Basic Information | |
---|---|
Family ID | F098254 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 40 residues |
Representative Sequence | MLILAGGGRGFPLDYDELERWTRVGYERGMRSRKGER |
Number of Associated Samples | 74 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 28.71 % |
% of genes near scaffold ends (potentially truncated) | 60.58 % |
% of genes from short scaffolds (< 2000 bps) | 77.88 % |
Associated GOLD sequencing projects | 73 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.31 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (60.577 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (29.808 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.577 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.77% β-sheet: 0.00% Coil/Unstructured: 69.23% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF01872 | RibD_C | 1.92 |
PF13474 | SnoaL_3 | 1.92 |
PF00011 | HSP20 | 0.96 |
PF13185 | GAF_2 | 0.96 |
PF13396 | PLDc_N | 0.96 |
PF14333 | DUF4389 | 0.96 |
PF12728 | HTH_17 | 0.96 |
PF00589 | Phage_integrase | 0.96 |
PF12852 | Cupin_6 | 0.96 |
PF01695 | IstB_IS21 | 0.96 |
PF03861 | ANTAR | 0.96 |
PF13424 | TPR_12 | 0.96 |
PF12762 | DDE_Tnp_IS1595 | 0.96 |
PF13539 | Peptidase_M15_4 | 0.96 |
PF07553 | Lipoprotein_Ltp | 0.96 |
PF02894 | GFO_IDH_MocA_C | 0.96 |
PF08335 | GlnD_UR_UTase | 0.96 |
PF00892 | EamA | 0.96 |
PF11611 | DUF4352 | 0.96 |
PF13472 | Lipase_GDSL_2 | 0.96 |
PF01641 | SelR | 0.96 |
PF01019 | G_glu_transpept | 0.96 |
PF04075 | F420H2_quin_red | 0.96 |
PF11158 | DUF2938 | 0.96 |
PF12680 | SnoaL_2 | 0.96 |
PF14325 | DUF4383 | 0.96 |
PF11746 | DUF3303 | 0.96 |
PF00149 | Metallophos | 0.96 |
PF14690 | zf-ISL3 | 0.96 |
PF07452 | CHRD | 0.96 |
PF03462 | PCRF | 0.96 |
PF00106 | adh_short | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.92 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.92 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.96 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.96 |
COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.96 |
COG2844 | UTP:GlnB (protein PII) uridylyltransferase | Signal transduction mechanisms [T] | 0.96 |
COG3707 | Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains | Transcription [K] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 60.58 % |
All Organisms | root | All Organisms | 39.42 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000550|F24TB_12239547 | Not Available | 579 | Open in IMG/M |
3300000559|F14TC_103201834 | Not Available | 720 | Open in IMG/M |
3300000956|JGI10216J12902_105069022 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
3300000956|JGI10216J12902_106578783 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300000956|JGI10216J12902_126225228 | Not Available | 759 | Open in IMG/M |
3300001431|F14TB_100754503 | Not Available | 1864 | Open in IMG/M |
3300002568|C688J35102_120988392 | All Organisms → cellular organisms → Bacteria | 8605 | Open in IMG/M |
3300005339|Ga0070660_101421735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 589 | Open in IMG/M |
