Basic Information | |
---|---|
Family ID | F098304 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 42 residues |
Representative Sequence | MIAIGFGFLALFSILSILLGNEDPRRADPRDDVRLWMRYGLR |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 89.42 % |
% of genes near scaffold ends (potentially truncated) | 21.15 % |
% of genes from short scaffolds (< 2000 bps) | 90.38 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (92.308 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.269 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.808 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.615 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF13404 | HTH_AsnC-type | 47.12 |
PF01988 | VIT1 | 11.54 |
PF01037 | AsnC_trans_reg | 4.81 |
PF04542 | Sigma70_r2 | 4.81 |
PF07883 | Cupin_2 | 3.85 |
PF04545 | Sigma70_r4 | 1.92 |
PF10099 | RskA | 0.96 |
PF08281 | Sigma70_r4_2 | 0.96 |
PF03176 | MMPL | 0.96 |
PF02423 | OCD_Mu_crystall | 0.96 |
PF01209 | Ubie_methyltran | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 11.54 |
COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 11.54 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 4.81 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 4.81 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 4.81 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 4.81 |
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.96 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.96 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.96 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.96 |
COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.31 % |
Unclassified | root | N/A | 7.69 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459016|G1P06HT01BFT6R | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2007225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 532 | Open in IMG/M |
3300000891|JGI10214J12806_11249354 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300000891|JGI10214J12806_12627066 | Not Available | 651 | Open in IMG/M |
3300000956|JGI10216J12902_100675327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 644 | Open in IMG/M |
3300000956|JGI10216J12902_110043778 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300004081|Ga0063454_100988346 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300004114|Ga0062593_103411150 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300004157|Ga0062590_101158324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 750 | Open in IMG/M |
3300004463|Ga0063356_100275778 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
3300004463|Ga0063356_100703886 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
3300004463|Ga0063356_104827936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 579 | Open in IMG/M |
3300004479|Ga0062595_100517868 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300005093|Ga0062594_102064164 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300005181|Ga0066678_10181487 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
3300005293|Ga0065715_10174491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1522 | Open in IMG/M |
3300005330|Ga0070690_100652629 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300005332|Ga0066388_105351958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 651 | Open in IMG/M |
3300005344|Ga0070661_101825599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 516 | Open in IMG/M |
3300005354|Ga0070675_100388262 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
3300005354|Ga0070675_100656330 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300005406|Ga0070703_10013577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2314 | Open in IMG/M |
