| Basic Information | |
|---|---|
| Family ID | F098244 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MLTSNDYKELAARCTELASESSEPTVAEALRALASDYLARAAKLHHQTAD |
| Number of Associated Samples | 71 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 76.47 % |
| % of genes near scaffold ends (potentially truncated) | 59.62 % |
| % of genes from short scaffolds (< 2000 bps) | 88.46 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.76 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (65.385 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (19.231 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.462 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.423 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.13% β-sheet: 0.00% Coil/Unstructured: 44.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.76 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| a.24.16.0: automated matches | d1wola_ | 1wol | 0.9185 |
| a.25.1.1: Ferritin | d3pwfa1 | 3pwf | 0.90565 |
| f.14.1.4: TRPM-like (melastatin-like transient receptor potential) channels | d6bcoa2 | 6bco | 0.90457 |
| a.25.1.1: Ferritin | d4iwka_ | 4iwk | 0.90384 |
| a.25.1.1: Ferritin | d1j30a_ | 1j30 | 0.89931 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF13460 | NAD_binding_10 | 1.92 |
| PF08281 | Sigma70_r4_2 | 1.92 |
| PF12833 | HTH_18 | 1.92 |
| PF04542 | Sigma70_r2 | 1.92 |
| PF13531 | SBP_bac_11 | 0.96 |
| PF00027 | cNMP_binding | 0.96 |
| PF01381 | HTH_3 | 0.96 |
| PF00196 | GerE | 0.96 |
| PF04392 | ABC_sub_bind | 0.96 |
| PF01068 | DNA_ligase_A_M | 0.96 |
| PF03404 | Mo-co_dimer | 0.96 |
| PF01370 | Epimerase | 0.96 |
| PF12625 | Arabinose_bd | 0.96 |
| PF05425 | CopD | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.92 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.92 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.92 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.92 |
| COG1276 | Putative copper export protein | Inorganic ion transport and metabolism [P] | 0.96 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.96 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.96 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 65.38 % |
| All Organisms | root | All Organisms | 34.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig886647 | Not Available | 565 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1013040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1337 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1021408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1216 | Open in IMG/M |
| 3300000789|JGI1027J11758_12764447 | Not Available | 826 | Open in IMG/M |
| 3300001431|F14TB_102574917 | Not Available | 662 | Open in IMG/M |
| 3300004081|Ga0063454_101176337 | Not Available | 632 | Open in IMG/M |
| 3300005332|Ga0066388_100027103 | All Organisms → cellular organisms → Bacteria | 5254 | Open in IMG/M |
| 3300005332|Ga0066388_100297867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2257 | Open in IMG/M |
| 3300005332|Ga0066388_101198789 | Not Available | 1297 | Open in IMG/M |
