| Basic Information | |
|---|---|
| Family ID | F098521 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIIFTNG |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.97 % |
| % of genes near scaffold ends (potentially truncated) | 84.47 % |
| % of genes from short scaffolds (< 2000 bps) | 99.03 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (96.117 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (39.806 % of family members) |
| Environment Ontology (ENVO) | Unclassified (70.874 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (64.078 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 2.33% β-sheet: 58.14% Coil/Unstructured: 39.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 96.12 % |
| All Organisms | root | All Organisms | 3.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 39.81% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 27.18% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 9.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.94% |
| Root | Host-Associated → Plants → Roots → Unclassified → Unclassified → Root | 1.94% |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014486 | Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017692 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300020031 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300020033 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12JUL2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028140 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028141 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028149 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028150 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028152 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028246 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028251 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028253 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028466 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028467 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028468 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028525 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032781 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032915 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032934 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070690_1001462264 | 3300005330 | Switchgrass Rhizosphere | MYFERFDVFFEKYKICQKSDKCWIDLESLKLKGPQVGIIVTSG* |
| Ga0070666_107355611 | 3300005335 | Switchgrass Rhizosphere | MYVERFDVFFEKYKIYQKSDKCWIDLESLKLKGPQVGIIVTS |
| Ga0070666_108964382 | 3300005335 | Switchgrass Rhizosphere | KISWQFNLYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIIFTNS* |
| Ga0070689_1005095572 | 3300005340 | Switchgrass Rhizosphere | LYFERFDVFFEKYKICQKSDKYWIDLKSLKLKGPQVGIIFTSG* |
| Ga0070671_1012992442 | 3300005355 | Switchgrass Rhizosphere | YFERFDVFFEKYKICQKSDKYWIDLKSLKLKGPQVGIIFTNG* |
| Ga0070671_1020489671 | 3300005355 | Switchgrass Rhizosphere | NMYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVEIIFTSG* |
| Ga0070705_1004083601 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVEIIFTSG* |
| Ga0070706_1001414293 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIIFTNG* |
| Ga0070707_1012011342 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIIVTSG* |
| Ga0068864_1001811553 | 3300005618 | Switchgrass Rhizosphere | LYFERFDVFFEKYKICQKSDKYWIDLKSLKLKGPQVGIIFTNG* |