3300005440|Ga0070705_100379647 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300005526|Ga0073909_10391596 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300005556|Ga0066707_10917049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 537 | Open in IMG/M |
3300005713|Ga0066905_100748968 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300005718|Ga0068866_11422836 | Not Available | 507 | Open in IMG/M |
3300005937|Ga0081455_10297838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1159 | Open in IMG/M |
3300009012|Ga0066710_101475336 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
3300009148|Ga0105243_11589438 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300010039|Ga0126309_10022626 | All Organisms → cellular organisms → Bacteria | 2767 | Open in IMG/M |
3300010041|Ga0126312_10306052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1122 | Open in IMG/M |
3300010403|Ga0134123_13194373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 527 | Open in IMG/M |
3300011003|Ga0138514_100032871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 991 | Open in IMG/M |
3300011119|Ga0105246_11617244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 613 | Open in IMG/M |
3300011432|Ga0137428_1208706 | Not Available | 579 | Open in IMG/M |
3300012202|Ga0137363_11269412 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300012205|Ga0137362_11404078 | Not Available | 584 | Open in IMG/M |
3300012685|Ga0137397_10433194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 980 | Open in IMG/M |
3300012922|Ga0137394_10901438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 738 | Open in IMG/M |
3300012930|Ga0137407_11228177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 711 | Open in IMG/M |
3300012955|Ga0164298_10655523 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300012988|Ga0164306_10458450 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300013297|Ga0157378_12348587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 585 | Open in IMG/M |
3300014326|Ga0157380_11578324 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300015371|Ga0132258_10020034 | All Organisms → cellular organisms → Bacteria | 14558 | Open in IMG/M |
3300017695|Ga0180121_10134170 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300017792|Ga0163161_10927463 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300018027|Ga0184605_10051764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1748 | Open in IMG/M |
3300018027|Ga0184605_10113573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1202 | Open in IMG/M |
3300018027|Ga0184605_10116750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1186 | Open in IMG/M |
3300018028|Ga0184608_10020092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2415 | Open in IMG/M |
3300018028|Ga0184608_10329039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 671 | Open in IMG/M |
3300018028|Ga0184608_10427830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 572 | Open in IMG/M |
3300018031|Ga0184634_10414058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 613 | Open in IMG/M |
3300018051|Ga0184620_10146286 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300018056|Ga0184623_10000108 | All Organisms → cellular organisms → Bacteria | 32072 | Open in IMG/M |
3300018071|Ga0184618_10306306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 677 | Open in IMG/M |
3300018074|Ga0184640_10512921 | Not Available | 527 | Open in IMG/M |
3300018076|Ga0184609_10294079 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300018084|Ga0184629_10401059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 721 | Open in IMG/M |
3300018429|Ga0190272_10078615 | All Organisms → cellular organisms → Bacteria | 2033 | Open in IMG/M |
3300018432|Ga0190275_13116603 | Not Available | 536 | Open in IMG/M |