| 3300005332|Ga0066388_103584665 | Not Available | 792 | Open in IMG/M |
| 3300005332|Ga0066388_104404359 | Not Available | 717 | Open in IMG/M |
| 3300005332|Ga0066388_104442519 | Not Available | 714 | Open in IMG/M |
| 3300005332|Ga0066388_104489506 | Not Available | 711 | Open in IMG/M |
| 3300005332|Ga0066388_105871286 | Not Available | 620 | Open in IMG/M |
| 3300005363|Ga0008090_10047463 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005363|Ga0008090_15836722 | Not Available | 720 | Open in IMG/M |
| 3300005435|Ga0070714_100462872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1206 | Open in IMG/M |
| 3300005436|Ga0070713_100536403 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300005451|Ga0066681_10582742 | Not Available | 690 | Open in IMG/M |
| 3300005713|Ga0066905_100186080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1537 | Open in IMG/M |
| 3300005713|Ga0066905_100391166 | Not Available | 1124 | Open in IMG/M |
| 3300005713|Ga0066905_102325203 | Not Available | 501 | Open in IMG/M |
| 3300005764|Ga0066903_100699510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1786 | Open in IMG/M |
| 3300005764|Ga0066903_101393635 | Not Available | 1316 | Open in IMG/M |
| 3300005764|Ga0066903_102004856 | Not Available | 1112 | Open in IMG/M |
| 3300005764|Ga0066903_102354875 | Not Available | 1029 | Open in IMG/M |
| 3300005764|Ga0066903_103893148 | Not Available | 801 | Open in IMG/M |
| 3300005764|Ga0066903_104959379 | Not Available | 706 | Open in IMG/M |
| 3300005764|Ga0066903_106989444 | Not Available | 585 | Open in IMG/M |
| 3300005764|Ga0066903_108500347 | Not Available | 523 | Open in IMG/M |
| 3300005764|Ga0066903_108525419 | Not Available | 522 | Open in IMG/M |
| 3300005937|Ga0081455_10121463 | All Organisms → cellular organisms → Bacteria | 2058 | Open in IMG/M |
| 3300005981|Ga0081538_10012292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 6872 | Open in IMG/M |
| 3300006028|Ga0070717_11480409 | Not Available | 616 | Open in IMG/M |
| 3300006051|Ga0075364_10820645 | Not Available | 634 | Open in IMG/M |
| 3300006844|Ga0075428_100935661 | Not Available | 919 | Open in IMG/M |
| 3300009100|Ga0075418_10214760 | Not Available | 2048 | Open in IMG/M |
| 3300009100|Ga0075418_11312289 | Not Available | 785 | Open in IMG/M |
| 3300009100|Ga0075418_11808137 | Not Available | 665 | Open in IMG/M |
| 3300009137|Ga0066709_101991165 | Not Available | 805 | Open in IMG/M |
| 3300009792|Ga0126374_10801611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia | 720 | Open in IMG/M |
| 3300010043|Ga0126380_10141614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1524 | Open in IMG/M |
| 3300010043|Ga0126380_10166374 | Not Available | 1434 | Open in IMG/M |
| 3300010043|Ga0126380_10884514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 740 | Open in IMG/M |
| 3300010046|Ga0126384_11788069 | Not Available | 583 | Open in IMG/M |
| 3300010047|Ga0126382_12026381 | Not Available | 548 | Open in IMG/M |
| 3300010361|Ga0126378_11096602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 897 | Open in IMG/M |
| 3300010366|Ga0126379_12076856 | Not Available | 670 | Open in IMG/M |
