organisms → cellular organisms → Bacteria → Acidobacteria3445Open in IMG/M
3300014158|Ga0181521_10417227All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia658Open in IMG/M
3300014200|Ga0181526_10701336All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia638Open in IMG/M
3300014496|Ga0182011_10216630All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300014501|Ga0182024_12184714Not Available606Open in IMG/M
3300014638|Ga0181536_10281122All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2782Open in IMG/M
3300014638|Ga0181536_10527250Not Available511Open in IMG/M
3300016728|Ga0181500_1370973Not Available531Open in IMG/M
3300017929|Ga0187849_1084809All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1374Open in IMG/M
3300017929|Ga0187849_1213972All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2747Open in IMG/M
3300017931|Ga0187877_1239724All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2702Open in IMG/M
3300017938|Ga0187854_10026239All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3150Open in IMG/M
3300017972|Ga0187781_10453269All Organisms → cellular organisms → Bacteria → Acidobacteria918Open in IMG/M
3300017972|Ga0187781_10888613All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300017975|Ga0187782_10294046Not Available1225Open in IMG/M
3300017975|Ga0187782_11453788All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2539Open in IMG/M
3300017996|Ga0187891_1167510All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300017996|Ga0187891_1293159Not Available532Open in IMG/M
3300017998|Ga0187870_1241475All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2621Open in IMG/M
3300018002|Ga0187868_1079380Not Available1314Open in IMG/M
3300018004|Ga0187865_1040452All Organisms → cellular organisms → Bacteria → Acidobacteria1942Open in IMG/M
3300018004|Ga0187865_1062961All Organisms → cellular organisms → Bacteria → Acidobacteria1445Open in IMG/M
3300018008|Ga0187888_1360635All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2552Open in IMG/M
3300018009|Ga0187884_10235952All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2747Open in IMG/M
3300018009|Ga0187884_10250569All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia721Open in IMG/M
3300018009|Ga0187884_10424019All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2535Open in IMG/M
3300018009|Ga0187884_10471111All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2505Open in IMG/M
3300018013|Ga0187873_1191877All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2768Open in IMG/M
3300018014|Ga0187860_1344503Not Available568Open in IMG/M
3300018015|Ga0187866_1284046All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2584Open in IMG/M
3300018016|Ga0187880_1123114Not Available1249Open in IMG/M
3300018016|Ga0187880_1198672All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium911Open in IMG/M
3300018018|Ga0187886_1395080All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2505Open in IMG/M
3300018019|Ga0187874_10233729All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300018019|Ga0187874_10282670All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2677Open in IMG/M