3300018920|Ga0190273_11426563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 606 | Open in IMG/M |
3300019356|Ga0173481_10210610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 849 | Open in IMG/M |
3300019377|Ga0190264_10067192 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
3300021078|Ga0210381_10384909 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300021080|Ga0210382_10089967 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
3300021363|Ga0193699_10006789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4124 | Open in IMG/M |
3300021363|Ga0193699_10135203 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300022534|Ga0224452_1027135 | All Organisms → cellular organisms → Bacteria | 1632 | Open in IMG/M |
3300022756|Ga0222622_11268423 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300025165|Ga0209108_10483153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 597 | Open in IMG/M |
3300025899|Ga0207642_10625467 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300025903|Ga0207680_10218050 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
3300025912|Ga0207707_10360030 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
3300025918|Ga0207662_10418881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 911 | Open in IMG/M |
3300025922|Ga0207646_11434234 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300025945|Ga0207679_10388906 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
3300025960|Ga0207651_10033615 | All Organisms → cellular organisms → Bacteria | 3310 | Open in IMG/M |
3300025961|Ga0207712_11758350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 556 | Open in IMG/M |
3300026142|Ga0207698_12595804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 516 | Open in IMG/M |
3300026528|Ga0209378_1274716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 536 | Open in IMG/M |
3300027562|Ga0209735_1059545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 822 | Open in IMG/M |
3300027647|Ga0214468_1127115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 642 | Open in IMG/M |
3300028589|Ga0247818_10613359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 749 | Open in IMG/M |
3300028711|Ga0307293_10035046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1530 | Open in IMG/M |
3300028718|Ga0307307_10273165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 542 | Open in IMG/M |
3300028807|Ga0307305_10246833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 816 | Open in IMG/M |
3300028814|Ga0307302_10174282 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
3300028814|Ga0307302_10184891 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300028819|Ga0307296_10640254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 582 | Open in IMG/M |
3300030336|Ga0247826_11800163 | Not Available | 501 | Open in IMG/M |
3300030619|Ga0268386_10172166 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
3300031093|Ga0308197_10215330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 662 | Open in IMG/M |
3300031226|Ga0307497_10137467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1000 | Open in IMG/M |
3300031228|Ga0299914_10002634 | All Organisms → cellular organisms → Bacteria | 12416 | Open in IMG/M |
3300031852|Ga0307410_11838490 | Not Available | 538 | Open in IMG/M |
3300031949|Ga0214473_10308490 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
3300032179|Ga0310889_10742405 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300033811|Ga0364924_035430 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300033815|Ga0364946_178710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 500 | Open in IMG/M |