| 3300010366|Ga0126379_12232199 | Not Available | 648 | Open in IMG/M |
| 3300010366|Ga0126379_13152892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300015371|Ga0132258_12070129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1431 | Open in IMG/M |
| 3300015372|Ga0132256_101045878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 931 | Open in IMG/M |
| 3300015373|Ga0132257_100133841 | All Organisms → cellular organisms → Bacteria | 2891 | Open in IMG/M |
| 3300016319|Ga0182033_11297025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 654 | Open in IMG/M |
| 3300016341|Ga0182035_11135017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300016357|Ga0182032_10818693 | Not Available | 788 | Open in IMG/M |
| 3300016387|Ga0182040_11205945 | Not Available | 637 | Open in IMG/M |
| 3300016422|Ga0182039_10078629 | Not Available | 2362 | Open in IMG/M |
| 3300016422|Ga0182039_10993283 | Not Available | 752 | Open in IMG/M |
| 3300016445|Ga0182038_10474636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1063 | Open in IMG/M |
| 3300019767|Ga0190267_11162162 | Not Available | 561 | Open in IMG/M |
| 3300021080|Ga0210382_10425135 | Not Available | 588 | Open in IMG/M |
| 3300021170|Ga0210400_11546791 | Not Available | 525 | Open in IMG/M |
| 3300021560|Ga0126371_11428734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 822 | Open in IMG/M |
| 3300021560|Ga0126371_11961321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 704 | Open in IMG/M |
| 3300021560|Ga0126371_12261401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300027663|Ga0208990_1112290 | Not Available | 747 | Open in IMG/M |
| 3300027909|Ga0209382_11048378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 846 | Open in IMG/M |
| 3300028787|Ga0307323_10329607 | Not Available | 547 | Open in IMG/M |
| 3300028793|Ga0307299_10311170 | Not Available | 591 | Open in IMG/M |
| 3300028819|Ga0307296_10157550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1228 | Open in IMG/M |
| 3300031545|Ga0318541_10009784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4269 | Open in IMG/M |
| 3300031573|Ga0310915_10513331 | Not Available | 851 | Open in IMG/M |
| 3300031679|Ga0318561_10633553 | Not Available | 588 | Open in IMG/M |
| 3300031682|Ga0318560_10532705 | Not Available | 636 | Open in IMG/M |
| 3300031719|Ga0306917_11006859 | Not Available | 650 | Open in IMG/M |
| 3300031724|Ga0318500_10392149 | Not Available | 689 | Open in IMG/M |
| 3300031744|Ga0306918_10596724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 865 | Open in IMG/M |
| 3300031763|Ga0318537_10073741 | Not Available | 1252 | Open in IMG/M |
| 3300031764|Ga0318535_10271155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 759 | Open in IMG/M |
| 3300031771|Ga0318546_10555766 | Not Available | 806 | Open in IMG/M |
| 3300031896|Ga0318551_10168395 | Not Available | 1202 | Open in IMG/M |
| 3300031910|Ga0306923_10385750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1595 | Open in IMG/M |
| 3300031910|Ga0306923_10410675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1539 | Open in IMG/M |