| Ga0068861_1012405102 | 3300005719 | Switchgrass Rhizosphere | FERFDVFFEKYKICQKSDKYWIDLKSLKLKGPQVGIIFTNG* |
| Ga0068861_1024637432 | 3300005719 | Switchgrass Rhizosphere | FNMYFERFDVFFEKYKICQKSDKCWIDLESLKLKGPQVGIIVTSG* |
| Ga0068863_1017594791 | 3300005841 | Switchgrass Rhizosphere | LYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIILTNG* |
| Ga0068863_1020825691 | 3300005841 | Switchgrass Rhizosphere | ERFDVFFEKYKICQKSDKCWIDLESLKLKCPQVGIIVTSG* |
| Ga0068858_1008664351 | 3300005842 | Switchgrass Rhizosphere | LYYERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVEIIFTSG* |
| Ga0068860_1011515362 | 3300005843 | Switchgrass Rhizosphere | LYFERFDIFFERYKICQKSDKYWIDLESLKLKGPQVEIIVTSG* |
| Ga0068860_1012389851 | 3300005843 | Switchgrass Rhizosphere | HKISWQFNLYFERFDVFFEKYKICQKSDKYWIDLKSLKLKGPQVGIIFTNG* |
| Ga0068862_1006507081 | 3300005844 | Switchgrass Rhizosphere | RFDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIIFTSG* |
| Ga0105248_108454381 | 3300009177 | Switchgrass Rhizosphere | MYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVEIIFTSG* |
| Ga0105249_119902462 | 3300009553 | Switchgrass Rhizosphere | DVFFEKYKICQKSDKYWIDLKSLKLNIPEVGIILTNG* |
| Ga0134125_111678141 | 3300010371 | Terrestrial Soil | FNLYFERFDVFFEKYKICQKSDKYWIDLESLKLKGHQVEIISTSG* |
| Ga0134126_130439721 | 3300010396 | Terrestrial Soil | FNLYFERFDVFFEKYKICQKSDKYWIDLKSLKLKGPQVGIIFTNG* |
| Ga0134124_108519382 | 3300010397 | Terrestrial Soil | DVFFEKYKICQKSDKYWIDLESLKLKGPQVEIIVTSG* |
| Ga0134124_115189941 | 3300010397 | Terrestrial Soil | KILWQFNLYSKRYDIFFERYKICQKSDKYWIDLESLKLKGTQVEIIFTIG* |
| Ga0157380_115489481 | 3300014326 | Switchgrass Rhizosphere | KGLEAQIFMAAKCLSVTHLHKILWQFNLCSKRYDIFFERYKICQKSDKYWIELKSLKLKGPQVEIIFTSG* |
| Ga0182004_101699871 | 3300014486 | Root | MLWYLALYIVRYGYLFKGYRICQKSDNYWIDLESLQLKGPQV |
| Ga0182004_102940552 | 3300014486 | Root | LDLYIVRYGYFFKGYRICQKSDKYWIDLESLKLKGPQVGNMFISV* |
| Ga0182183_10194682 | 3300015270 | Switchgrass Phyllosphere | VFFEKYKICQKSDKYWIDLKSLKLKGPQVGIIFTNG* |
| Ga0182099_10510921 | 3300015278 | Switchgrass Phyllosphere | FDVFFEKYKICQKSDKYWIDLESLKLKGPQVEIIVTSG* |
| Ga0182100_10844162 | 3300015280 | Switchgrass Phyllosphere | ERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIILTNG* |
| Ga0182104_10505471 | 3300015297 | Switchgrass Phyllosphere | FDVFFEKYKICQKSDKCWIDLESLKLKGPQVGIIFTSG* |
| Ga0182184_10460171 | 3300015301 | Switchgrass Phyllosphere | SKRYDIFFERYKICQKSDKYWIDLESLKLKGHQVEIIFTSG* |
| Ga0182184_10785231 | 3300015301 | Switchgrass Phyllosphere | WQFNLYFERFDVFFEKYKICQKSDKYWIDLKSLKLKGPQVGIIFTNG* |
| Ga0182180_10690321 | 3300015306 | Switchgrass Phyllosphere | DVFFEKYKICQKSDKYWIDLESLKLKGPQVGIILTNG* |
| Ga0182162_10561942 | 3300015310 | Switchgrass Phyllosphere | FNLYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIILTNG* |
| Ga0182162_11318331 | 3300015310 | Switchgrass Phyllosphere | LSVTHLHKISWQFNLYFERFDVLFEKYKICQKSDKYWIDLKSLKLKGPQVEIIFTSG* |
| Ga0182182_10767942 | 3300015311 | Switchgrass Phyllosphere | YFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIIIISG* |
| Ga0182164_10969892 | 3300015313 | Switchgrass Phyllosphere | DVFFEKYKICQKSDKYWIDLKSLKLKGPQVGIIFTNG*GT* |
| Ga0182181_10936811 | 3300015318 | Switchgrass Phyllosphere | LHKISWQFNLYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIIFTSG* |
| Ga0182165_10882991 | 3300015320 | Switchgrass Phyllosphere | FERYKICQKSDKYWIDLESLKLKGPQVEIIVTSG* |