3300034169|Ga0370480_0143078 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300034644|Ga0370548_084953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 619 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.27% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 12.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.69% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.88% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.88% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.92% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.92% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.92% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.92% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.96% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.96% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.96% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027647 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq | Environmental | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
3300034169 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15 | Environmental | Open in IMG/M |
3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2ZMR_02098690 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | MIALGFGFLALFSILSILLGEDESRRDDPRDDVKIWMRYAIR |
ICChiseqgaiiDRAFT_20072251 | 3300000033 | Soil | MIAIGFGLLALFSILSILLGSEDPRPADPRDDFRLWMRFVVR* |
JGI10214J12806_112493542 | 3300000891 | Soil | MIALGFAVLALFSVLSIVLGNEDSRRGADPRDDLALWMRLGAR* |
JGI10214J12806_126270661 | 3300000891 | Soil | MIALGFGFLALFSILSILLGEDESRRDDPRDDVKLWMRYAIR* |
JGI10216J12902_1006753272 | 3300000956 | Soil | MIALGFGFLALFSILSILLGEDESRRDDPRDDVKIWMRYAIR* |
JGI10216J12902_1100437782 | 3300000956 | Soil | MIAIGFGLLALFSVLSILLGSEDPRREDPRDDIRIWMRYGVR* |
Ga0063454_1009883462 | 3300004081 | Soil | MIAIGLGFLALFSVLSILLGSEDPRRADPRDDIRIWMRYGVR* |
Ga0062593_1034111501 | 3300004114 | Soil | MIAIGFGLLALFSVLSILLGSEDPRREDPQDEIRLWMRYVVR* |
Ga0062590_1011583241 | 3300004157 | Soil | MIALGFGFLALFSLLSIVLGTEDPRHADPRDDIRLWMRYGIR* |
Ga0063356_1002757782 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIAIGFGLLALFSILSILLGSEDPRRVDPRDDIRIWMRYGVR* |
Ga0063356_1007038863 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIAIGFGFLALFSVLSILLGSEDPQPADPRDDVRLWMRYGIR* |
Ga0063356_1048279362 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIAIGLGFLALFSLLSILLGDEDRRHEDPRDDMRLWMRYSIR* |
Ga0062595_1005178682 | 3300004479 | Soil | MIVIGIGFLALFSILSIALGNDERQTDIRDDARLWIRFVAH* |
Ga0062594_1020641641 | 3300005093 | Soil | MIAIGFGLLALFSVLSILLGNEDPRREDPRDDIRLWMRYGLR* |
Ga0066678_101814872 | 3300005181 | Soil | MILIGIGFLALFSILSIVLGNDEPRATDIRDDARLWIRFVAH* |
Ga0065715_101744913 | 3300005293 | Miscanthus Rhizosphere | MIGIGFGLLALFSVLSIVLGHEDPRREDPRDDIRVWLPYGIR* |
Ga0070690_1006526292 | 3300005330 | Switchgrass Rhizosphere | MIGIGFGLLALFSVLSIVLGHEDPRREDPRDDIRIWTPYGIR* |
Ga0066388_1053519582 | 3300005332 | Tropical Forest Soil | VIAIGFGLLALFSALSILLGSEDPRYEDPRDDIRIWMRYGVR* |
Ga0070661_1018255991 | 3300005344 | Corn Rhizosphere | MIAIGFGLLALFSVLSIVLGHEDPRREDPRDDIRVWLPYGIR* |
Ga0070675_1003882622 | 3300005354 | Miscanthus Rhizosphere | MIGIGFGLLALFSVLSIVLGHGDPRREDPRDDIRVWLPYGIR* |
Ga0070675_1006563301 | 3300005354 | Miscanthus Rhizosphere | HRSEGVPMIGIGFGLLALFSVLSIVLGHEDPRREDPRDDIRIWTPYGIR* |
Ga0070703_100135771 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MFVAALGFLALFSLISILLGYEDPRPITDPRDELLLWMRFGVR* |
Ga0070705_1003796473 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAIGIGFLALFSILSIALGNDERQTDIRDDARLWIRFVAH* |
Ga0073909_103915962 | 3300005526 | Surface Soil | MIAIGIGFLALFSILSIALGNDERQNDIRDDARLWIRFVAH* |
Ga0066707_109170492 | 3300005556 | Soil | MILIGIGFLALFSILSIVLGNDEPRATDIRDDARLW |
Ga0066905_1007489682 | 3300005713 | Tropical Forest Soil | VIAIGFGLLALFSVLSILLGSEDPRFEDPRDDIRIWMRYGVR* |