| 3300031910|Ga0306923_10942397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 942 | Open in IMG/M |
| 3300031941|Ga0310912_11440991 | Not Available | 519 | Open in IMG/M |
| 3300031945|Ga0310913_10011310 | Not Available | 5346 | Open in IMG/M |
| 3300031945|Ga0310913_10143749 | Not Available | 1644 | Open in IMG/M |
| 3300031947|Ga0310909_10906931 | Not Available | 723 | Open in IMG/M |
| 3300031954|Ga0306926_11593826 | Not Available | 749 | Open in IMG/M |
| 3300032001|Ga0306922_12215037 | Not Available | 529 | Open in IMG/M |
| 3300032041|Ga0318549_10072974 | Not Available | 1459 | Open in IMG/M |
| 3300032051|Ga0318532_10057593 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300032060|Ga0318505_10372984 | Not Available | 674 | Open in IMG/M |
| 3300032076|Ga0306924_10233718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2111 | Open in IMG/M |
| 3300032090|Ga0318518_10436135 | Not Available | 671 | Open in IMG/M |
| 3300032180|Ga0307471_101863403 | Not Available | 752 | Open in IMG/M |
| 3300032261|Ga0306920_102245766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300032261|Ga0306920_102673780 | Not Available | 682 | Open in IMG/M |
| 3300032261|Ga0306920_103196201 | Not Available | 613 | Open in IMG/M |
| 3300033289|Ga0310914_10448884 | Not Available | 1167 | Open in IMG/M |
| 3300033551|Ga0247830_10980160 | Not Available | 674 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 19.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.46% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.92% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.92% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.96% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.96% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.96% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_09992020 | 2124908045 | Soil | MLTWDDYRELAARCIELADESSEPSVAEALRALAADYLTRGDKLYSEAAE |
| AF_2010_repII_A01DRAFT_10130405 | 3300000580 | Forest Soil | MLTSNDYKELAARCAELASESSEPTMAEALRALASDYL |
| AF_2010_repII_A100DRAFT_10214084 | 3300000655 | Forest Soil | AMLTSNDYKELAARCTELASEFSEPAVAEALRALASDYLAHAVKLHHQTAD* |
| JGI1027J11758_127644472 | 3300000789 | Soil | MLTWDDYRELAARCIELADESSEPSVAAALRALAADYLARGAKLYS* |
| F14TB_1025749172 | 3300001431 | Soil | MLTSNDYKELAARCTELASESSEPTVAEALMALASDYLARAAKLHRQTAD* |
| Ga0063454_1011763371 | 3300004081 | Soil | MLIADDYRELAARCIELAGESSEPSVAEALRALAADYLARGGKLYREAAE* |
| Ga0066388_1000271031 | 3300005332 | Tropical Forest Soil | MLTSNDYKELAARCIELASESSEPTVAEALMTLASDYLARAAKLHRQTAN* |
| Ga0066388_1002978671 | 3300005332 | Tropical Forest Soil | DYKELAARCTELASESSEPTVAEALRALASDYLARAAKLHHQTAD* |
| Ga0066388_1011987892 | 3300005332 | Tropical Forest Soil | MLTSNDYKELAARCTELASECSEPTVAEPLRALALDYLARAAKLHYQTAD* |
| Ga0066388_1035846651 | 3300005332 | Tropical Forest Soil | MLTSNDYKELAARCTELASESSEPTVAEALRALASDYLTRAAKLHHQTAD* |
| Ga0066388_1044043592 | 3300005332 | Tropical Forest Soil | MLTSNDYKELAARCTELASEFPEPTVAEALMALASDYLARAAKLHH* |
| Ga0066388_1044425191 | 3300005332 | Tropical Forest Soil | MLTSNDYKELAARCAELASESSEPTMAEALRALASDYLARAAKLRFE |