3300005937|Ga0081455_10011271 | All Organisms → cellular organisms → Bacteria | 8997 | Open in IMG/M |
3300005937|Ga0081455_10017320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6915 | Open in IMG/M |
3300005937|Ga0081455_10020007 | All Organisms → cellular organisms → Bacteria | 6318 | Open in IMG/M |
3300005937|Ga0081455_10095105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 2405 | Open in IMG/M |
3300005937|Ga0081455_10278575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1209 | Open in IMG/M |
3300005981|Ga0081538_10106711 | Not Available | 1389 | Open in IMG/M |
3300006581|Ga0074048_11221988 | Not Available | 538 | Open in IMG/M |
3300006847|Ga0075431_101311810 | Not Available | 685 | Open in IMG/M |
3300006854|Ga0075425_102306348 | Not Available | 598 | Open in IMG/M |
3300006854|Ga0075425_102746287 | Not Available | 542 | Open in IMG/M |
3300006876|Ga0079217_10284979 | Not Available | 905 | Open in IMG/M |
3300006903|Ga0075426_10007970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7552 | Open in IMG/M |
3300006904|Ga0075424_100947621 | Not Available | 918 | Open in IMG/M |
3300007004|Ga0079218_10386948 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
3300007004|Ga0079218_10692549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 954 | Open in IMG/M |
3300007004|Ga0079218_13432798 | Not Available | 537 | Open in IMG/M |
3300007076|Ga0075435_100975293 | Not Available | 740 | Open in IMG/M |
3300009094|Ga0111539_13135112 | Not Available | 533 | Open in IMG/M |
3300009100|Ga0075418_12539722 | Not Available | 559 | Open in IMG/M |
3300009789|Ga0126307_11354948 | Not Available | 576 | Open in IMG/M |
3300009840|Ga0126313_10051864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2897 | Open in IMG/M |
3300010036|Ga0126305_10471178 | Not Available | 835 | Open in IMG/M |
3300010037|Ga0126304_10715701 | Not Available | 677 | Open in IMG/M |
3300010038|Ga0126315_10152345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1369 | Open in IMG/M |
3300010040|Ga0126308_11276936 | Not Available | 521 | Open in IMG/M |
3300010041|Ga0126312_11128919 | Not Available | 576 | Open in IMG/M |
3300010042|Ga0126314_10347163 | Not Available | 1064 | Open in IMG/M |
3300010042|Ga0126314_10839585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 677 | Open in IMG/M |
3300010042|Ga0126314_11012887 | Not Available | 617 | Open in IMG/M |
3300010042|Ga0126314_11040308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 608 | Open in IMG/M |
3300010044|Ga0126310_11331884 | Not Available | 582 | Open in IMG/M |
3300010166|Ga0126306_10321486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 1196 | Open in IMG/M |
3300010166|Ga0126306_10547985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 918 | Open in IMG/M |
3300010166|Ga0126306_11368720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 585 | Open in IMG/M |
3300010166|Ga0126306_11813758 | Not Available | 511 | Open in IMG/M |
3300010999|Ga0138505_100000302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 3515 | Open in IMG/M |