| Ga0182166_10340121 | 3300015326 | Switchgrass Phyllosphere | THLHKISWQFNLNFERFDVFFEEYKICQKSDKYWIDLKSLKLKGPQVGIIFING* |
| Ga0182166_11198171 | 3300015326 | Switchgrass Phyllosphere | MYFERFDVFFEKYKICQKSDKCWIDLESLKLKGPQVGIIVTSGCGT* |
| Ga0182153_10945261 | 3300015328 | Switchgrass Phyllosphere | MYFERFDVFFEKYKIYQKSDKYWIDLESLKLKGPQVGIILTNG* |
| Ga0182135_11566971 | 3300015329 | Switchgrass Phyllosphere | FFEKYKICQKSDKCWIDLESLKLKGPQVGIIITSG* |
| Ga0182132_11466641 | 3300015334 | Switchgrass Phyllosphere | SNMYFERFDVFFEKYKICQKNDKYWIDLESLKLKGPQVGIILTNG* |
| Ga0182116_10681021 | 3300015335 | Switchgrass Phyllosphere | DVFFEKYKICQKSDKYWIDLKSLKLKGPQVEIIVTSD* |
| Ga0182116_11124961 | 3300015335 | Switchgrass Phyllosphere | FDVFFEKYKICQKSDKCWIDLESLKLKGPQVGIIITSG* |
| Ga0182137_11074451 | 3300015338 | Switchgrass Phyllosphere | HLHKISWQFNLYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIILTNG* |
| Ga0182115_12075422 | 3300015348 | Switchgrass Phyllosphere | FNMYFERFDVFFEKYKICQKSDKCWIDLESLKLKGPQVGIIITSG* |
| Ga0182185_12034161 | 3300015349 | Switchgrass Phyllosphere | FEKYKICQKSDKYWIDLESLKLKGPQVGIIVTSG* |
| Ga0182185_12695701 | 3300015349 | Switchgrass Phyllosphere | MYVERFDVFFEKYKIYQKSDKCWIDLESLKLKGPQVGIIVTSG* |
| Ga0182163_12611911 | 3300015350 | Switchgrass Phyllosphere | FDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIILTNG* |
| Ga0182163_12949171 | 3300015350 | Switchgrass Phyllosphere | LYFERFDVFFEKYKICQKSDKYWIDLESLKLIGPQVGIILING* |
| Ga0182197_11298421 | 3300017408 | Switchgrass Phyllosphere | FDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIILTNG |
| Ga0182197_11439742 | 3300017408 | Switchgrass Phyllosphere | KISWQFNLYFERFGIFFERYKICQKSDKYWIDLEPLKLKGPQVGIIFTNG |
| Ga0182208_10724321 | 3300017411 | Miscanthus Phyllosphere | AHLHQILWYLDLYFGRYAYFFEKYKICQKSDKCWIDLESLXLKGPQVENMFISNXGT |
| Ga0182196_10361852 | 3300017432 | Switchgrass Phyllosphere | FDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIIFTSG |
| Ga0182196_11069761 | 3300017432 | Switchgrass Phyllosphere | DVFFEKYKICQKSDKYWIDLESLKLKGPQVGIILTNG |
| Ga0182194_10099041 | 3300017435 | Switchgrass Phyllosphere | LYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQV |
| Ga0182194_11102801 | 3300017435 | Switchgrass Phyllosphere | NLYFERFDVFFEKYKICQKSDKYWIDLESLKLKGSQVGIILTNG |
| Ga0182214_11227341 | 3300017440 | Switchgrass Phyllosphere | ERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIILTNG |
| Ga0182229_10920322 | 3300017682 | Miscanthus Phyllosphere | YLDLYFDRYAFFFEEYKICQKSDKCWIDLESLGLKGSQVGIMFISD |
| Ga0182210_11169771 | 3300017692 | Switchgrass Phyllosphere | LYSKRYDIFFERYKICQKSDKYWIDLESLKLKGPQVEIIFNKWLRNLG |
| Ga0182119_1054101 | 3300020031 | Switchgrass Phyllosphere | FFEKYKICQKSDKYWIDLESLKLKGPQVGIIFTSG |
| Ga0182146_1024991 | 3300020033 | Switchgrass Phyllosphere | SKRYDIFFERYKIYQKSDKYWIDLESLKLKGPQVEIIFTSG |
| Ga0207696_10381581 | 3300025711 | Switchgrass Rhizosphere | MYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIIFTSG |
| Ga0207710_104786641 | 3300025900 | Switchgrass Rhizosphere | MYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQIEIIVTSG |
| Ga0207680_107249202 | 3300025903 | Switchgrass Rhizosphere | FDVFFEKYKIWQKSDKYWIDLESLKLKGSQVGIIFTNG |
| Ga0207681_102506821 | 3300025923 | Switchgrass Rhizosphere | MYFERFDVFFEKYKICQKSDKCWIDLESLKLKGPQVGIIV |
| Ga0207676_116563951 | 3300026095 | Switchgrass Rhizosphere | SWQFNLYFERFDVFFEKYKICQKSDKYWIDLKSLKLKGPQVGIIFTNG |
| Ga0268322_10501041 | 3300028049 | Phyllosphere | VFFEKYKICQKSDKYWIDLKSLKLKGPQVGIIFTNG |
