| Basic Information | |
|---|---|
| Family ID | F098376 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MAGIRTLATAILQKTNCQNKKAQLENFSDDFDNLIITLKTMNFL |
| Number of Associated Samples | 31 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 19.42 % |
| % of genes near scaffold ends (potentially truncated) | 47.57 % |
| % of genes from short scaffolds (< 2000 bps) | 84.47 % |
| Associated GOLD sequencing projects | 29 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.233 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand (89.320 % of family members) |
| Environment Ontology (ENVO) | Unclassified (89.320 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (94.175 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.22% β-sheet: 0.00% Coil/Unstructured: 52.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF01609 | DDE_Tnp_1 | 28.43 |
| PF13808 | DDE_Tnp_1_assoc | 5.88 |
| PF01791 | DeoC | 0.98 |
| PF07994 | NAD_binding_5 | 0.98 |
| PF00056 | Ldh_1_N | 0.98 |
| PF04014 | MazE_antitoxin | 0.98 |
| PF00483 | NTP_transferase | 0.98 |
| PF01488 | Shikimate_DH | 0.98 |
| PF09424 | YqeY | 0.98 |
| PF00999 | Na_H_Exchanger | 0.98 |
| PF13424 | TPR_12 | 0.98 |
| PF07676 | PD40 | 0.98 |
| PF03740 | PdxJ | 0.98 |
| PF13613 | HTH_Tnp_4 | 0.98 |
| PF13460 | NAD_binding_10 | 0.98 |
| PF01381 | HTH_3 | 0.98 |
| PF00144 | Beta-lactamase | 0.98 |
| PF13517 | FG-GAP_3 | 0.98 |
| PF00589 | Phage_integrase | 0.98 |
| PF14696 | Glyoxalase_5 | 0.98 |
| PF00872 | Transposase_mut | 0.98 |
| PF00266 | Aminotran_5 | 0.98 |
| PF12770 | CHAT | 0.98 |
| PF02371 | Transposase_20 | 0.98 |
| PF00486 | Trans_reg_C | 0.98 |
| PF13589 | HATPase_c_3 | 0.98 |
| PF17189 | Glyco_hydro_30C | 0.98 |
| PF00903 | Glyoxalase | 0.98 |
| PF12680 | SnoaL_2 | 0.98 |
| PF00583 | Acetyltransf_1 | 0.98 |
| PF13470 | PIN_3 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 28.43 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 28.43 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 28.43 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 28.43 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 28.43 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 28.43 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.98 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.98 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.98 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.98 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.98 |
| COG1486 | Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase | Carbohydrate transport and metabolism [G] | 0.98 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.98 |
| COG1260 | Myo-inositol-1-phosphate synthase | Lipid transport and metabolism [I] | 0.98 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.98 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.98 |
| COG0854 | Pyridoxine 5'-phosphate synthase PdxJ | Coenzyme transport and metabolism [H] | 0.98 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.98 |
| COG0039 | Malate/lactate dehydrogenase | Energy production and conversion [C] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.23 % |
| Unclassified | root | N/A | 7.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002548|JGI24974J35850_1003907 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300002548|JGI24974J35850_1023438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300003322|rootL2_10254490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1368 | Open in IMG/M |
| 3300006041|Ga0075023_100035613 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300011244|Ga0137483_107086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1107 | Open in IMG/M |
