NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F098461

Metagenome / Metatranscriptome Family F098461

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098461
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 78 residues
Representative Sequence MRDMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Number of Associated Samples 89
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 3.92 %
% of genes near scaffold ends (potentially truncated) 21.36 %
% of genes from short scaffolds (< 2000 bps) 97.09 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.029 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(54.369 % of family members)
Environment Ontology (ENVO) Unclassified
(76.699 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(74.757 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.50%    β-sheet: 31.25%    Coil/Unstructured: 51.25%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.03 %
UnclassifiedrootN/A0.97 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005331|Ga0070670_101865012All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum554Open in IMG/M
3300005347|Ga0070668_101856527All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum555Open in IMG/M
3300005365|Ga0070688_100714862All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum777Open in IMG/M
3300005466|Ga0070685_11598531All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum504Open in IMG/M
3300005468|Ga0070707_102312332All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300005544|Ga0070686_100833280All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum746Open in IMG/M
3300005549|Ga0070704_101556326All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum609Open in IMG/M
3300005843|Ga0068860_102016062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum599Open in IMG/M
3300005844|Ga0068862_100150436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum2071Open in IMG/M
3300009553|Ga0105249_10429849All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1356Open in IMG/M
3300009972|Ga0105137_105479All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum623Open in IMG/M
3300009976|Ga0105128_106653All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum721Open in IMG/M
3300009980|Ga0105135_120886All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum577Open in IMG/M
3300009994|Ga0105126_1016543All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum766Open in IMG/M
3300009995|Ga0105139_1038270All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum804Open in IMG/M
3300010371|Ga0134125_10711327All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1107Open in IMG/M
3300010396|Ga0134126_12917119All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum517Open in IMG/M
3300010397|Ga0134124_11643340All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum674Open in IMG/M
3300010399|Ga0134127_10467688All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1265Open in IMG/M
3300010399|Ga0134127_12009025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum656Open in IMG/M
3300010401|Ga0134121_10652026All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum992Open in IMG/M
3300010403|Ga0134123_10591104All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1065Open in IMG/M
3300013306|Ga0163162_11277247All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum834Open in IMG/M
3300014326|Ga0157380_12805176All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum554Open in IMG/M
3300014968|Ga0157379_10599635All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1028Open in IMG/M
3300015270|Ga0182183_1047355All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum629Open in IMG/M
3300015270|Ga0182183_1073352All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum548Open in IMG/M
3300015273|Ga0182102_1011549All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum726Open in IMG/M
3300015278|Ga0182099_1019818All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum722Open in IMG/M
3300015284|Ga0182101_1000618All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum2202Open in IMG/M
3300015297|Ga0182104_1050240All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum684Open in IMG/M
3300015297|Ga0182104_1058936All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum649Open in IMG/M
3300015306|Ga0182180_1045838All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum652Open in IMG/M
3300015310|Ga0182162_1075626All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum616Open in IMG/M
3300015310|Ga0182162_1123312All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum513Open in IMG/M