| Ga0066388_1044895061 | 3300005332 | Tropical Forest Soil | MLSSNDYKELAAQCTELASELSEPTMAEALRVLASDYLARAAKLHHQTAD* |
| Ga0066388_1058712861 | 3300005332 | Tropical Forest Soil | MLTSNDYKELAARCTELASESPEPTVAEALMALASDYLARAAKLHHQRAD* |
| Ga0008090_100474631 | 3300005363 | Tropical Rainforest Soil | MLPQPWSQRAMLTSNDYKELAARCTELASESSEPTVAEALRALASDYLARAAKLH |
| Ga0008090_158367223 | 3300005363 | Tropical Rainforest Soil | MLTSNDYKELAARCAELASESSEPTVAEALRALASDYLARAAKL |
| Ga0070714_1004628721 | 3300005435 | Agricultural Soil | MLTSNDYKELAARCTELASEFSEPAVAEALSALASDYLARAAKLHDQKAN* |
| Ga0070713_1005364032 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTWDDYRELAARCIELADESSEPSVAEALRALAADYLARGGKLYSEAAE* |
| Ga0066681_105827421 | 3300005451 | Soil | MLIADDYRQLAARCIELAGESSEPSVAEALRALAADYLARGGKLYREAE* |
| Ga0066905_1001860802 | 3300005713 | Tropical Forest Soil | MLTSNDYKELAVRCTELASESPEPTVAEALMALASDYLARAAKLHHQRAD* |
| Ga0066905_1003911662 | 3300005713 | Tropical Forest Soil | MLTSNDYKDLAARCTELASESPEPTVAQALMALASDYLARAAKLHHQTAD* |
| Ga0066905_1023252031 | 3300005713 | Tropical Forest Soil | MLTSEDYKQLAERCVELASECSAPTVAEALRALAVD |
| Ga0066903_1006995103 | 3300005764 | Tropical Forest Soil | MLTSNDYKELAARCTELASESPEPTVAEALRALASDYLARAAKLHYQTAD* |
| Ga0066903_1013936351 | 3300005764 | Tropical Forest Soil | MLTSNDYKELAARCTELASESSEPTVAEALRALASDYLARAAKLGGL* |
| Ga0066903_1020048561 | 3300005764 | Tropical Forest Soil | MLTLDDYEELATRCTELASESSEPTVAEALRALASDYLARAAKLHRQTAN* |
| Ga0066903_1023548752 | 3300005764 | Tropical Forest Soil | MLTSNDYKELAARCSELATESSEPTVTEALRALASDYLVRAAQLRHQTTD* |
| Ga0066903_1038931481 | 3300005764 | Tropical Forest Soil | MLTSNDYKELAARCTELASESSEPTVAEALRALAS |
| Ga0066903_1049593791 | 3300005764 | Tropical Forest Soil | MLTSNDYKELAARCTELASESSEPTVVEALRALASDYL |
| Ga0066903_1069894441 | 3300005764 | Tropical Forest Soil | MLTSNDYKELAARCAELASESAEPTVAEALRALASD |
| Ga0066903_1085003471 | 3300005764 | Tropical Forest Soil | MLTSNDYKELAARCTELASESPEPTVAEALIALASDYLARAAKLHHQRAD* |
| Ga0066903_1085254191 | 3300005764 | Tropical Forest Soil | MLTSNDYKELAAQCTELASESSEPTVAEALRALASDYLARAAKLHHQTAD* |
| Ga0081455_101214631 | 3300005937 | Tabebuia Heterophylla Rhizosphere | LLTSDDYKELAARCIELASESSERTVAEALKALASDYLARAVKLRSRTAE* |
| Ga0081538_100122928 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MLTSDDYNQLADRCVELANECSEPAVVEALRALALDYLARAAKLHGQTADSRPQMQTT* |
| Ga0070717_114804092 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSAEDYRELSARCIELADESSEPSVAEALRALAADYLARGGKLYSEAAE* |
| Ga0075364_108206452 | 3300006051 | Populus Endosphere | MLTSNDYKELAARCTELASESSEPTVAEALMALASDYLARAAKLHHQIAN* |
| Ga0075428_1009356612 | 3300006844 | Populus Rhizosphere | MLTSNDYRELAARCTELASESSEPTVAEALMALASDYLARAAKLHHQTA* |
| Ga0075418_102147606 | 3300009100 | Populus Rhizosphere | MTRQASAMLTSEDYKQLGERCAELASECSAPTVAEALRALAVDYLSRAA |
| Ga0075418_113122892 | 3300009100 | Populus Rhizosphere | MLSSNDYRELAARCTELASESSEPTVAEALMALASDYLARPAKLHRQTA |
| Ga0075418_118081371 | 3300009100 | Populus Rhizosphere | MLTSNDYRELAARCTELASESSEPTVAEALMALASDYLARPAKLHRQTA |