3300018021|Ga0187882_1227515All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2727Open in IMG/M
3300018023|Ga0187889_10312459All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2693Open in IMG/M
3300018030|Ga0187869_10235973All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2888Open in IMG/M
3300018030|Ga0187869_10602860All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2519Open in IMG/M
3300018040|Ga0187862_10265693All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21097Open in IMG/M
3300018043|Ga0187887_10204027All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300018046|Ga0187851_10327250All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300018062|Ga0187784_10481506Not Available1001Open in IMG/M
3300018088|Ga0187771_10551368All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2977Open in IMG/M
3300018088|Ga0187771_10562189Not Available966Open in IMG/M
3300018088|Ga0187771_11601876All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300018090|Ga0187770_11142451All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300018468|Ga0066662_11233043All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium760Open in IMG/M
3300019264|Ga0187796_1610087All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2512Open in IMG/M
3300019270|Ga0181512_1442734Not Available556Open in IMG/M
3300019275|Ga0187798_1771066All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia711Open in IMG/M
3300019278|Ga0187800_1736481Not Available528Open in IMG/M
3300019284|Ga0187797_1337874All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300019284|Ga0187797_1457625All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2525Open in IMG/M
3300023088|Ga0224555_1031096All Organisms → cellular organisms → Bacteria2257Open in IMG/M
3300025320|Ga0209171_10582241Not Available541Open in IMG/M
3300025419|Ga0208036_1001497All Organisms → cellular organisms → Bacteria9597Open in IMG/M
3300025432|Ga0208821_1082431All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2526Open in IMG/M
3300025448|Ga0208037_1049246All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium818Open in IMG/M
3300025448|Ga0208037_1090340All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2527Open in IMG/M
3300025460|Ga0208562_1052247All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium884Open in IMG/M
3300028866|Ga0302278_10101123All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300029883|Ga0311327_10521892All Organisms → cellular organisms → Bacteria725Open in IMG/M
(restricted) 3300031877|Ga0315314_1096440All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1251Open in IMG/M
(restricted) 3300031877|Ga0315314_1321034All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300031997|Ga0315278_10369500All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1482Open in IMG/M
3300032069|Ga0315282_10286679All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1088Open in IMG/M