3300010999|Ga0138505_100038110 | Not Available | 673 | Open in IMG/M |
3300011003|Ga0138514_100086450 | Not Available | 670 | Open in IMG/M |
3300011332|Ga0126317_10022090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 718 | Open in IMG/M |
3300012212|Ga0150985_114878897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2716 | Open in IMG/M |
3300012469|Ga0150984_110999611 | Not Available | 504 | Open in IMG/M |
3300012481|Ga0157320_1028508 | Not Available | 551 | Open in IMG/M |
3300014497|Ga0182008_10109354 | Not Available | 1369 | Open in IMG/M |
3300014497|Ga0182008_10843944 | Not Available | 535 | Open in IMG/M |
3300018028|Ga0184608_10001265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7323 | Open in IMG/M |
3300018031|Ga0184634_10032327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2077 | Open in IMG/M |
3300018054|Ga0184621_10107119 | Not Available | 992 | Open in IMG/M |
3300018075|Ga0184632_10387243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527 | 590 | Open in IMG/M |
3300018082|Ga0184639_10310924 | Not Available | 827 | Open in IMG/M |
3300018466|Ga0190268_10402932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 881 | Open in IMG/M |
3300019767|Ga0190267_10088014 | Not Available | 1196 | Open in IMG/M |
3300019767|Ga0190267_11368235 | Not Available | 534 | Open in IMG/M |
3300019869|Ga0193705_1007322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2408 | Open in IMG/M |
3300020003|Ga0193739_1003198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 4465 | Open in IMG/M |
3300022756|Ga0222622_10065458 | Not Available | 2117 | Open in IMG/M |
3300022883|Ga0247786_1116474 | Not Available | 586 | Open in IMG/M |
3300027907|Ga0207428_11238617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
3300028705|Ga0307276_10093230 | Not Available | 721 | Open in IMG/M |
3300028714|Ga0307309_10189623 | Not Available | 537 | Open in IMG/M |
3300028718|Ga0307307_10314396 | Not Available | 505 | Open in IMG/M |
3300028721|Ga0307315_10003190 | Not Available | 3982 | Open in IMG/M |
3300028744|Ga0307318_10251619 | Not Available | 615 | Open in IMG/M |
3300028754|Ga0307297_10029874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Arsenicicoccus → unclassified Arsenicicoccus → Arsenicicoccus sp. oral taxon 190 | 1594 | Open in IMG/M |
3300028754|Ga0307297_10232065 | Not Available | 652 | Open in IMG/M |
3300028784|Ga0307282_10231462 | Not Available | 886 | Open in IMG/M |
3300028791|Ga0307290_10192634 | Not Available | 747 | Open in IMG/M |
3300028796|Ga0307287_10027645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Friedmanniella | 2011 | Open in IMG/M |
3300028796|Ga0307287_10085631 | Not Available | 1184 | Open in IMG/M |
3300028799|Ga0307284_10224473 | Not Available | 742 | Open in IMG/M |
3300028811|Ga0307292_10007820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3617 | Open in IMG/M |
3300028811|Ga0307292_10393268 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300028819|Ga0307296_10037451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 2560 | Open in IMG/M |