| Ga0066709_1019911652 | 3300009137 | Grasslands Soil | MLTADDYSELAARCIELAGECSEPSVAEALSALAADYLARGGKLYREAAE* |
| Ga0126374_108016111 | 3300009792 | Tropical Forest Soil | DYEELAARCTELASESSEPTVAEALRALASDYLARAAKLHFARHEHCRR* |
| Ga0126380_101416143 | 3300010043 | Tropical Forest Soil | MLTSNDYKELAARCTELASEFSEPAVAEALRALASDYLAHAVKLHHQTAD* |
| Ga0126380_101663742 | 3300010043 | Tropical Forest Soil | MLTSNDYKELAAQCSELASEALIALASDYLSRAGKLHHQTAD* |
| Ga0126380_108845141 | 3300010043 | Tropical Forest Soil | SNDYKELAVRCTELASESPEPTVAEALMALASDYLARAAKLHHQRAD* |
| Ga0126384_117880692 | 3300010046 | Tropical Forest Soil | MLTSNDYKELAAQCGELASEALIALASDYLSRAGKLHHQTAD* |
| Ga0126382_104917501 | 3300010047 | Tropical Forest Soil | MLTSNDYKELEARCTELASESSEPTVAEALRALASDYLARAAKLHFVFLEPR |
| Ga0126382_120263812 | 3300010047 | Tropical Forest Soil | MLTSNDYKELAIRCTELASESSEPTVAEALRALASDYLARAAKLH |
| Ga0126378_110966023 | 3300010361 | Tropical Forest Soil | MLTSNDYNELAARCTELASEFSEPAVAEALRALASDYLALAAKLHHQTAE* |
| Ga0126379_120768561 | 3300010366 | Tropical Forest Soil | MLTSNDYKELAARCAELASESSEPTMAEALRALASDYLARAAKL |
| Ga0126379_122321991 | 3300010366 | Tropical Forest Soil | MLTSNDYKELAARCTELASEFSEPAVAEALRALASDYLAHAVKLH |
| Ga0126379_131528921 | 3300010366 | Tropical Forest Soil | NDYKELAARCTELASEFSEPAVAEALRALASDYLAHAVKLHNQTAD* |
| Ga0132258_120701292 | 3300015371 | Arabidopsis Rhizosphere | MLTSNDYKELAARCSELAGESSAPTVTEALRALASDYLVRAAQLRHQTKD* |
| Ga0132256_1010458781 | 3300015372 | Arabidopsis Rhizosphere | QRAMLSSNDYRELAARCTELASESSELTVAEALRALASDYLARAAKLHRQTAD* |
| Ga0132257_1001338417 | 3300015373 | Arabidopsis Rhizosphere | MLSSNDYRELAARCTELASESSEPTVAEALMALASDYLARAAKLHRQTAD* |
| Ga0182033_112970251 | 3300016319 | Soil | DYKELAARCTELASESSEPTVAEALRALASDYLARAAKLHHQTAD |
| Ga0182035_111350171 | 3300016341 | Soil | QRAMLTSNDYKELAARCTELASESSEPTVAEALRALASDYLARAAKLHHQTAD |
| Ga0182032_108186931 | 3300016357 | Soil | MLTSNDFTELAARCTGLASEASEPTVAEALRALASDYLARAAK |
| Ga0182040_112059451 | 3300016387 | Soil | MLPQPRSQRIMLTSNDYKELAARCTELASESSEPTVAEALRALASDYLARAA |
| Ga0182039_100786294 | 3300016422 | Soil | MLTSNDYKELAAQCAELASESSEPTVAEALRALASDYLARA |
| Ga0182039_109932831 | 3300016422 | Soil | MLTLNDYKELAARCTELASESSEPTVAEALRALASDYLARA |
| Ga0182038_104746362 | 3300016445 | Soil | MLTSNDYKELAARCTELASEFSEPAVAEALRALASDYLAHAVKLHHQTAD |
| Ga0190267_111621622 | 3300019767 | Soil | MLISEDYKQLAERCLKLAGESSDPVVAAALRALATDY |
| Ga0210382_104251351 | 3300021080 | Groundwater Sediment | MVQDEMLISEDYKQLAERCMRLARECSDPDGAEALRALALDYL |
| Ga0210400_115467911 | 3300021170 | Soil | MLTSNDYKELAARCAELASEFSEPTVAEALRALASDYLARAAKLHF |
| Ga0126371_114287341 | 3300021560 | Tropical Forest Soil | KELAARCTELASEFSEPAVAEALRALASDYLAHAVKLHNQTAD |
| Ga0126371_119613211 | 3300021560 | Tropical Forest Soil | NDYKELAARCTELASESSEPTVAEALRALASDYLARAAKLHHQTAD |
| Ga0126371_122614012 | 3300021560 | Tropical Forest Soil | MLTSNDYKELAARCTELASESSEPTVAEALRALASDYLARAAKLH |
| Ga0208990_11122901 | 3300027663 | Forest Soil | MLVSEDYKQLAERCMKLVSECSDPTVAEALRALASDYLARA |
| Ga0209382_110483782 | 3300027909 | Populus Rhizosphere | MLTSNDYRELAARCTELASESSEPTVAEALMALASDYLARAAKLHHQTA |