3300032401|Ga0315275_12065615All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300032783|Ga0335079_11429913Not Available686Open in IMG/M
3300032805|Ga0335078_10615364Not Available1366Open in IMG/M
3300032892|Ga0335081_11639747All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300033402|Ga0326728_10000169All Organisms → cellular organisms → Bacteria262722Open in IMG/M
3300033402|Ga0326728_10444214All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1082Open in IMG/M
3300033402|Ga0326728_10977866All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300033402|Ga0326728_10979711Not Available588Open in IMG/M
3300033405|Ga0326727_10002878All Organisms → cellular organisms → Bacteria56914Open in IMG/M
3300033755|Ga0371489_0529689All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2517Open in IMG/M
3300033977|Ga0314861_0362383All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2641Open in IMG/M
3300033983|Ga0371488_0264270All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300033983|Ga0371488_0509979All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia542Open in IMG/M
3300034091|Ga0326724_0132204All Organisms → cellular organisms → Bacteria1576Open in IMG/M
3300034091|Ga0326724_0350455Not Available801Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland31.07%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland16.50%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil9.71%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland8.74%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog6.80%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland5.83%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment4.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.91%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil2.91%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.94%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.94%
Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment0.97%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.97%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.97%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.97%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.97%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.97%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009039Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cmEnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300016728Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019264Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019270Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019275Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019278Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025419Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025432Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025448Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300031877 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP9EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032069Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Ga0105152_1013692523300009039Lake SedimentSAVVKGVRSGLEFLFSRRRAPSVSEATQDEQLFI*