3300028819|Ga0307296_10262742 | Not Available | 939 | Open in IMG/M |
3300028828|Ga0307312_10252320 | Not Available | 1142 | Open in IMG/M |
3300028875|Ga0307289_10218246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 784 | Open in IMG/M |
3300028881|Ga0307277_10560422 | Not Available | 513 | Open in IMG/M |
3300028889|Ga0247827_10601170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Humibacillus → Humibacillus xanthopallidus | 704 | Open in IMG/M |
3300030496|Ga0268240_10188633 | Not Available | 522 | Open in IMG/M |
3300030496|Ga0268240_10198098 | Not Available | 512 | Open in IMG/M |
3300030902|Ga0308202_1075429 | Not Available | 661 | Open in IMG/M |
3300030994|Ga0308153_105903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 690 | Open in IMG/M |
3300031058|Ga0308189_10479544 | Not Available | 532 | Open in IMG/M |
3300031091|Ga0308201_10361270 | Not Available | 535 | Open in IMG/M |
3300031091|Ga0308201_10366951 | Not Available | 532 | Open in IMG/M |
3300031099|Ga0308181_1033236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Microlunatus → Microlunatus kandeliicorticis | 906 | Open in IMG/M |
3300031901|Ga0307406_10024660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3594 | Open in IMG/M |
3300031995|Ga0307409_100016460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4892 | Open in IMG/M |
3300031995|Ga0307409_100272397 | Not Available | 1560 | Open in IMG/M |
3300031995|Ga0307409_100405740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 1303 | Open in IMG/M |
3300031995|Ga0307409_102256749 | Not Available | 574 | Open in IMG/M |
3300032126|Ga0307415_101694358 | Not Available | 609 | Open in IMG/M |
3300032126|Ga0307415_102037234 | Not Available | 559 | Open in IMG/M |
3300033811|Ga0364924_152891 | Not Available | 545 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 29.81% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 16.35% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.65% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 7.69% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.81% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 4.81% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.88% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 2.88% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.92% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.96% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.96% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030994 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_142 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F24TB_122395472 | 3300000550 | Soil | MGPVLIMAGGGDGTPPDYDQLERWTRVGYERGMRSIK |
F14TC_1032018341 | 3300000559 | Soil | ILAGNGRGLPFDYDELERWTRVGYERGMRSRRGER* |
JGI10216J12902_1050690222 | 3300000956 | Soil | LIVAGLLIMASGHDGKPMDYEALERWSRVGSEQGIRFRKGER* |
JGI10216J12902_1065787831 | 3300000956 | Soil | MLIMAGGHDGKPLDFGELERWTRIGYERGMAVRRVER* |
JGI10216J12902_1262252282 | 3300000956 | Soil | MVIAAGDGRGLPMDYDELRRWTRVGYERGMRSRKGDHEPAEGG* |
F14TB_1007545032 | 3300001431 | Soil | MLIMAGGSRGLPLDYDKLERWTHGSGFERSTRLRHEER* |