3300015311|Ga0182182_1053502All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum675Open in IMG/M
3300015311|Ga0182182_1082762All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum580Open in IMG/M
3300015313|Ga0182164_1062262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum679Open in IMG/M
3300015315|Ga0182120_1058208All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum700Open in IMG/M
3300015316|Ga0182121_1110059All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum566Open in IMG/M
3300015318|Ga0182181_1021308All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum887Open in IMG/M
3300015319|Ga0182130_1076484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum625Open in IMG/M
3300015320|Ga0182165_1031940All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum882Open in IMG/M
3300015320|Ga0182165_1070547All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum671Open in IMG/M
3300015324|Ga0182134_1038688All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum823Open in IMG/M
3300015324|Ga0182134_1053528All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum738Open in IMG/M
3300015326|Ga0182166_1077345All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum638Open in IMG/M
3300015329|Ga0182135_1063645All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum708Open in IMG/M
3300015329|Ga0182135_1075650All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum665Open in IMG/M
3300015331|Ga0182131_1033029All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum892Open in IMG/M
3300015331|Ga0182131_1144995All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum518Open in IMG/M
3300015332|Ga0182117_1065946All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum743Open in IMG/M
3300015332|Ga0182117_1068447All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum733Open in IMG/M
3300015333|Ga0182147_1026787All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum999Open in IMG/M
3300015334|Ga0182132_1071619All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum713Open in IMG/M
3300015335|Ga0182116_1017706All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1190Open in IMG/M
3300015335|Ga0182116_1063743All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum773Open in IMG/M
3300015336|Ga0182150_1072978All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum695Open in IMG/M
3300015340|Ga0182133_1163661All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300015348|Ga0182115_1277400All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum531Open in IMG/M
3300015350|Ga0182163_1165906All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum689Open in IMG/M
3300015353|Ga0182179_1122204All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum795Open in IMG/M
3300015354|Ga0182167_1100450All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1057Open in IMG/M
3300015354|Ga0182167_1249110All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum641Open in IMG/M
3300017412|Ga0182199_1069786All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum759Open in IMG/M
3300017414|Ga0182195_1087681All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum726Open in IMG/M
3300017414|Ga0182195_1219080All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300017421|Ga0182213_1123827All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum722Open in IMG/M
3300017421|Ga0182213_1142829All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum673Open in IMG/M
3300017432|Ga0182196_1127852All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300017435|Ga0182194_1016321All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1144Open in IMG/M
3300017439|Ga0182200_1073129All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum668Open in IMG/M
3300017440|Ga0182214_1157012All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum507Open in IMG/M
3300017446|Ga0182217_1090498All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum716Open in IMG/M
3300017447|Ga0182215_1020995All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1347Open in IMG/M
3300017691|Ga0182212_1059909All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum840Open in IMG/M
3300017693|Ga0182216_1220207All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300020023|Ga0182178_1000761All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1513Open in IMG/M
3300025972|Ga0207668_10435605All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1116Open in IMG/M
3300026095|Ga0207676_10738408All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum957Open in IMG/M