Ga0116128_102199013300009518PeatlandPMQEVSAVIAGMRAGLEFLFSRRRTTSVSEAAQDEQLFI*
Ga0116218_155308313300009522Peatlands SoilIETTSETVQRGVLAPVQEVSAVIKGMQAGLEFLFSRRRTTSVTEAAQDEQLFI*
Ga0116137_103337013300009549PeatlandVQKVETTADAVQRGVLAPMQEVSAVVKGMRAGLEFLFTRRRTTSVSEAAQDEQLFI*
Ga0116137_105787813300009549PeatlandETTSDAVQRGVLAPMQEVSAVIAGMRAGLEFLFSRRRTTSVSEAAQDEQLFI*
Ga0116137_111732713300009549PeatlandKVETTSDAVQRGVLAPMQEVSAVIAGMRAGLEFLFSRRRTTRVSEAAQDEQLFI*
Ga0116123_115451713300009617PeatlandQIVRVDRMVSDLVEKVESTADSVQKGVLGPIQEVSAVVKGVRTGLEFLFSRRRVTNVSEATQDEQLFI*
Ga0116120_129599213300009641PeatlandLVQKVETTADAVQRGVLAPMQEVSAVVKGMRAGLEFLFSRRRTTSVSEAAQDEQLFI*
Ga0116110_104419933300009643PeatlandSDAVQRGVLAPIQEVSAIIKGMQAGLEFLFSRRRTTSASEAAQDEQLFL*
Ga0116121_104987423300009644PeatlandRGVLAPVQEVSAVIKGMQAGLEFLFSRRRTTSVSESAQDEQLFI*
Ga0116106_104872623300009645PeatlandETVQRGVLAPVQEVSAVIKGMQAGLEFLFSRRRKTSVSEAAQDEQLFI*
Ga0116106_107858433300009645PeatlandSAIIKGMQAGLEFLFSRRRTTGVSEAAQDEQLFP*
Ga0116131_105735913300009760PeatlandKVETTSDAVQRGVLAPMQEVSAVIAGMRAGLEFLFSRRRTTSVSEAAQDEQLFI*
Ga0116131_106736013300009760PeatlandMQEVSAVIAGMRAGLEFLFSRRRTTSVSEAAQDEQLFI*
Ga0074045_1029891023300010341Bog Forest SoilLVEKVETTADSVQKGVLGPIQEVSAVVKGVRSGLEFLFSRRRVTNVSEATQDEQLFI*
Ga0074044_1067075323300010343Bog Forest SoilSDAVQRGVLAPVQAVSAVIAGMRAGLAFPFTRRPTTSVSEAPQDEQLFI*
Ga0074044_1096243513300010343Bog Forest SoilVSAVVKGVRSGLEFLFSRRRVTNVSEATQDEQLFI*
Ga0136449_10142356623300010379Peatlands SoilPMQEVSAVVKGMRAGLEFLFSRRRTTSVSEAAQDEQLFI*
Ga0137392_1033526313300011269Vadose Zone SoilIGPVQEISALIKGVRSGFDFLFSRKRSPGVTEVAQDEQLFI*
Ga0181539_131329013300014151BogRGVLAPMQEVSAVIAGMRAGLDFLFSRRRTTSVSEAAQDEQLFI*
Ga0181527_140869113300014153BogLAPVQEVSAVIKGMRAGLEFLVSRRRTTSVSEAAQDEQLFI*
Ga0181524_1003433743300014155BogVLASIQEVSAIIKGMQAGLEFLFSRRRTTSVSKAAQDEQLFK*
Ga0181521_1041722713300014158BogAVQRGVLAPMQEVSAVIAGMRAGLEFLFTRRRTTSVSEAAQDEQLFI*
Ga0181526_1070133613300014200BogQRGVLAPVQEVSAVIKGMQAGLEFLFSRRRTTSVSETAQDDQLFI*
Ga0182011_1021663033300014496FenETTADAVQKGVLGPISEVSAVVKGVRSGLEFLFSRRRVTNVSEATQDEQLFI*
Ga0182024_1218471423300014501PermafrostSGLVDRVESTADVVQKGMLVPINEVSAVMKGVRSGLEFLFSHRRVANVSEATQDEQLFI*
Ga0181536_1028112223300014638BogVDQMVSDLVQKVETTSDAVQRGVLAPMQEVSAVIKGMRAGLEFLFSRRRTTSGSEAAQDEQLFI*
Ga0181536_1052725023300014638BogQEVSAIIKGMQAGLEFLFSRRRTTSVSKAAQDEQLFK*
Ga0181500_137097323300016728PeatlandDLVERVETTADAVQKGVLGPISEVSAVVKGVRSGLEFLFSRRRVTNVSEATQDEQLFI
Ga0187849_108480923300017929PeatlandVQKVETTADAVQRGVLAPMQEVSAVVKGMRAGLEFLFSRRRTTSVSEAAQDEQLFI
Ga0187849_121397213300017929PeatlandKVETTSDAVQRGVLAPMQEVSAVIAGMRAGLEFLFSRRRTTRVSEAAQDEQLFI
Ga0187877_123972413300017931PeatlandPMQEVSAVIAGMRAGLEFLFSRRRTTSVSEAAQDEQLFI
Ga0187854_1002623923300017938PeatlandMVSDLVQKVETTSDAVQRGVLAPIQEVSAIIKGMQAGLEFLFSRRRTTSASEAAQDEQLF
Ga0187781_1045326923300017972Tropical PeatlandPMEEVSAVIKGMRAGLDYLFSRRGKTSATEASADEQQLFI
Ga0187781_1088861313300017972Tropical PeatlandTSETVQRGVLAPIQEVSAVIKGMQAGLEFLFSRRRTTSVSEAAQDEQLFI
Ga0187782_1029404613300017975Tropical PeatlandRMDRMVSDLIEKVETTSATVQRGVLAPIQEVSAVIKGMQAGLEFLFSRRRTTSVTDAAQDDQLFI