| 3300012042|Ga0136627_1030217 | All Organisms → cellular organisms → Bacteria | 1981 | Open in IMG/M |
| 3300012042|Ga0136627_1066795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1260 | Open in IMG/M |
| 3300012043|Ga0136631_10072418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1297 | Open in IMG/M |
| 3300012045|Ga0136623_10066641 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae | 1572 | Open in IMG/M |
| 3300012045|Ga0136623_10090823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1333 | Open in IMG/M |
| 3300012045|Ga0136623_10144606 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300012046|Ga0136634_10016615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2488 | Open in IMG/M |
| 3300012046|Ga0136634_10034487 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1777 | Open in IMG/M |
| 3300012046|Ga0136634_10036297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1736 | Open in IMG/M |
| 3300012046|Ga0136634_10041980 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300012046|Ga0136634_10055514 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300012046|Ga0136634_10078366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1224 | Open in IMG/M |
| 3300012046|Ga0136634_10078440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1224 | Open in IMG/M |
| 3300012046|Ga0136634_10089623 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300012046|Ga0136634_10118135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1012 | Open in IMG/M |
| 3300012046|Ga0136634_10145661 | Not Available | 919 | Open in IMG/M |
| 3300012046|Ga0136634_10166222 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300012046|Ga0136634_10252272 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 709 | Open in IMG/M |
| 3300012046|Ga0136634_10261377 | Not Available | 698 | Open in IMG/M |
| 3300012046|Ga0136634_10300552 | Not Available | 653 | Open in IMG/M |
| 3300012046|Ga0136634_10340061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300012046|Ga0136634_10340061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300012046|Ga0136634_10361232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300012046|Ga0136634_10442272 | Not Available | 547 | Open in IMG/M |
| 3300012046|Ga0136634_10486594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300012092|Ga0136621_1134600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 994 | Open in IMG/M |
| 3300012093|Ga0136632_10074073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1573 | Open in IMG/M |
| 3300012093|Ga0136632_10099481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1346 | Open in IMG/M |
| 3300012094|Ga0136638_10003693 | All Organisms → cellular organisms → Bacteria | 4808 | Open in IMG/M |
| 3300012094|Ga0136638_10009534 | All Organisms → cellular organisms → Bacteria | 3378 | Open in IMG/M |
| 3300012094|Ga0136638_10036806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1957 | Open in IMG/M |
| 3300012094|Ga0136638_10045418 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
| 3300012094|Ga0136638_10050577 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
| 3300012094|Ga0136638_10092112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1312 | Open in IMG/M |
| 3300012094|Ga0136638_10112618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1197 | Open in IMG/M |
| 3300012094|Ga0136638_10283494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 768 | Open in IMG/M |
| 3300012185|Ga0136619_10063369 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300012185|Ga0136619_10262279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300012186|Ga0136620_10114029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1236 | Open in IMG/M |