3300026118|Ga0207675_100347959All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1452Open in IMG/M
3300028049|Ga0268322_1018635All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum725Open in IMG/M
3300028050|Ga0268328_1052218All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum567Open in IMG/M
3300028052|Ga0268300_1003403All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum968Open in IMG/M
3300028054|Ga0268306_1006988All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum826Open in IMG/M
3300028056|Ga0268330_1018653All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum765Open in IMG/M
3300028057|Ga0268352_1016280All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum774Open in IMG/M
3300028058|Ga0268332_1015515All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum874Open in IMG/M
3300028062|Ga0268342_1019995All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum659Open in IMG/M
3300028141|Ga0268326_1000480All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1379Open in IMG/M
3300028143|Ga0268348_1014319All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum607Open in IMG/M
3300028152|Ga0268336_1001320All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1227Open in IMG/M
3300028153|Ga0268320_1003024All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum963Open in IMG/M
3300028251|Ga0268324_1019520All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum553Open in IMG/M
3300028381|Ga0268264_10423716All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1284Open in IMG/M
3300028465|Ga0268301_100918All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum988Open in IMG/M
3300028467|Ga0268333_1003047All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum785Open in IMG/M
3300028471|Ga0268323_1001380All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1085Open in IMG/M
3300028472|Ga0268315_1027975All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum503Open in IMG/M
3300028525|Ga0268305_111756All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum511Open in IMG/M
3300032502|Ga0214490_1152458All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum521Open in IMG/M
3300032591|Ga0214484_1113990All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum548Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere54.37%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere17.48%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil6.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.85%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated4.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009972Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaGHost-AssociatedOpen in IMG/M
3300009976Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015278Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017421Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017446Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017691Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300020023Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MGHost-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028049Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028050Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028052Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028054Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028057Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028058Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028062Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028141Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028143Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028152Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028153Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028251Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028465Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028467Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028471Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028472Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028525Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032591Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070670_10186501213300005331Switchgrass RhizosphereMRDMYPYRKISFDIKIRRRCPDSYVITDKPSPCSLKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0070668_10185652713300005347Switchgrass RhizosphereMRDMYLYRKVSFDIKIRRWCRDPYVITDKPSPCALKDVYERLIVFFWSPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0070688_10071486213300005365Switchgrass