C688J35102_1209883927 | 3300002568 | Soil | VGYELVAAGMLIMAGGHDGKPLDYEELERWTRIGYERGVRSRKGER* |
Ga0070660_1014217352 | 3300005339 | Corn Rhizosphere | IAAGMMILAGGGRGLPLDYDELERWTRVGFERGTRSRNGER* |
Ga0081455_100112716 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MAAGRDSGPLDYDELERWTRVSYERGMRSRKGER* |
Ga0081455_1001732012 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MIILAGSHRGLPFDYDELERWTRIGFERGMRSHKGER* |
Ga0081455_100200074 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MAGGSRGLPLDYDKLERWTRGSGFERGPRLRHEER* |
Ga0081455_100951054 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MLIVAANHRDLPFDYDELERWTRVGYERGMRSRKGER* |
Ga0081455_102785752 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MLIMAGGNGTPLDYSELERRTRVGYERGMRSRKSEREAIC* |
Ga0081538_101067113 | 3300005981 | Tabebuia Heterophylla Rhizosphere | SRNVDHGHDGKPLDYKELERWTRVGYERGMRSRKGER* |
Ga0074048_112219882 | 3300006581 | Soil | MLILAGGGNGTPLDYGELERWTRVGYERGVRSRKGQR* |
Ga0075431_1013118102 | 3300006847 | Populus Rhizosphere | HELIGAGMLILAGDGRGLPFDYDELERWTQVGYERGMRSRKGER* |
Ga0075425_1023063483 | 3300006854 | Populus Rhizosphere | GMLILAGGGNGTPLDYRELERWTRVGYERGMRFRKGER* |
Ga0075425_1027462872 | 3300006854 | Populus Rhizosphere | AGMLIMAAGRDGMPLDFQALERWTRVGYERALKSGHGRH* |
Ga0079217_102849791 | 3300006876 | Agricultural Soil | MAGGHDGKPLDYGELERWTRVGYERGMRSRKGER* |
Ga0075426_100079705 | 3300006903 | Populus Rhizosphere | MNPGRFSMLILAGGGNSTPLDYRELERWTRLGYERGMKSRKGER* |
Ga0075424_1009476213 | 3300006904 | Populus Rhizosphere | IAAGMMILAGGGRGLPLDYDELERWTRVGFERGRRSRNGER* |
Ga0079218_103869482 | 3300007004 | Agricultural Soil | MRLVSWNILAGGGRGLPLDYDELERWTRVGFERGTRSRRGER* |
Ga0079218_106925491 | 3300007004 | Agricultural Soil | MLIAAAGREGKPLDYDELERWTRIGYERGVRSRKGER* |
Ga0079218_134327982 | 3300007004 | Agricultural Soil | MLILAGGGRGFPLDYDELERWTRVGYERGMRSRKGER* |
Ga0075435_1009752932 | 3300007076 | Populus Rhizosphere | AAMLILAGGGRGFLDYGELERWTRVGYERGMRSRKR* |
Ga0111539_131351121 | 3300009094 | Populus Rhizosphere | AAGMLIMAAGRDGMPLDFQALERWTRVGYERALKSGHGRH* |
Ga0075418_125397222 | 3300009100 | Populus Rhizosphere | AGMLILAGGGRGVPLDYAELERWTRVGYERGMKSSKGER* |
Ga0126307_113549482 | 3300009789 | Serpentine Soil | LILAGGGNGKPLDYGELERWTRVGYERGMRSRKGER* |
Ga0126313_100518645 | 3300009840 | Serpentine Soil | MLILAGGGQGLPLDYEELERWTRVGFERGMSSRKGER* |
Ga0126313_118224151 | 3300009840 | Serpentine Soil | MLIAAGRYDGEPLDYADMERWTRVGFERGTRFRKGER* |
Ga0126305_104711782 | 3300010036 | Serpentine Soil | GMLIMAGGGNGTPLDYDELERWTRVRYERGMRSRKGER* |
Ga0126304_107157011 | 3300010037 | Serpentine Soil | VGHELLAAAMLILAGGGHGVPLDYRELERWTRIGYERGL |
Ga0126315_101523451 | 3300010038 | Serpentine Soil | MLIAAGGYDGEPLDYADMERWTRVGFERGTRFRKGER* |
Ga0126308_112769361 | 3300010040 | Serpentine Soil | IGAGMLILAGGGQEFPLDYDDLERWTRVGFERGMRSRKGER* |
Ga0126312_111289191 | 3300010041 | Serpentine Soil | ALLILAGGGNGVPLNYGDLERWTRIGYERGMRSRKGER* |
Ga0126314_103471631 | 3300010042 | Serpentine Soil | GMLILAGGGEGFPLDYDELERWTRVGFERGMRSRMGER* |