| 3300012188|Ga0136618_10018801 | Not Available | 3056 | Open in IMG/M |
| 3300012188|Ga0136618_10059708 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300012188|Ga0136618_10108256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1225 | Open in IMG/M |
| 3300012188|Ga0136618_10192422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 888 | Open in IMG/M |
| 3300012526|Ga0136637_1000621 | All Organisms → cellular organisms → Bacteria | 8988 | Open in IMG/M |
| 3300012529|Ga0136630_1157822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
| 3300012529|Ga0136630_1175211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300012529|Ga0136630_1338490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300012531|Ga0136640_10041876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2044 | Open in IMG/M |
| 3300012531|Ga0136640_10408890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300012679|Ga0136616_10082939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1522 | Open in IMG/M |
| 3300012679|Ga0136616_10471393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300012679|Ga0136616_10552997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300012679|Ga0136616_10583140 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012680|Ga0136612_10150642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1183 | Open in IMG/M |
| 3300012681|Ga0136613_10067511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2046 | Open in IMG/M |
| 3300012681|Ga0136613_10085978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1801 | Open in IMG/M |
| 3300012681|Ga0136613_10100293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1658 | Open in IMG/M |
| 3300012681|Ga0136613_10246365 | Not Available | 1000 | Open in IMG/M |
| 3300012681|Ga0136613_10481030 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300012681|Ga0136613_10793330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300012682|Ga0136611_10141005 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
| 3300012682|Ga0136611_10194929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1382 | Open in IMG/M |
| 3300012682|Ga0136611_10309543 | Not Available | 1040 | Open in IMG/M |
| 3300012682|Ga0136611_10850832 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300012684|Ga0136614_10046038 | All Organisms → cellular organisms → Bacteria | 3289 | Open in IMG/M |
| 3300012684|Ga0136614_10565755 | Not Available | 813 | Open in IMG/M |
| 3300012684|Ga0136614_10767609 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300013097|Ga0136639_10317112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300017695|Ga0180121_10013804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2894 | Open in IMG/M |
| 3300017695|Ga0180121_10060806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1337 | Open in IMG/M |
| 3300017695|Ga0180121_10113446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 979 | Open in IMG/M |
| 3300017695|Ga0180121_10280805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300017695|Ga0180121_10329011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300017695|Ga0180121_10342629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300017787|Ga0183260_10054334 | All Organisms → cellular organisms → Bacteria | 2969 | Open in IMG/M |
| 3300017787|Ga0183260_10060726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2789 | Open in IMG/M |
| 3300017787|Ga0183260_10088658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2251 | Open in IMG/M |
| 3300017787|Ga0183260_10164454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1575 | Open in IMG/M |