RhizosphereYRKVSFDIKIRRRRRDPYVITDKPSPCALKDVYERLIVFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0070685_1159853113300005466Switchgrass RhizosphereKVSFDIKIRRRCRDSYVITDKPIPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0070707_10231233213300005468Corn, Switchgrass And Miscanthus RhizosphereKVSFDIKIRRRCRNPYVITDKPSPCALKDVYERLIVFFWSPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0070686_10083328013300005544Switchgrass RhizosphereYRKVSFDIKIKSRCRDSYLFTDKPSPCALKDLFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0070704_10155632613300005549Corn, Switchgrass And Miscanthus RhizosphereMRDMYPYRKVSFDIKIRRRCRNSYVITDKRSPCALKDVYERLILFFWFPKGVEYHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0068860_10201606213300005843Switchgrass RhizosphereKVSFDIKIRRRCRDSYVFTNKPSPCALKDDYERLILFFWFLQGVKHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0068862_10015043633300005844Switchgrass RhizosphereMYPYRKVSFDIKIKRRCRDSYVITDKPSPCALKDVYERLIHFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0105249_1042984923300009553Switchgrass RhizosphereMRDMYPYRKISFDIKIRRRCRDSYVITDKPSPCALKDVYERLIVFFWSPQGVENHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0105137_10547923300009972Switchgrass AssociatedMHDMYPYRKVSFDIKIRRRCRNSYVFRNKPSPCALKDVYERLIVFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0105128_10665313300009976Switchgrass AssociatedMYPYRKVSFDIKIRRRCRDSYVFTDKPSPCVLKDVYERLILFFWFPHGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0105135_12088623300009980Switchgrass AssociatedMRDMYPYRKVSFDIKIRRHYRDSYVFMEKPSPCFLKDVYEILILFFWLPQGVEHHNSGPINLDREQDPVEAIEIEVMKRS*
Ga0105126_101654313300009994Switchgrass AssociatedMRDMDPYWKVSFDIKIGGCCCDSYLFMNKPSPCALKDVYERLILFSWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0105139_103827013300009995Switchgrass AssociatedMRDMYLYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0134125_1071132713300010371Terrestrial SoilMRDMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYERLIVFFWSPQGVAHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0134126_1291711913300010396Terrestrial SoilMRDMYPYQKVSFDIKIRRRCRNPYVITDKPSPCALKDVYERLIVFFWSPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0134124_1164334013300010397Terrestrial SoilMRDMYPYRKVSFDIKIRRRCCDSYVITDKPSPCALKDVYERLIVFFWSPQGVEHHNSGPIDLDREQDPVETVEIEVMKRS*
Ga0134127_1046768813300010399Terrestrial SoilMRDMYPYQKVSFDIKIRRRCRDSYVFTDKPSQCALKDVHERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIE
Ga0134127_1200902513300010399Terrestrial SoilMRDMYPYRKVGFDIKIRRRCRDPYVITDKPSPCALKDVYERLIVFFWSPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0134121_1065202623300010401Terrestrial SoilMRDMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYQRLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKKVKGLTQSCTAN*
Ga0134123_1059110423300010403Terrestrial SoilMRDMYPYRKVSFDIKIRRRCRDPYVITDKPSPCALKDVYERLIVFFWSPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0163162_1127724723300013306Switchgrass RhizosphereMCDLYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0157380_1280517613300014326Switchgrass RhizosphereMCDMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0157379_1059963523300014968Switchgrass RhizosphereMHDMYPYRKVSFDIKIRRRCRDPYVITDKPSPCALKDVYERLIVFFWSPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0182183_104735513300015270Switchgrass PhyllosphereYPYRKVSFDIKIRRHCRDSYLFTDKPSPFVLKDVYERLILFFWLPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0182183_107335213300015270Switchgrass PhyllosphereYPYRKVNFDIKIRRCCRDTYVFMDKPSPCILKDVYEKLILFFWFPQGVEHHNLGPIDLDREQDLVKAVEIEVMKRS*
Ga0182102_101154913300015273Switchgrass PhyllosphereMRDMYSYRKVSFDIKIRRRCRDSYVITDKPSPGALNDVYERLIVFFWSLQGVKHHNSGPIDLYREQDPVEPV
Ga0182099_101981823300015278Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALNDVYERLIVFFWSPQGVKHHNSGPIDLDREQDLVEAVE
Ga0182101_100061833300015284Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRRCRDSYVITDQPSPYFWKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0182104_105024013300015297Switchgrass PhyllosphereMRDMYPYWKVNFDIKIRRRCRDSYVITDKPSPCALKDVYERLILFFWFPQGVEYHNSGPIDLDREQDPVEAVKIEVMKRR*
Ga0182104_105893613300015297Switchgrass PhyllosphereMREMYPYRKVSFDKEIRRRCPDSYVIMDKPSPCALKDVYERLILYFWFSQGVKHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0182180_104583813300015306Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0182162_107562613300015310Switchgrass PhyllosphereQKVSFDIKIRRQCRNSYVITDKLSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0182162_112331213300015310Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRRCRDPYVITDKPSPCALKDVYERLIVFFWSPRGVEHHNLGPIDLDREQDPVEAVEIEVMKRS*