Ga0126314_108395852 | 3300010042 | Serpentine Soil | AGMLIVAAGDRGLPMDYDELERWTRVGYERGMRSRHGER* |
Ga0126314_110128872 | 3300010042 | Serpentine Soil | ILAGGGEGFPLDYDELERWTRVGYDRGMRSRKGER* |
Ga0126314_110403082 | 3300010042 | Serpentine Soil | MLIMAGGGNGKPLDYDELERWTRVGFERGMRSRKGER* |
Ga0126310_113318841 | 3300010044 | Serpentine Soil | MLILAGGGNGVPLNYGELERWTRVGYERGRRSRKGER* |
Ga0126306_103214862 | 3300010166 | Serpentine Soil | GYELIGAGMLILAGGGRGLPMDYDELERWTRVGYERGMRSRKGER* |
Ga0126306_105479851 | 3300010166 | Serpentine Soil | MAGGHDGKPLDFGELERWTRVGYERGMRFRKGER* |
Ga0126306_113687201 | 3300010166 | Serpentine Soil | YELVGAGMLILAGDGRGLPFDYDELERWTRVGYERGMRSRKGER* |
Ga0126306_118137582 | 3300010166 | Serpentine Soil | MVILAGGGKGVPLDYGELERWTRVGFERGRRPRHGER* |
Ga0138505_1000003021 | 3300010999 | Soil | LIMASGHEGKPLDYEALERWTRVGFERGMRFRKGER* |
Ga0138505_1000381102 | 3300010999 | Soil | YELIGAGMLIAAGDGRGFPLDYDELERSTRVGYERGIRSRKGER* |
Ga0138514_1000864502 | 3300011003 | Soil | MFILAGGGRGLPLDYDELERWTQVGFERGMRSRKGER* |
Ga0126317_100220901 | 3300011332 | Soil | GMLIMASGHDGKPMDYEDLERWTRVGFERGTRFRKCER* |
Ga0150985_1148788976 | 3300012212 | Avena Fatua Rhizosphere | GYELIGAGMLTLAGGGRGTPLDYHQLERCTRVGYERGMWSRKGER* |
Ga0150984_1109996111 | 3300012469 | Avena Fatua Rhizosphere | LIMAGGYDGKPLNYTELERWTRVGYERGMRFRKGER* |
Ga0157320_10285082 | 3300012481 | Arabidopsis Rhizosphere | AAGMLIMAAGRDGTPLDFQALERWTRVGYERALKSGHGPQ* |
Ga0182008_101093543 | 3300014497 | Rhizosphere | MLIMAGGYDGKPLDYGELERWTRVGYERGMRSRKGER* |
Ga0182008_108439442 | 3300014497 | Rhizosphere | AAGMLIMAGGDDGKPLDFDALGRWSRVGFERGTRFRKGER* |
Ga0184608_100012655 | 3300018028 | Groundwater Sediment | VGYELIGAGMLILAGGSRGLPMDYDELERWTRVGFERGMRSRKGER |
Ga0184634_100323273 | 3300018031 | Groundwater Sediment | VGYELIGAGMLILAGGSRGLPMDYDELERWTRVGFERGMRSRKGGR |
Ga0184621_101071191 | 3300018054 | Groundwater Sediment | LVAAGMLIMAGSGNGKPLDYDELERWTRVGYERGMRSRKGER |
Ga0184632_103872431 | 3300018075 | Groundwater Sediment | LIAGMMILAGGGRGVPLDYGELERWTRVGYERGTRSRHGER |
Ga0184639_103109243 | 3300018082 | Groundwater Sediment | MILAGGGRGLPLDYDELERWTRVGFERGTRSRNGEGDVRCGIRACSI |
Ga0190268_104029322 | 3300018466 | Soil | GYELVAAGMLIMASGHEGKPLDYQALERWTRVGYERGMRFRKAER |
Ga0190267_100880142 | 3300019767 | Soil | MLIMAGGHDGNPLGFEALERWTRVGYERGLRSRKGER |
Ga0190267_113682352 | 3300019767 | Soil | GMLIMAGGHDGKPFDFGELERWTRVGYERGIRFRKGER |
Ga0193705_10073222 | 3300019869 | Soil | MLIMAAGHEGKPLDYDELERWTRVGYERGMKWRKGER |
Ga0193739_10031984 | 3300020003 | Soil | MLIAAGAGRGLPMANGELQRRTRVGYERGTRSGKGER |
Ga0222622_100654582 | 3300022756 | Groundwater Sediment | MLIMAGGGSGKPLDFEALERWTRVGYERGMRSRKGER |
Ga0247786_11164742 | 3300022883 | Soil | AGMLIMASGHDGKPLDFEALERWTRFGYERGMRSRKGVR |
Ga0207428_112386171 | 3300027907 | Populus Rhizosphere | GMLILAGGGNGTPLDHRELERWTRLGYERGMRFRKGER |
Ga0307276_100932302 | 3300028705 | Soil | VGYELVSAGMLILARDGRGLPFDYDELERWTRTGYERGMTSRKGER |
Ga0307303_100048241 | 3300028713 | Soil | VGYELIGAGMLILAGGGRGLPMDYDELERWTRVGFERGMRLRKGER |
Ga0307309_101896232 | 3300028714 | Soil | MFILAGGGRGLPMDYDELERWTRVGFERGMRLRKGER |