| 3300017787|Ga0183260_10359603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 976 | Open in IMG/M |
| 3300017787|Ga0183260_10511965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300017787|Ga0183260_10909844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300017789|Ga0136617_10024961 | All Organisms → cellular organisms → Bacteria | 5328 | Open in IMG/M |
| 3300017789|Ga0136617_10125460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2205 | Open in IMG/M |
| 3300017789|Ga0136617_10208387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1644 | Open in IMG/M |
| 3300017789|Ga0136617_10225180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1571 | Open in IMG/M |
| 3300017789|Ga0136617_10238026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1521 | Open in IMG/M |
| 3300017789|Ga0136617_10272610 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1401 | Open in IMG/M |
| 3300017789|Ga0136617_10281610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1374 | Open in IMG/M |
| 3300017789|Ga0136617_10336488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1232 | Open in IMG/M |
| 3300017789|Ga0136617_10631120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
| 3300017789|Ga0136617_10793479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
| 3300017789|Ga0136617_11134264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300019360|Ga0187894_10104537 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300019458|Ga0187892_10005575 | All Organisms → cellular organisms → Bacteria | 19661 | Open in IMG/M |
| 3300027618|Ga0208736_1009599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2437 | Open in IMG/M |
| 3300027618|Ga0208736_1083130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300027910|Ga0209583_10204836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
| 3300031454|Ga0272427_1065878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1570 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 89.32% |
| Polar Desert | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert | 3.88% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.94% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.97% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.97% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.97% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.97% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002548 | Polar desert microbial communities from Antarctic Dry Valleys - UQ255 | Environmental | Open in IMG/M |
| 3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300011244 | Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 18 - S13.2.60.3.a - transect 2, repeat 3, age 113 years, surface depth) | Environmental | Open in IMG/M |
| 3300012042 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ489 (22.06) | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
| 3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012094 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06) | Environmental | Open in IMG/M |
| 3300012185 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06) | Environmental | Open in IMG/M |
| 3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
| 3300012188 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06) | Environmental | Open in IMG/M |
| 3300012526 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ857 (21.06) | Environmental | Open in IMG/M |
| 3300012529 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06) | Environmental | Open in IMG/M |
| 3300012531 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ864 (21.06) | Environmental | Open in IMG/M |