Ga0068866_114228361 | 3300005718 | Miscanthus Rhizosphere | MIGIGFGLLALFSVLSIVLGHEDPRREDPRDDILIWTPYGIR* |
Ga0081455_102978383 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MIALGFGLLALFSVLSILLGSEDPRHADPRDDIRIWMRYGVR* |
Ga0066710_1014753361 | 3300009012 | Grasslands Soil | IGFLALFSILSIVLGNDEPRATDIRDDARLWIRFVAH |
Ga0105243_115894381 | 3300009148 | Miscanthus Rhizosphere | SEGVPMIGIGFGLLALFSVLSIVLGHEDPRREDPRDDIRIWTPYGIR* |
Ga0126309_100226262 | 3300010039 | Serpentine Soil | MIAFGIGFLALFSLLSIVLGNDEPRRVDPRDDIRLWMRFGLR* |
Ga0126312_103060522 | 3300010041 | Serpentine Soil | MIAFGIGFLALFSLLSIALGNDEPRRVDPRDDIRLWMRFGLR* |
Ga0134123_131943732 | 3300010403 | Terrestrial Soil | MIAIGFGLLALFSVLSILLGGEDPRRPDPRDDIRIWMRYGVR* |
Ga0138514_1000328711 | 3300011003 | Soil | MILIGIGFLALFSILSIALGNDERQTDIRDDARLWIRFVAH* |
Ga0105246_116172441 | 3300011119 | Miscanthus Rhizosphere | MIAIGFGLLALFSVLSILLGGEDPRRPDPRDDIRIWMR |
Ga0137428_12087061 | 3300011432 | Soil | MIAIGFGLLALFSVLSILLGSEEPRHADPRDDIHVWMRYGVR* |
Ga0137363_112694122 | 3300012202 | Vadose Zone Soil | MILIGIGFLALFSILSIVLGNDEPHATDIRDDARLWIRFVAH* |
Ga0137362_114040781 | 3300012205 | Vadose Zone Soil | MIAIGSGFLALFSILSIALGNDERQIDIRDDARLWIRFVAH* |
Ga0137397_104331942 | 3300012685 | Vadose Zone Soil | MIAIGIGFLALFSILSIVLGNDERQTDIRDDARLWIRFVAH* |
Ga0137394_109014382 | 3300012922 | Vadose Zone Soil | MIAIGIGFLALFSILSIVLGNDERQTDIRDDARLWIRFVA |
Ga0137407_112281772 | 3300012930 | Vadose Zone Soil | MIAIGIGFLALFSILSIVLGNDEPRATDIRDDARLWIRFVAH* |
Ga0164298_106555231 | 3300012955 | Soil | MIAIGFGLLALFSVLSIVLGHEDPRREDPRDDIRIWTPYGIR* |
Ga0164306_104584502 | 3300012988 | Soil | MIGIGFGLLALFSVLSIVLGHEDPRREDPSDDIRVWLPYGIR* |
Ga0157378_123485872 | 3300013297 | Miscanthus Rhizosphere | MIGIGFGLLALFSVLSIVLGHDDPRREDPRDDIRIWTPYGIR* |
Ga0157380_115783242 | 3300014326 | Switchgrass Rhizosphere | MIAIGFGLLALFSVLSILLGSEDPRHEDPRDDIRIWMRYGVR* |
Ga0132258_1002003412 | 3300015371 | Arabidopsis Rhizosphere | MIAIGFGLLALFSVLSILLGSEDPRREDPRDDIRLWMRYGLR* |
Ga0180121_101341702 | 3300017695 | Polar Desert Sand | MVLATIIGLLALFSVLSILLGSAEPRQTGRDPDTELKLWMRYGLR |
Ga0163161_109274632 | 3300017792 | Switchgrass Rhizosphere | MIGIGFGLLALFSVLSIVLGHEDPRREDPRDDIRIWTPYGIR |
Ga0184605_100517641 | 3300018027 | Groundwater Sediment | MIAIGIGFLALFSILSIALGNDERQTDIRDDARLWIRFVAH |
Ga0184605_101135731 | 3300018027 | Groundwater Sediment | MIAIGIGFLALFSILSVALGNDERQTDIRDDARLWIRFVAH |
Ga0184605_101167501 | 3300018027 | Groundwater Sediment | MIAFGIGFLALFSVLSIMLGNDEPRRTNPQDDVRLWMRFAAPTTNR |
Ga0184608_100200924 | 3300018028 | Groundwater Sediment | MIAIGIGFLALFSLLSILLGNEDPRQVDPQDELRLWMRFGIR |
Ga0184608_103290392 | 3300018028 | Groundwater Sediment | MIAIGFGFLALFSVLSILLGSEDPQPADPRDDVRLWM |
Ga0184608_104278301 | 3300018028 | Groundwater Sediment | MIAVGFGFLALFSVLSILLGSEDPQPADPRDDVRLWMRYGIR |
Ga0184634_104140582 | 3300018031 | Groundwater Sediment | MIAFGIGFLALFSLLSILLGNEDPRHADPRDDVRLWMRYSSR |
Ga0184620_101462862 | 3300018051 | Groundwater Sediment | MIAIGFGFLALFSVLSILLGSEDPQPADPRDDVRLWMRYGVR |
Ga0184623_1000010818 | 3300018056 | Groundwater Sediment | MIAIGFGFLALFSILSILLGNEDPRRADPRDDVRLWMRYGLR |
Ga0184618_103063061 | 3300018071 | Groundwater Sediment | MIAIGIGFLALFSLLSILLGNEDPRHVDPRDDIRLWMRFSIR |
Ga0184640_105129211 | 3300018074 | Groundwater Sediment | MIAFGIGFLALFSLLSILLGNEDPRHADPRDDVRLWMRYSLR |
Ga0184609_102940792 | 3300018076 | Groundwater Sediment | MIAFGIGFLALFSVLSIMLGNDEPRRTNPQDDVRLWMRFAAPTINR |
Ga0184629_104010591 | 3300018084 | Groundwater Sediment | MIAIGFGFLALFSILSILLGNEDPRHTDPRDDVRLWMRYGLR |
Ga0190272_100786153 | 3300018429 | Soil | MIAIGFGFLALFSVLSILLGSEDQRRADPRDDVRLWMRYGLR |
Ga0190275_131166031 | 3300018432 | Soil | MIAVGFGFLALFSLLSILLGTEDPRHADPRDDVRLWMRFGLR |
Ga0190273_114265631 | 3300018920 | Soil | MIAIGFGFLALFSILSILLGNEDPRHTDPKDDVRLWMRYGLR |