| Ga0268338_10380081 | 3300028055 | Phyllosphere | FFERYKVCQKSDKYWIDLESLKLKGPQVEIIFTSG |
| Ga0268332_10674962 | 3300028058 | Phyllosphere | RFDVFFEKYKICQKSDKCWIDLESLKLKGPQVGIIVTSG |
| Ga0268334_10133691 | 3300028140 | Phyllosphere | QFNLYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIIFTSG |
| Ga0268326_10004872 | 3300028141 | Phyllosphere | MYFERFDVFFEKYKICQKSDKCWIDLESLKLKGPQVGII |
| Ga0268326_10017542 | 3300028141 | Phyllosphere | MYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIIVTSG |
| Ga0268326_10061571 | 3300028141 | Phyllosphere | LYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIIFTNG |
| Ga0268326_10065291 | 3300028141 | Phyllosphere | YFERFDVFFEKYKICQKSDKCWIDLESLKLKGPQVGIIITSG |
| Ga0268347_10003521 | 3300028142 | Phyllosphere | RFDVFFEKYKICQKSDKYWIDLESLKLKGPQVEIIFTSG |
| Ga0268347_10226421 | 3300028142 | Phyllosphere | FFEKYKICQKSDKYWIDLESLKLKGPQVGIIVTSD |
| Ga0268348_10158991 | 3300028143 | Phyllosphere | DVFFEKYKICQKSDKYWIDLESLKLKGPQVGIIFTNG |
| Ga0268353_1114461 | 3300028149 | Phyllosphere | HKILWQFNLYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIILTNG |
| Ga0268343_10098161 | 3300028150 | Phyllosphere | KILWQFNLYFERFDVFFEKYKICQKSDKYWIDLKSLKLKGPQVGIIFTNG |
| Ga0268336_10072621 | 3300028152 | Phyllosphere | HLHKISWQFNLYFERFDVFFEKYKICQKSDKYWIDLKSLKLKGPQVGIIFTNG |
| Ga0268351_10099692 | 3300028246 | Phyllosphere | NLYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQIGIIFTNG |
| Ga0268324_10259691 | 3300028251 | Phyllosphere | ERFDVFFEKYKICQKSDKYWIDLKSLKLKGPQVRIIFTNG |
| Ga0268316_10032561 | 3300028253 | Phyllosphere | ERFDVSFEKYKICQKSDKCWIDLESLKLKGPQVRIIVTSG |
| Ga0268310_10377231 | 3300028262 | Phyllosphere | IFFERYKICQKSDKYWIDLESLKLKGPQVGIIFTNG |
| Ga0268321_1071361 | 3300028466 | Phyllosphere | KISWQFNLYFERFDVFFEKYKICQKSDKYWIDLKSLKLKGPQVGIIFTNG |
| Ga0268333_10011101 | 3300028467 | Phyllosphere | HLHKISWQFNLYFERCDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIIVTSD |
| Ga0268317_10041012 | 3300028468 | Phyllosphere | MYFERFDVFFEKYKICQKSDKCWIDLESLKLKGPQVGI |
| Ga0268317_10082941 | 3300028468 | Phyllosphere | QFNLYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIIFTNG |
| Ga0268315_10078442 | 3300028472 | Phyllosphere | MYFERFDVFFEKYKICQKSDKCWIDLESLKLRGPQVGIIV |
| Ga0268315_10266411 | 3300028472 | Phyllosphere | LHKFLWQFNMYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVEIIFTSG |
| Ga0268327_10053451 | 3300028475 | Phyllosphere | LYFERCDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIIVTSD |
| Ga0268327_10068932 | 3300028475 | Phyllosphere | SVTHLHKISWQFNLYFERFDVFFEKYKICQKSDKYWIDLKSLKLKGPQVGIIFTNG |
| Ga0268305_1009951 | 3300028525 | Phyllosphere | LHKISWQFNLYFERCDVFFEKYKICQKSDKYWIDLESLKLKGPQVGIIVTSD |
| Ga0268311_10046511 | 3300028529 | Phyllosphere | DVFFEKYKICQKSDKYWIDLESLKLKGPQVGIIVTSD |
| Ga0214499_10573711 | 3300032697 | Switchgrass Phyllosphere | LYFERFDIFFERYKICQKSDKYWIDLESLKLKGPQVEII |
| Ga0214499_11342441 | 3300032697 | Switchgrass Phyllosphere | MYFERFDVFFEKYKICRKSDKCWIDLESLKLKGPQVGII |
| Ga0314742_10785501 | 3300032781 | Switchgrass Phyllosphere | VTHLYKILWQFNLYFERFDVFFEKYKISQKRDKYWIDLESLKLKGPQVGIIFTSGCGT |
| Ga0314749_11439021 | 3300032915 | Switchgrass Phyllosphere | HKISWQFNLYFERFDVFFEKYKICQKSDKYWIDLESLKLKGPQVGVIITSG |
| Ga0314741_10866351 | 3300032934 | Switchgrass Phyllosphere | MATRWLSATHLHKFLWQFNMYFERFDVFFEKYKFCQKSDKYWIDIESLKLKGPQVEIIFTSG |
| ⦗Top⦘ |