Ga0187782_1145378813300017975Tropical PeatlandQEVSAVLKGFQAGLEFLFSRRRTTSVSEATQDEQLFI
Ga0187891_116751013300017996PeatlandGPIREISAVAKGVRSGLEFLLSHRRVTNVSEATQDEQLFI
Ga0187891_129315913300017996PeatlandVQRGVLAPMQEVSAVIAGMRAGLEFLFTRRRTTSVSEAAQDEQLFI
Ga0187870_124147513300017998PeatlandVQRGVLAPIQEFSAVIKGMQAGLEFLFSRRRTTRVSEAAQDEQLFI
Ga0187868_107938023300018002PeatlandVQRGVLAPVQEVSAVIKGMRAGLEFLVSRRRTTSVSEAAQDEQLFI
Ga0187865_104045233300018004PeatlandQKVETTADAVQRGVLAPMQEVSAVVKGMRAGLEFLFSRRRTTSVSEAAQDEQLFI
Ga0187865_106296133300018004PeatlandTSDAVQRGVLAPMQEVSAVIAGMRAGLEFLFSRRRTTSVSEAGQDEQLFI
Ga0187888_136063513300018008PeatlandETTSDAVQRGVLAPMQEVSAVVKGMRAGLEFLFTRRRTTSVSEAAQDEQLFI
Ga0187884_1023595213300018009PeatlandKVETTSDAVQRGVLAPMQEVSAVIAGMRAGLEFLFSRRRTTSVSEAAQDEQLFI
Ga0187884_1025056923300018009PeatlandLAPVQEVSAVIKGMQAGLEFLFSRRRKTSVSEAAQDEQLFI
Ga0187884_1042401913300018009PeatlandETTSDAVQRGVLAPMQEVSAVIAGMRAGLEFLFSRRRTTRVSEAAQDEQLFI
Ga0187884_1047111113300018009PeatlandTSDAVQRGVLAPMQEVSAVIAGMRAGLDFLFSRRRTTSVSEAAQDEQLFI
Ga0187873_119187713300018013PeatlandLVQKVETTSDAVQRGVLAPMQEVSAVIKGMRAGLDFLISRRRTTSVSEAAQDEQLFI
Ga0187860_134450323300018014PeatlandDAVQRGVLAPMQEVSAVIAGMRAGLEFLFTRRRTTSVSEAAQDEQLFI
Ga0187866_128404623300018015PeatlandRGVLGPIQEVSAVVKGVRSGLEFLFSRRRVTNVSEATLDEQLFI
Ga0187880_112311423300018016PeatlandAPIQEVSAVMKGMQAGLEFLFSRRRTTSVSEAAQDEQLFI
Ga0187880_119867223300018016PeatlandMVSDLLQKVETTSDAMQRGVLAPIQEVSAVIKGMRAGLEFLFSHRRTTRVSEAAQDEQLF
Ga0187886_139508013300018018PeatlandVLAPMQEVSAVIAGMRAGLEFLFSRRRTTRVSEAAQDEQLFI
Ga0187874_1023372923300018019PeatlandADAVQKGVIGPIQEVSAVVKGVRSGLEFLFSRRRVTNVSEATQDEQLFI
Ga0187874_1028267023300018019PeatlandEKVETTSDAVQRGVLAPMQEVSAVIKGMRAGLEFLFTRRRTTSVSEAAQDEQLFI
Ga0187882_122751513300018021PeatlandAVQRGVLAPMQEVSAVIAGMRAGLEFLFSRRRTTRVSEAAQDEQLFI
Ga0187889_1031245913300018023PeatlandKVETTSDAVQRGVLAPMQEVSAVIKGMRAGLEFLFTRRRTTSVSEAAQDEQLFI
Ga0187869_1023597323300018030PeatlandGVLAPIQEVSAIIKGMQAGLEFLFSRRRTTGVSEAAQDEQLFP
Ga0187869_1060286013300018030PeatlandTTSDAVQRGVLAPMQEVSAVIAGMRAGLEFLFSRRRTTRVSEAAQDEQLFI
Ga0187862_1026569313300018040PeatlandLVQKVETTSDAVQCGVLAPIQEVSAIIKGMQAGLEFLFSRRRTTGVSEAAQDEQLFP
Ga0187887_1020402713300018043PeatlandTADSVQKGVLGPIHEVSAVVKGVRSGLEFLFTRRRVTNVSEATQDEQLFI
Ga0187851_1032725023300018046PeatlandIVRVDKMVSELVCKVETTADAVQKGVLGPVSEVSAVVKGVRSGLEFLFSRRRVTNVSEATQDEQLFI
Ga0187784_1048150623300018062Tropical PeatlandQVIRMDRMVSDLIEKVETTSETVQRGMLAPIQEVSAVIKGMQAGLEFLFSRRRTTSVSETAQDEQLFI
Ga0187771_1055136823300018088Tropical PeatlandGVLVPLQEVSAVIKGMRAGLEFLFSRRRTTTVSEAAQDEQLFI
Ga0187771_1056218923300018088Tropical PeatlandVDEMVTGLVEKVETTAETVRRGVLAPLQEVSAVVKGVRSGLEFLFSRRRVTNVSEATQDEQLFI
Ga0187771_1160187613300018088Tropical PeatlandEVSAVLKGFQAGLEFLFSRRRTTSVRDAAQDEQLFI
Ga0187770_1114245113300018090Tropical PeatlandVLAPIQEVSAVVKGVRSGLEFLFSRRRVTNVSEATQDEQLFI
Ga0066662_1123304313300018468Grasslands SoilRQVIGPVQEISALIKGVRSGFDFLFSRKRSPGVTEVAQDEQLFI
Ga0187796_161008723300019264PeatlandIIRVDQMVTDLVGKVETTSDTVQRGLLAPIEEVSAVMKGMRAGLEFLFSRRRTTNVSEAAPDEQLFI