| 3300012679 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06) | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012682 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300013097 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ859 (21.06) | Environmental | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300027618 | Polar desert microbial communities from Antarctic Dry Valleys - UQ255 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300031454 | Rock endolithic microbial communities from Victoria Land, Antarctica - Siegfried Peak sud | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24974J35850_10039072 | 3300002548 | Polar Desert | MAGIRTLATAILQKTNCQNKKAQLENFSDDFDNLIITLKTMNFL* |
| JGI24974J35850_10234381 | 3300002548 | Polar Desert | MAEVRTLTTIILSKTNCQNKKAQLENFSDDFDSLIITLKMLNFL* |
| rootL2_102544903 | 3300003322 | Sugarcane Root And Bulk Soil | MSGIRTLATIILEKTGSQNKKAQMEKFADDFDKLILTLKDLNFL* |
| Ga0075023_1000356131 | 3300006041 | Watersheds | MAGLRTLATTILEKTNCQNKKAQLEDFADDFDNLIITLKGMNFL* |
| Ga0137483_1070862 | 3300011244 | Glacier Forefield Soil | MAGLRTLATTILQKTNCQNKKEQLEDFADNFDNLILTLKAFNFL* |
| Ga0136627_10302173 | 3300012042 | Polar Desert Sand | MAEVRTMATIILSETNCQNKKAQLENFSDNFDSLIVTLKLLNFL* |
| Ga0136627_10667952 | 3300012042 | Polar Desert Sand | MAEIRTLATTILSKTNCQNKKAQLENFGDDFDSLIIALKRFKFL* |
| Ga0136631_100724182 | 3300012043 | Polar Desert Sand | MAEVRTLTTIILSKTNCQNKKAQLENFSDDFDSLIITLKILNFL* |
| Ga0136623_100666412 | 3300012045 | Polar Desert Sand | MAEVRTMATIILSETKCQNKKAQLENFSDNFDSLIVTLKMLNFL* |
| Ga0136623_100908232 | 3300012045 | Polar Desert Sand | MAGLRTLATTILRKTKCQNKKEQLEDFADNFDTLIIALKTFNFL* |
| Ga0136623_101446062 | 3300012045 | Polar Desert Sand | MAGIRTLAMSILQKTRCHNKKAQLEDFADDFDSLIITLKAMNFL* |
| Ga0136634_100166155 | 3300012046 | Polar Desert Sand | AFKKKTVNRIMAGVRTLATALLQKTNCQNKKAQLENFSDDFDNLIIILKILNFL* |
| Ga0136634_100344872 | 3300012046 | Polar Desert Sand | MAGIRTLATIILEKTRCQNKKAQLENFADDFDHLIVTLKVMNFL* |
| Ga0136634_100362971 | 3300012046 | Polar Desert Sand | MAGLRTIATTLLQKTKCQNKKEQLENFADDFGNLIITLKS |
| Ga0136634_100419802 | 3300012046 | Polar Desert Sand | MGGLRTLATAILEQTKCQNKKAQLENFSDDFDNLIITLKALNFL* |
| Ga0136634_100555144 | 3300012046 | Polar Desert Sand | TAILEKTGCQNKKAQLDDFADNFDNLILTLQLFNFL* |
| Ga0136634_100783661 | 3300012046 | Polar Desert Sand | MGGLRTLTTAILEKTGCQNKKAQLDDFADNFDNLILTLQLFNFL* |
| Ga0136634_100784401 | 3300012046 | Polar Desert Sand | MAGVRTLAIAILDQTNCQNKKAQLENFSDDFDSLIITLKKFNFL* |
| Ga0136634_100896235 | 3300012046 | Polar Desert Sand | TIILSKTNCQNKKAQLENFSDDFDSLIITLKMLNFL* |
| Ga0136634_101181351 | 3300012046 | Polar Desert Sand | MAGLRTLATTILRKTKCQNKKEQLEDFADNFDNLI |
| Ga0136634_101456611 | 3300012046 | Polar Desert Sand | TTVLSEIKCQNKKAQLENFSDDFDSLIVTLKMLNFL* |
| Ga0136634_101662221 | 3300012046 | Polar Desert Sand | TILEKTECQNKKAQLEDFADDFDNLIITLKLINFL* |
| Ga0136634_102522722 | 3300012046 | Polar Desert Sand | MAGVRTLAIAILSQTNCQNKKAQLENFSDDFDTLIITLKKLDFL* |
| Ga0136634_102613772 | 3300012046 | Polar Desert Sand | ILEKTGCQNKKAQLENFADDFDKLIITLKVMNFL* |
| Ga0136634_103005522 | 3300012046 | Polar Desert Sand | TIILQKTNCQNKKAQLENFSDDFDSLIVTLKSLNFL* |
| Ga0136634_103400612 | 3300012046 | Polar Desert Sand | MAGIRSLATIILEKTKCQNKKAQLEEFADDFDTLIITLKEMNFL* |
| Ga0136634_103400613 | 3300012046 | Polar Desert Sand | ILQKTNCQNKKAQLENFSDDFDGLIVTLKSLDFL* |
| Ga0136634_103612321 | 3300012046 | Polar Desert Sand | FEIACSKKIKCGQKKTVNRLMAGVRTLAIAILDQTNWQNKKAQSENFSDDFDSLIITLKKFNFL* |
| Ga0136634_104422722 | 3300012046 | Polar Desert Sand | ILQKTNCQNKKEQLEDFADNFDNLILTLKTFNFL* |
| Ga0136634_104865941 | 3300012046 | Polar Desert Sand | MAEVRTLATTILSQTNCQNKKAQLENFGDNFGNLIITLKSLNF |