Ga0182182_105350213300015311Switchgrass PhyllosphereMRDMYPYRKVNFDIKIRRCCRDTYVFTDKPSPCILKDVYERLILFFWFPQGVEHHNSGLIDLDREKDPVEAVEIEVM*
Ga0182182_108276213300015311Switchgrass PhyllosphereMRDMYPHRKVSFDIKIRRRCRDSYVFLEKPSPCLLKDVYERLILFFLFPQGVEHHNSGPIDLDREQDPVEAIEI*
Ga0182164_106226213300015313Switchgrass PhyllosphereMCDMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYERLIVFFWSPQGVEHHNSGPIDLDREQDPVEAVEFEVMKRN*
Ga0182120_105820813300015315Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYQRLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0182121_111005913300015316Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRRCCDSYVITDKPSPCALKDVYERLILFFLFPQGVEHHNSGPIDLDREQDLVEAVEIEVMKRS*
Ga0182181_102130813300015318Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRRCPDSYVITDKPSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVE
Ga0182130_107648423300015319Switchgrass PhyllosphereCRDSYVFTDKPSPCVLKDVYERLILFFLLPQGVEHHNSEPIDLDREQDPVEAH*
Ga0182165_103194013300015320Switchgrass PhyllosphereRRRCRDSYVFTDKPSQCALKDVHERLILFFWFPQGVEHHNSGRIDLDREQDPVEAVEIEVMKIS*
Ga0182165_107054713300015320Switchgrass PhyllosphereMHDMYSYRKVSFVIKIKRRCRDSYVITDQPSPYFWKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0182134_103868813300015324Switchgrass PhyllosphereMCDMYPYRKVSFDIKIRRRCRDSYVITDKLSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0182134_105352813300015324Switchgrass PhyllosphereMHDMYPYRKVSFDIKIRRHCRDSYLFTDKPSPCVLKDVYERLILFFWLPQGVEHHNLGPVDLDREQDPVEAVEIEVTKRS*
Ga0182148_114345113300015325Switchgrass PhyllosphereDKPSPCALKDVYERLIVFFWSPQGVEHHNLGPIDLDREQDPVEAVEIEVMKIS*
Ga0182166_107734513300015326Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVM*
Ga0182135_106364513300015329Switchgrass PhyllosphereMCNMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0182135_107565023300015329Switchgrass PhyllosphereKFDIKIRRRCCDSYVFLDKSSPCLLKDVYEILILVYWLPQGVGDHNSGPIDLDTEQDPVEAVEIEVIKRS*
Ga0182131_103302913300015331Switchgrass PhyllosphereMRDMYLYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYERLIVFFWSPQGVEHHNSGPINLDRDYDPVEDVEIEVMKRS*
Ga0182131_114499513300015331Switchgrass PhyllosphereMRDMYPYRKVNFDIKIRRCCRDTYVFTDKPSPCILKDVYEKLILFFWFPQGVEHHNLGPIDLDREQDPVKAVEIEVMKRS*
Ga0182117_106594613300015332Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRRCRDPYVITDKPSPCTLKDVYERLIVFFWSPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0182117_106844713300015332Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYQRLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVM*
Ga0182147_102678723300015333Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRRCRDFYVITDKLSPCALKDVYERLILFFWFPQGVDHHNSGPIDLDREQDPVETVEIEVMKRS*
Ga0182132_107161913300015334Switchgrass PhyllosphereMGYERFMAFNLKKSQKMCDMYSYRKVKFDIKIRRRCCDSNVFLDKSSPCLLKDVYEILILFFWLPQGVEHYNSGPIDLDREQDPVEAVEIEVMKIS*
Ga0182116_101770623300015335Switchgrass PhyllosphereRRCRDSYVFTNKPSPCALKDDYERLILFFWFLQGVKHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0182116_106374313300015335Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRSYLKDSLKFLR*
Ga0182150_107297813300015336Switchgrass PhyllosphereMYSYQKVSLDMKIRRRCRNSYVFTDKPSPCALKDVYERLILFFWFSQGVKHHNSGPIDLDREQDPVEAVEIE
Ga0182133_116366113300015340Switchgrass PhyllosphereMRDMYPYRKVNFYIKIRRCCRDTYVFTDKPSPCILKDVYEKLILFFWFPQGVEHHNLGPIDLDREHDPVKAVEIEVMKRS*
Ga0182115_127740013300015348Switchgrass PhyllosphereMRDMYPDRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0182163_116590613300015350Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRRCHDSYVITDKLSPCALKDVYERLILFFWFPKGVEYHNSGPIDLDREQDPVETVEIEVMKRS*
Ga0182179_112220423300015353Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRGRYHDSYVITDKPSPCFLKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0182167_110045013300015354Switchgrass PhyllosphereMRDMYPYRKVNFDIKIRRCCRDTYVFTDKPSPCALKDVYERLILFFWFPQGVVHHNSGPIDLDREQDPVEAVEIEVMKRS*
Ga0182167_124911013300015354Switchgrass PhyllosphereKVSFDIKIIGRCRDSYVFLEKPSPCLLKDVYERLILFFLLPQGVEHHNSEPIDLDREQDPVEAH*
Ga0182199_106978623300017412Switchgrass PhyllosphereMYLYRKVSFDIKIRSRCRDSYVITDKLNPCALKDVYERLILFSWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0182195_108768113300017414Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRRCCDSYVITDKPSPCALKDVYERLILFFLFPQGVEHHNSGPIDLDREQDPVEAIEIEVMKRS
Ga0182195_121908013300017414Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRRCRDPYVITDKLSPSALKDVYERLKVFFWSLQGVEHHNSGPIDLDRKQDLVEAVEIKVMKRS
Ga0182213_112382713300017421Switchgrass PhyllosphereMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYERLIVFFWSPQGVEHHNSGLIDLDREQDPVEAVEIEVMKRS