Ga0173481_102106102 | 3300019356 | Soil | MIAIGFGLLALFSVLSILLGSEDPRREDPQDEIRLWMRYVVR |
Ga0190264_100671923 | 3300019377 | Soil | GFLALFSVLSILLGNEDQRRADPRDDVRLWMRYGLR |
Ga0210381_103849092 | 3300021078 | Groundwater Sediment | IAFGFAFLALFSLLSILLGNEDPRHADPRDDIRLWMRFGIR |
Ga0210382_100899673 | 3300021080 | Groundwater Sediment | MIALGFGFLALFSLLSIVLGTEDPRHADPRDDIRLWMRYGIR |
Ga0193699_100067893 | 3300021363 | Soil | MIAIGFGFLALFSILSIMLGEDDSRRDDPRDDVKLWMRYAIR |
Ga0193699_101352033 | 3300021363 | Soil | MIAIGFGFLALFSILSIVLGEDESRRDDPRDDVKLWMRYAIR |
Ga0224452_10271353 | 3300022534 | Groundwater Sediment | MIAIGFGFLALFSVLSILLGSEDPQPADPRDDVRLWMRYGIR |
Ga0222622_112684232 | 3300022756 | Groundwater Sediment | IGFGLLALFSILSIVLGDEEPRRADPRDDVRLWLRFVAR |
Ga0209108_104831531 | 3300025165 | Soil | VIALAIGFLALFSLLSILLGNEDPRHVDPRDDIRLWMRFGLR |
Ga0207642_106254671 | 3300025899 | Miscanthus Rhizosphere | MIGIGFGLLALFSVLSIVLGHEDPRREDPRDDILIWTPYGIR |
Ga0207680_102180501 | 3300025903 | Switchgrass Rhizosphere | MIGIGFGLLALFSVLSIVLGHEDPRREDPRDDIRVWLPYGIR |
Ga0207707_103600303 | 3300025912 | Corn Rhizosphere | ALGFGFLALFSILSILLGEDESRRDDPRDDVKIWMRYAIR |
Ga0207662_104188812 | 3300025918 | Switchgrass Rhizosphere | MIAIGFGLLALFSVLSILLGSEDPRREDPRDDMRIWMRYGVR |
Ga0207646_114342342 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | EEPPMIAIGIGFLALFSILSIALGNDERQNDIRDDARLWIRFVAH |
Ga0207679_103889064 | 3300025945 | Corn Rhizosphere | MIAIGFGLLALFSVLSILLGGEDPRRPDPRDDIRIWMRYGVR |
Ga0207651_100336156 | 3300025960 | Switchgrass Rhizosphere | MIGIGFGLLALFSVLSIVLGHEDPRREDPRDDIRVIGT |
Ga0207712_117583501 | 3300025961 | Switchgrass Rhizosphere | MIAIGFGFLALFSVLSVLLGSEEPRHGDPQDDIRMWMRYGVR |
Ga0207698_125958042 | 3300026142 | Corn Rhizosphere | MIAIGFGLLALFSVLSIVLGHEDPRREDPRDDIRIWTPYGIR |
Ga0209378_12747161 | 3300026528 | Soil | MILIGIGFLALFSILSIVLGNDEPRATDIRDDARLWI |
Ga0209735_10595452 | 3300027562 | Forest Soil | MFLVGLGFLALFSILSIALGNDERQTDIRDDARLWIRFVAH |
Ga0214468_11271152 | 3300027647 | Soil | MIALGLGFLALFSLLSILLGTDDPRRVDPRDDVKFWMRYGIR |
Ga0247818_106133591 | 3300028589 | Soil | MIAIGFGLLALFSILSILLGSEDPRPADPRDDFRLWMRFVVR |
Ga0307293_100350463 | 3300028711 | Soil | MIAIGFGLLALFSILSIVLGDEEPRRADPRDDVRLWLRFVAR |
Ga0307307_102731652 | 3300028718 | Soil | MIAIGFGFLALFSILSIVLGDDDSRRDDPRDDVKLWMRYAIR |
Ga0307305_102468331 | 3300028807 | Soil | MIAVGIGFLALFSLLSILLGNEDQRRADPRDDVRLWMRFAVR |
Ga0307302_101742822 | 3300028814 | Soil | MIAIGIGFLALFSIISIMLSDSEPRREDPRDDIRLWMRFVAR |
Ga0307302_101848911 | 3300028814 | Soil | AFGIGFLALFSVLSIMLGNDEPRRTNPQDDVRLWMRFAAPTTNR |
Ga0307296_106402541 | 3300028819 | Soil | MIAVGFGFLALFSVLSILLGSEDPQPADPRDDVRL |
Ga0247826_118001631 | 3300030336 | Soil | MIAIGFGFLALFSVLSILLGSEEPRHGDPRDDIRMWMRYGVR |
Ga0268386_101721661 | 3300030619 | Soil | MVLLTIIGLLALFALFGILLGSEDPRHAGVDPRAEVNFWMRYGVR |
Ga0308197_102153301 | 3300031093 | Soil | MIAFGIGFLALFSVLSIMLGNDEPRRTNPQDDVRLWMRFA |
Ga0307497_101374673 | 3300031226 | Soil | MIAIGFGLLALFSVLSILLGSEDPRREDPRDDIRIWMRYSIR |
Ga0299914_100026347 | 3300031228 | Soil | MVLVTMLGLLALTSLLGILLGSEDPRQTGADPRTEIKFWMRYGIR |
Ga0307410_118384901 | 3300031852 | Rhizosphere | MIAVGFGFLALFSILSIMLGSEDPRRADPRDDVRFWMRFGIR |
Ga0214473_103084903 | 3300031949 | Soil | MIALGIGFLALFSILSILLGSEDPRRPDPRDDIRFWMRYGIR |
Ga0310889_107424052 | 3300032179 | Soil | FLALFSVLSILLGSEEPRQGDPRDDIRMWMRYGVR |
Ga0364924_035430_472_600 | 3300033811 | Sediment | MIAFGIGFLALFSLLSILLGNEDPRHADPRDDVRLWMRYSIR |
Ga0364946_178710_41_169 | 3300033815 | Sediment | MIAIGFGFLALFSILSILLGNEDPRQNDPRDDVRLWMRYGLR |
Ga0370480_0143078_134_262 | 3300034169 | Untreated Peat Soil | VIALAIGFLALFSLLSILLGNEDPRHVDPRDDIRLWMRFGMR |
Ga0370548_084953_1_123 | 3300034644 | Soil | MIAIGFGLLALFSILSIVLGDEEPRRADPRDDVRLWLRFVA |
⦗Top⦘ |