| Ga0136621_11346002 | 3300012092 | Polar Desert Sand | MAGIRTLATTILQKTGCRNKKAQLENFADDFDNLIITLKVMNFL* |
| Ga0136632_100740732 | 3300012093 | Polar Desert Sand | MASIRTLATVILHKTNCQNKKAQLENFSDDFDNLIITLKNLNFL* |
| Ga0136632_100994811 | 3300012093 | Polar Desert Sand | MAGLRTLATTILQKTNWQNKKEQLEDFADNFDTLIIT |
| Ga0136638_100036934 | 3300012094 | Polar Desert Sand | MAEVRTLATAILNKTNCQNKKAQLENFSDDFDSLIITLKNLNFL* |
| Ga0136638_100095341 | 3300012094 | Polar Desert Sand | MAGVRTLAIAILDQTNWQNKKAQSENFSDDFDSLTITLKKFNFL* |
| Ga0136638_100368063 | 3300012094 | Polar Desert Sand | TIILEKTKCQNKKAQLENFADDFDNLIITLKVMNFL* |
| Ga0136638_100454181 | 3300012094 | Polar Desert Sand | MAGIRTLATIILEKTKCQNKKAQLENFADDFDNLIITLKVMNFL* |
| Ga0136638_100505772 | 3300012094 | Polar Desert Sand | MAEIRTLATTILSNTNCQNKKAQLENFSDDFDSLIIKLKVLNFL* |
| Ga0136638_100921123 | 3300012094 | Polar Desert Sand | MAEVRTLATTILNKTNCQNKKAQLENFSDDFDGLII |
| Ga0136638_101126181 | 3300012094 | Polar Desert Sand | MASIRTLATVILHKTNCQNKKAQLENFSDDFDNLIIT |
| Ga0136638_102834941 | 3300012094 | Polar Desert Sand | ATTILRKTKCQNKKEQLEDFADNFDNLIIALKTFNFL* |
| Ga0136619_100633691 | 3300012185 | Polar Desert Sand | MAGIRTLATTILQKTGCRNKKAQLENFADDFDNLIITLKGLN |
| Ga0136619_102622792 | 3300012185 | Polar Desert Sand | MILEKTKCQNKKAQLEDFADDFDNLIITLKGLNFL* |
| Ga0136620_101140291 | 3300012186 | Polar Desert Sand | TVILHKTNCQNKKAQLENFSDDFDNLIITLKNLNFL* |
| Ga0136618_100188011 | 3300012188 | Polar Desert Sand | TIILQKINCQNKKAQLENFGDDFDSLIVTLKSLNFL* |
| Ga0136618_100597082 | 3300012188 | Polar Desert Sand | MAEVRTLAIAILNQTNCQNKKAQLENFSDDFDSLIITLKKLNFL* |
| Ga0136618_101082562 | 3300012188 | Polar Desert Sand | MAEVRTLTTTILSKTNGQNKKAQLENFSDDFDGLIITLKMLNFL* |
| Ga0136618_101924221 | 3300012188 | Polar Desert Sand | MAGLRTIATTILRKTKCQNKKEQLEDFADNFDNLIIALKTFNF |
| Ga0136637_10006219 | 3300012526 | Polar Desert Sand | MAGLRTIATTILRKTKCQNKKEQLEDFADNFDTLILALKTFNFL* |
| Ga0136630_11578222 | 3300012529 | Polar Desert Sand | MAGIRTLAMSILQKTRCHNKKAQSEDFADDFDSLIITLKAMNFL* |
| Ga0136630_11752111 | 3300012529 | Polar Desert Sand | MAILQKTKCQNKKAQLENFSDDFDNLIITLKVLNFL* |
| Ga0136630_13384902 | 3300012529 | Polar Desert Sand | MGEIRTLAIAILQKTNCQNKKAQLENFSDDFDNLIVTLKLLNFL* |
| Ga0136640_100418761 | 3300012531 | Polar Desert Sand | TTILRKTKCQNKKEQLEDFADNFDTLIIALKTFNFL* |
| Ga0136640_104088901 | 3300012531 | Polar Desert Sand | MAEVRTMATIILSETNCQNKKAQLENFSDNFDSLIVALKLLNF |
| Ga0136616_100829392 | 3300012679 | Polar Desert Sand | MAEVRTLATAILNKTNCQNKKAQLENFSDDFDGLIITLKNLNFL* |
| Ga0136616_104713931 | 3300012679 | Polar Desert Sand | MAGLRTIATTILRKTKCQNKKEQLEDFADNFDNLIIALKTFN |
| Ga0136616_105529973 | 3300012679 | Polar Desert Sand | RTLATTILQKTNCQNKKEQLENFADNFDNLIVTLKTFNFL* |
| Ga0136616_105831401 | 3300012679 | Polar Desert Sand | ILRKTKCQNKKEQLEDFADNFDNLIIALKTFNFL* |
| Ga0136612_101506421 | 3300012680 | Polar Desert Sand | MAEIRTLATTILSNTNCQNKKAQLENFSDDFDSLIITLKILNFL* |
| Ga0136613_100675111 | 3300012681 | Polar Desert Sand | TTILQKTNCQNKKEQLEDFADNFDNLIITLKTFNFL* |
| Ga0136613_100859783 | 3300012681 | Polar Desert Sand | MAGLRTLACEILQKTKCQNKKAQLENFADNFDDLIITLKILNFL* |
| Ga0136613_101002932 | 3300012681 | Polar Desert Sand | TILQKTNCQNKKEQLEDFADNFDNLIITLKTFNFL* |
| Ga0136613_102463651 | 3300012681 | Polar Desert Sand | QQTMAGLRTLATTILRKTKCKNKKEQLEDFADNFDTLILALKTFNFL* |
| Ga0136613_104810301 | 3300012681 | Polar Desert Sand | MAEVRTMATIILSETKCQNKKAQLENFSDNFDSLIVT |
| Ga0136613_107933301 | 3300012681 | Polar Desert Sand | TILRKTKCQNKKEQLEDFADNFDTLILALKTFNFL* |
| Ga0136611_101410053 | 3300012682 | Polar Desert Sand | MAGIRTLATTILQNTGCHNKRAQLEDFADDFDNLIITLKVMNFL* |
| Ga0136611_101949293 | 3300012682 | Polar Desert Sand | MGGLRTLAAIILQKTNCQNKKEQLEDFADNFDNLIITLK |