Ga0182213_114282913300017421Switchgrass PhyllosphereMYSYRKVKFDIKIRRRCRDSYVITDKPSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0182196_112785213300017432Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRRCRDPYVITDKPNPCALKDVYERLIVFFCSSQGVEHHNSGPINLDREQDPVEAIEIEVMKRS
Ga0182194_101632113300017435Switchgrass PhyllospherePYRKVSFDIKIRRRCRDSYVFTDKQCPCALKDVYERLILFFWFPQGVEHHNPGPIDLDREQDPVEAVEIEVMKRS
Ga0182200_107312913300017439Switchgrass PhyllosphereKVSFDIKIRRRCRDSYVITDKPIPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0182214_115701213300017440Switchgrass PhyllosphereMYPYRKVSFDIKIRRRCRDPYVITDKLSPCALKDVYERLKVFFWSPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0182217_109049813300017446Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRRCRDPYVITDKPSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0182215_102099523300017447Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYQRLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0182212_105990913300017691Switchgrass PhyllosphereMRDMYLYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYERLIVFFWSPQGVEHHNSGPIDLDREQDLVEAVEIEVMKRS
Ga0182216_122020713300017693Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRQCRDSYVITDKPSPYALKDVYERLILFFWFPQGVEHHNSRPIHLDREQDPVEAVETEVMKRS
Ga0182178_100076123300020023Switchgrass PhyllosphereMRDMYPYRKVSFDIKIRRRCRDPYVIMDKPSPCALKDVYEGLIVFFWPPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0207668_1043560523300025972Switchgrass RhizosphereMRDMYPYRKVSFDIKIRRRCRDSYVFTDKPSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0207676_1073840813300026095Switchgrass RhizosphereMRDMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYERLIVFFWSPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0207675_10034795913300026118Switchgrass RhizosphereMRDMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVKAVEIEVMKRS
Ga0268322_101863513300028049PhyllosphereMRDMYPYRKVSFDIKIRRRCRDSYVITDKLSPCALKDVYEILILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0268328_105221813300028050PhyllosphereMRDMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0268300_100340323300028052PhyllosphereMRDMYPYRKVNFYIKIRRCCRDTYVFTDKPSPCILKDVYEKLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0268306_100698813300028054PhyllosphereMRDMYPYRKVSFDIKIRRRCRDSYVITDKPSPCFLKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0268330_101865313300028056PhyllosphereMRDMYPYRKVNFDIKIRRCCRNTYVFTDKPSPCILKDVYEKLILFFWFPQGVEHHNLGPIDLDREHDPVKAVEIEVMKRS
Ga0268352_101628013300028057PhyllosphereMRDMYPYRKVSFDIKIKSRCRDSYLFTDKPSPCALKDVYERLIVFFWSPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0268332_101551513300028058PhyllosphereMRDMDPYWKVSFDIKIGGCCCDSYLFTNKPSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0268342_101999513300028062PhyllosphereMHDMYPYRKVSFGIKIRRRCRDSYVITDKLSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0268326_100048023300028141PhyllosphereMRDMYPYRKVSFDIKIRRRCRNPYVITDKPSPCALKDVYERLILFSWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0268348_101431923300028143PhyllosphereMCDMYPYRKVSFDIKIRRRCRDPYVITDKPSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDRKQDPVEAVEIEVMKRS
Ga0268336_100132023300028152PhyllosphereMRDMYLYRKVSFDIKIRRWCRDPYVITDKPSPCALKDVYERLIVFFWSPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0268320_100302413300028153PhyllosphereMRDMDPYWKVSFDIKIGGCCCDSYLFTNKPSPCALKDDYERLILFFWFLQGVKHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0268324_101952013300028251PhyllosphereMCDMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0268264_1042371613300028381Switchgrass RhizosphereMRDMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYEILILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0268301_10091823300028465PhyllosphereMRDMYPYRKVSFDIKIRRRCRDSYVITDKPSPCALKDVYERLILFFWLPQGVEHHNSGPVDLDREQDPVEAVEIEVMKRS
Ga0268333_100304713300028467PhyllosphereMRDMYPYRKVSFDIKIRRRCRDSYVITDKPSPGALKDVYQRLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0268323_100138013300028471PhyllosphereMRDMYSYRKVSFDIKIRRRCRDSYVITDQPSPYFWKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0268315_102797523300028472PhyllosphereMRDMYPYRKVSFDIKIRRRCRDPYVIMDKPSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0268305_11175613300028525PhyllosphereMRDMYLYRKVSFDIKIRRRCRDPYVIMDKPSPCTLKDVYERLIVFFWSPQGVEHQNSGPIDLDREQDPVEAVEIEVMKRS
Ga0214490_115245813300032502Switchgrass PhyllosphereMRDMYSYRKVSFDIKIRRRCRDSYVITDKLSPCALKDVYERLILFFWFPQGVEHHNSGPIDLDREQDPVEAVEIEVMKRS
Ga0214484_111399013300032591Switchgrass PhyllosphereMRDMYPYRKVNFDIKIRRRCRDSYVFMDKQSPCDLKDVYERLILFFWFPQGVEHHTLXLIDLDREQDPVEAVEIEVMKKS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.