Ga0181512_144273413300019270PeatlandKVETTADAVQKGVLGPISEVSAVVKGVRSGLEFLFTRRRVTNVSEATQDEQLFI
Ga0187798_177106623300019275PeatlandVSDLVKKVETTSDAVQRGVLVPLQEVSAVIKGMRAGLEFLFSRRRTTSVSEAAQDEQLFI
Ga0187800_173648113300019278PeatlandIVRVDRMASELAEKVESTADTVQKGVLGPIQEVSAVVKGVRSGLEFLFSRRRVTNVSEATQDEQLFI
Ga0187797_133787423300019284PeatlandDRMVSDLVQKVETTSEAVQRGVLAPIQEVSAVIKGMEAGLGFLFSRRRTTRACETTQDEQLFI
Ga0187797_145762523300019284PeatlandDRMVSDLVQKVETTSEAVQRGVLAPIQEVSAVIKGMEAGLDFLFSRRRTTRACETTQDEQLFI
Ga0224555_103109633300023088SoilPISEVSAVVKGVRSGLEFLFSRRRVTNVSEATQDEQLFI
Ga0209171_1058224123300025320Iron-Sulfur Acid SpringDKVQETVLTPLNEISAVIKGVQSGLEFLFSRRRPAGAGETTQDEQLFI
Ga0208036_100149713300025419PeatlandAPMQEVSAVIAGMRAGLEFLFSRRRTTSVSEAAQDEQLFI
Ga0208821_108243123300025432PeatlandVQRGVLAPMQEVSAVIAGMRAGLEFLFSRRRTTRVSEAAQDEQLFI
Ga0208037_104924623300025448PeatlandGVLAPMQEVSAVIAGMRAGLEFLFSRRRTTRVSEAAQDEQLFI
Ga0208037_109034023300025448PeatlandVQKVETTADAVQRGVLAPMQEVSAVVKGMRAGLEFLFTRRRTTSVSEAAQDEQLFI
Ga0208562_105224713300025460PeatlandLVTKVETTADAVQRGVLAPVQEVSAVIKGMRAGLEFLFSRRRTTSISEAAQDEQLFI
Ga0302278_1010112343300028866BogMVTDLVERVETTADAVQKGVLGPISEVSAVVKGVRSGLEFLFSRRRVTNVSEATQDEQLF
Ga0311327_1052189213300029883BogVERVETTADAVQKGVLGPISEVSAVVKGVRSGLEFLFSRRRVTNVSEATQDEQLFI
(restricted) Ga0315314_109644013300031877SedimentVETTAEVVQRQVLAPVHEVSALITGVRSGLEFLFSRRRASKVSEAAQEEQLFI
(restricted) Ga0315314_132103423300031877SedimentVVEKVENTAAVVRQQVLVPVQEVSAVIHGIRSGLEFLFSRRRAARVTEATQDEQLFI
Ga0315278_1036950013300031997SedimentAVVQRQVLVPVHEISAVIHGIRSGLEFLFSRRRASSVTEATQDEQLFI
Ga0315282_1028667913300032069SedimentQRGVLAPIQEVSALIKGVRSGLEFLFSRRRSTSVTEATQDEQLFI
Ga0315275_1206561523300032401SedimentMVTGVVEKVENTAATVQRQVLVPVQEISAVIHGIRSGLEFLFARRRASSVTEATQDEQLF
Ga0335079_1142991323300032783SoilEKVESTADSVQKGVLGPIQEVSAVVKGVRSGLEFLFSRRRVTNVSEATQDEQLFI
Ga0335078_1061536423300032805SoilAKIESTSETVQRGVLAPVQEVSAVIKGMQAGLEFLFSRRRTTSVSETAQDEQLFI
Ga0335081_1163974713300032892SoilKGVLGPIQEVSAVVKGVRSGLEFLFSRRRVTNVSEATQDEQLFI
Ga0326728_1000016913300033402Peat SoilGPIQEVSAVVKGVRSGLEFLFSRRRVTNVSEATQDEQLFI
Ga0326728_1044421413300033402Peat SoilLAPMQEVSAVIAGMRAGLEFLFSRRRTTSVSEAAQDEQLFI
Ga0326728_1097786613300033402Peat SoilDLVEKVDTTSEAVQRGVLAPIQEISAIIKGMQAGLEFLFSRRRTTSIRKAAQAEQLFR
Ga0326728_1097971123300033402Peat SoilSEAVQRGVLVPIQEVSAVVKGMRAGLDFLFSRRGTTRVSEATQDEQLFI
Ga0326727_1000287893300033405Peat SoilMVSDLVQKVETTSDAVQRGVLAPIQEVSAIIKGMQAGLEFLFSCRRTTSVSEAARDERLS
Ga0371489_0529689_339_5153300033755Peat SoilDLIQKVETTTDAVQRGVLAPIQEVSAIIKGMQAGLEFLFSRRRTTSVSKAAQDEQLFK
Ga0314861_0362383_409_5943300033977PeatlandMVSELVEKVETTADTVQKGVLGPIQEVSAVVKGIRSGLEFLFSRRRVTNVSEATQDEQLF
Ga0371488_0264270_694_8223300033983Peat SoilVLGPIQEVSAVVKGVRSGLEFLFSRRRVTNVSEATQDEQLFI
Ga0371488_0509979_2_1243300033983Peat SoilAPIQEVSAVIKGMQAGLEFLFSRRRTTSVSEAAQDEQLFI
Ga0326724_0132204_3_1613300034091Peat SoilETTADTVQKGVLGPIQEVSAVVKGVRSGLEFLFSRRRVTNVSEATQDEQLFI
Ga0326724_0350455_590_7753300034091Peat SoilMVSELVEKVESTADTVQKGVLGPIQEVSAVVKGVRSGLEFLFSRRRVTNVSEATQDEQLF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.