Ga0307307_103143961 | 3300028718 | Soil | TELVAAGMLIIAAGHDGKPLDYEALERWTRVGYERGMRSRKGER |
Ga0307315_100031901 | 3300028721 | Soil | MILAGGGRGLPLDYDELERWTRVGFERGTRSRNGEGDVRCGIRAC |
Ga0307318_102516192 | 3300028744 | Soil | MLILAGDGRSLPLDYGELERWSRVGYEWETAMHRGER |
Ga0307297_100298742 | 3300028754 | Soil | AAGMLILAGGGRGLPLDYDELERWTRVGFERGTRWRNGER |
Ga0307297_102320653 | 3300028754 | Soil | MLIMAGGHDGKPFDYDELERWTRVGFDRGTRFRKGER |
Ga0307282_102314622 | 3300028784 | Soil | ITAGMLIMASGGNGNPLDYDELERCTRIGYERGMRSRHGER |
Ga0307290_101926343 | 3300028791 | Soil | QITAGMLIMASGGNGNPLDYDELERCTRIGYERGMRSRHGER |
Ga0307287_100276451 | 3300028796 | Soil | SGMLIMAAGHEGKPLDYQALERWTRVGFERGMRFRKGER |
Ga0307287_100856311 | 3300028796 | Soil | AGYELIAAGMMILAGGGRGLPLDYDELERWTRVGYERGTRSRNGER |
Ga0307284_102244732 | 3300028799 | Soil | IMASGGNGNPLDYDELERCTRIGYERGMRSRHGER |
Ga0307292_100078201 | 3300028811 | Soil | ELLGAGMLILAGGGRGLPMDYDELERWTRVGFERGMRSRKGER |
Ga0307292_103932682 | 3300028811 | Soil | MLIMAGGHDGKPLDYDALERWTRVGYERGMRSRKGER |
Ga0307296_100374511 | 3300028819 | Soil | VGYELIGAGMLILAGGSRGLPMDYDELERWTRVGFERGMRSRK |
Ga0307296_102627421 | 3300028819 | Soil | MILAGGGRGLPLDYDELERWTRVGFERGTRSRNGEGDVRCGI |
Ga0307312_102523203 | 3300028828 | Soil | MLILAGNGRGLPFDYDELERWTRVGYERGMRSRKGE |
Ga0307289_102182461 | 3300028875 | Soil | GHELIAAGMLILAAGGLGRPLDYDELERWTRVGYERGMAFRHREG |
Ga0307277_105604221 | 3300028881 | Soil | LDHGAVRGGNGTPLDYDELERWTRVGYERGMRSRKGER |
Ga0247827_106011701 | 3300028889 | Soil | GMMILAGGGRGLPLDYEELERWTRVGFERGTRSRNGER |
Ga0268240_101886332 | 3300030496 | Soil | MLIMAGGRDGKPFDFNELERWTRVGYERGMRSRKGER |
Ga0268240_101980981 | 3300030496 | Soil | GHELIAAGMLIMAGGHDGKCFDFDELERWTRVGYERGTRSRKGER |
Ga0308202_10754291 | 3300030902 | Soil | GYELVAAGMLIMAGGHNGRPLGYAALERWTRVGYERGMRSRKGQR |
Ga0308153_1059032 | 3300030994 | Soil | VGYELIGAGMLILAGGSRGLPMDYDELERWTRVGFERGMRLRKGER |
Ga0308189_104795442 | 3300031058 | Soil | MLIMAGGHDGKPFDYEELERWTRVGFERGTRFRKGER |
Ga0308201_103612703 | 3300031091 | Soil | MILAGGGRGLPLDYDELERWTRVGFERGTRSRNGEGDV |
Ga0308201_103669512 | 3300031091 | Soil | AGYELVAAGMLIMAGGHNGRPLGYAALERWTRVGYERGMRSRKGQR |
Ga0308181_10332361 | 3300031099 | Soil | VGYELIGAGMLILAGGSRGLPMDYDELERWTREGFERGMRSRKGGR |
Ga0307406_100246607 | 3300031901 | Rhizosphere | MLILAGGGRGFPLDYDELERWTRVGYERRMRSRKGER |
Ga0307409_1000164602 | 3300031995 | Rhizosphere | MLILAGGGRGFPLDYDELERWTRVGYERAMRSRKGER |
Ga0307409_1002723972 | 3300031995 | Rhizosphere | MLIMAGGGNGKPLDYEELERWTRVGYERGTRSRQGEK |
Ga0307409_1004057403 | 3300031995 | Rhizosphere | ADSCRRGQGFLLDYDELERWTRVGYERGMRSRKGER |
Ga0307409_1004667143 | 3300031995 | Rhizosphere | HMGYELVAAGMMIMAGGHDSKPFDFEALERWTRVGYERGMRSRKGER |
Ga0307409_1022567491 | 3300031995 | Rhizosphere | GAGMLILAGGGRGFPLDYDELERWTRVGYERGMRSRKGER |
Ga0307415_1016943582 | 3300032126 | Rhizosphere | AGMLIMAGGHNGKPLDYDELERWTQVGFERGMRSRRGER |
Ga0307415_1020372342 | 3300032126 | Rhizosphere | TAGMLILAGGGNGTPLDYNELERWTRVGYERGMRSPNGER |
Ga0364924_152891_18_131 | 3300033811 | Sediment | MLILAGGGKGVPLDYRELERWTRVGYERGMRSRLGER |
⦗Top⦘ |