| Ga0136611_103095431 | 3300012682 | Polar Desert Sand | KKKLQQTMAGLRTIATTLLHKTRCQNKKAQLEEFTDNFDD* |
| Ga0136611_108508321 | 3300012682 | Polar Desert Sand | MGEIRTMATIILQKINCRNKKAQLENFGDDFDSLIVTLKSLNFL* |
| Ga0136614_100460384 | 3300012684 | Polar Desert Sand | MAGVRTLTTIILSQTNCQNKKAQLENFSDDFGSLIVTLKILNFL* |
| Ga0136614_105657551 | 3300012684 | Polar Desert Sand | ILQKTNCQNKKEQLEDFADNFDTLIITLKTFNFL* |
| Ga0136614_107676091 | 3300012684 | Polar Desert Sand | IMAEVRTLAIAILNKTNCQYKKAQLENFSDDFDGLIITLKNLNFL* |
| Ga0136639_103171121 | 3300013097 | Polar Desert Sand | MAGLRTLATTILQKTNCQNKKEQLEDFADNFDNLIITLKT |
| Ga0180121_100138042 | 3300017695 | Polar Desert Sand | MAGIRTLATAILQKTPCQNKKAQLENFSDDFDNLIITLKVLNFL |
| Ga0180121_100608062 | 3300017695 | Polar Desert Sand | MAGIRTLVTTILKKTRCQNKKAQLEDFADDYDSLIITLKLMNFL |
| Ga0180121_101134462 | 3300017695 | Polar Desert Sand | MAGVRTLAIAILNQTNCQNKKAQLENFSDDFDSLIITLKKFNFL |
| Ga0180121_102808052 | 3300017695 | Polar Desert Sand | MGGLRTLTTAILEKTECQNKKAQLDDFADNFDNLILTLKLFNFL |
| Ga0180121_103290112 | 3300017695 | Polar Desert Sand | MGGLRTLTTAILQKTGCQNRKAQIDDFADSFDYLILTLKTFNFL |
| Ga0180121_103426292 | 3300017695 | Polar Desert Sand | MGEIRTLATIILQKTKCQNKKAQLENFGDDFDGLIVTLKSLNFL |
| Ga0183260_100543342 | 3300017787 | Polar Desert Sand | MAEIRTLATTILSNTNCQNKKAQLENFSDDFDSLIITLKILNFL |
| Ga0183260_100607263 | 3300017787 | Polar Desert Sand | MAGIRTVAAAILNQTNCPNKKAQLENFSDDFDELIVTLKLLNFL |
| Ga0183260_100886582 | 3300017787 | Polar Desert Sand | MAGIRTLATIILEKTKCQNKKAQLENFADDFDNLIITLKVMNFL |
| Ga0183260_101644543 | 3300017787 | Polar Desert Sand | MAEVRTLAIAILNQTNCQNKKAQLENFSDDFDSLIITLKKLNFL |
| Ga0183260_103596032 | 3300017787 | Polar Desert Sand | MGEIRTLATIILQKINCLNKKAQLENFGDDFDSLIITLKSLNFL |
| Ga0183260_105119653 | 3300017787 | Polar Desert Sand | VATIILSKTNWQNKKAQLENFSDDFDSLIVTLKILNFL |
| Ga0183260_109098441 | 3300017787 | Polar Desert Sand | TIILSKTNCQNKKAQLENFGDDFDSLIVTLKFLNFL |
| Ga0136617_100249614 | 3300017789 | Polar Desert Sand | MAGLRTLATTILQKTNCQNKKEQLEDFADNFDNLIITLKTFNFL |
| Ga0136617_101254602 | 3300017789 | Polar Desert Sand | MAGVRTLAIAILSQTSCQNKKAQLENFSDDFDTLIITLDII |
| Ga0136617_102083873 | 3300017789 | Polar Desert Sand | MGGLRTLTTAILEKTKCQNKKAQLDNFADNFDNLILTLKLFNFL |
| Ga0136617_102251802 | 3300017789 | Polar Desert Sand | MAGVRTLAIAILDQTNWQNKKAQSENFSDDFDSLIITLKKFNFL |
| Ga0136617_102380263 | 3300017789 | Polar Desert Sand | MAGIRTLATTILEKTECQNKKAQLEDFADDFDNLIITLKLINFL |
| Ga0136617_102726102 | 3300017789 | Polar Desert Sand | MAEVRTLTTTILSKTNGQNKKAQLENFSDDFDGLIITLKMLNFL |
| Ga0136617_102816103 | 3300017789 | Polar Desert Sand | MAAIRRLATAILEKTNCQNKKAQLEDFSDYFDNLIITLKIMNFL |
| Ga0136617_103364884 | 3300017789 | Polar Desert Sand | MAEIRTLATIILRKTNCQNKKAQLENFGDDFDSLIVTLKVLNFL |
| Ga0136617_106311202 | 3300017789 | Polar Desert Sand | TIILRKTNCQNKKAQLENFGDDFDSLIVTLKVLNFL |
| Ga0136617_107934791 | 3300017789 | Polar Desert Sand | MAGLRTVATTILQKTNCQNKKEQLEDFADNFDNLIITLKT |
| Ga0136617_111342641 | 3300017789 | Polar Desert Sand | MAGLRTIATTILRKTKCQNKKEQLEDFADNFDNLI |
| Ga0187894_101045371 | 3300019360 | Microbial Mat On Rocks | IRTLATTILNKTDCQNKKAQLEKFSDNFDDLIMKLKLLNFLRVSERLCK |
| Ga0187892_1000557518 | 3300019458 | Bio-Ooze | TTILNKTDCQNKKAQLEKFSDNFDDLIMKLKLLNFL |
| Ga0208736_10095992 | 3300027618 | Polar Desert | MAGIRTLATAILQKTNCQNKKAQLENFSDDFDNLIITLKTMNFL |
| Ga0208736_10831301 | 3300027618 | Polar Desert | MAGIRTLATTILEKTRCQNKKAQLENFADDFDNLIV |
| Ga0209583_102048362 | 3300027910 | Watersheds | MAGLRTLATTILEKTNCQNKKAQLEDFADDFDNLIITLKGMNFL |
| Ga0272427_10658781 | 3300031454 | Rock | MAEVRTIATIVISTTEGQNKKAQLENFSDNFDSLIVTLK |
| ⦗Top⦘ |