| Ga0307323_103296071 | 3300028787 | Soil | MVQDEMLISEDYKQLAERCMRLASECSDPDGAEALRAL |
| Ga0307299_103111701 | 3300028793 | Soil | MLTSNDYKELAARCTELASEFSEPAVAEALSALASDYLARAAKLHHQTAD |
| Ga0307296_101575502 | 3300028819 | Soil | MLTSNDYKELAARCTELASEFSEPAVAEALSALASDYLALAAKLHHQTAD |
| Ga0318541_100097848 | 3300031545 | Soil | MLTSNDYKELAARCTELASESSEPTVAEAPRALASDYLARAAKLHHQTAD |
| Ga0310915_105133311 | 3300031573 | Soil | MLTSNDYKELAARCTELASESSEPTVAEALRALASDY |
| Ga0318561_106335532 | 3300031679 | Soil | MLTSNDYKELAARCTELASESSEPTVAEALRALASDYLARAGKLHFVNQGTRLQ |
| Ga0318560_105327051 | 3300031682 | Soil | TSNDYKELAARCTELASESSEPTVAEAPRALASDYLARAAKLHHQTAD |
| Ga0306917_110068591 | 3300031719 | Soil | QRAMLTSNDYKELAARCTELASESSEPTVAEAPRALASDYLARAAKLHHQTAD |
| Ga0318500_103921491 | 3300031724 | Soil | MLTSNDYKELAARCTELASESSEPTVAEALRALASDYL |
| Ga0306918_105967243 | 3300031744 | Soil | MLPQPWSQRAMLTSNDYKELAARCTELASESSEPTVAEALRALASDYLARAAKLHHQTA |
| Ga0318537_100737413 | 3300031763 | Soil | MLTSNDYKELAARCTELASESSEPTVAEALRALASDYLARAGKL |
| Ga0318535_102711553 | 3300031764 | Soil | MLTSNDYKELAARCTELASESCEPTVAEALRALASDYL |
| Ga0318546_105557661 | 3300031771 | Soil | MLTSNDHKELAARCTELASESSEPTVAEALRALASDYLARAAKRHFVFLETKARG |
| Ga0318551_101683951 | 3300031896 | Soil | MLTSNDYKELAARCTELASESSEPTVAEALRALASDYLARAGK |
| Ga0306923_103857502 | 3300031910 | Soil | ELAARCTELASESSEPTVAEALRALASDYLARAAKLHFVFLE |
| Ga0306923_104106753 | 3300031910 | Soil | MLPQPWSQRAMLTSNDYKELAARCTELASESSEPTVAEALRALASDYLARAAKLHHQTAD |
| Ga0306923_109423973 | 3300031910 | Soil | MLTSNDYKELAARCTELASESSEPTVAEALRALASDYLARAGKLHF |
| Ga0310912_114409911 | 3300031941 | Soil | MLTSNDYKELAARCTELASESPEPTVAEALRALASDYL |
| Ga0310913_1001131014 | 3300031945 | Soil | MLTSNDHKELAARCTELASESSEPTVAEALRALASDYLARAAKLHFVF |
| Ga0310913_101437492 | 3300031945 | Soil | MLSSNDYKELAARCTELASESSEPTVAEALRALASDYLARAAKLHFVFLE |
| Ga0310909_109069313 | 3300031947 | Soil | MLTSNDYKELAARCTELAGESSEPTVAEALRALASDYPARAAK |
| Ga0306926_115938261 | 3300031954 | Soil | MLTLNDYKELAARCTELASESSEPTVAEALRALASDYLARAA |
| Ga0318530_104680891 | 3300031959 | Soil | MLTSNDYKELAARCTELAGESSEPTVAEALRALASDYLARAA |
| Ga0306922_122150371 | 3300032001 | Soil | MLTSNDYTELAARCTELASESSEPTVAEALRALASDY |
| Ga0318549_100729741 | 3300032041 | Soil | MLTSNDYKELAARCTELASESSEPTVAEALRALASDYLARAGKLH |
| Ga0318532_100575931 | 3300032051 | Soil | MLTSNDYKELAARCTELASESSEPTVAEALRALASDYLARDGKLHF |
| Ga0318505_103729842 | 3300032060 | Soil | PWSLRAMLSSNDYKELAARCTELASESSEPTVAEALRALASDYLARAAKLHFVFLE |
| Ga0306924_102337181 | 3300032076 | Soil | MLTSNDYKELAARCTELASESSEPTVAEALRALASDYLARAAKLHF |
| Ga0318518_104361351 | 3300032090 | Soil | LTSNDYKELAARCTELASESSEPTVAEAPRALASDYLARAAKLHHQTAD |
| Ga0307471_1018634032 | 3300032180 | Hardwood Forest Soil | MTWSQRAMLSSNDYRELAARCTELASESSEPTVAEALMALASDYLARAAKLHRQTAD |
| Ga0306920_1022457663 | 3300032261 | Soil | MLTSNDYKELAARCTELASESSEPTVAEALRALASDYLARAAKLHHQTAD |
| Ga0306920_1026737801 | 3300032261 | Soil | MLTSNDHKELAARCTELASESSEPTVAEALRALASDYLARAAKLHFV |
| Ga0306920_1031962013 | 3300032261 | Soil | MLTSNDYAELAARCTELASESSEPTVAEALRALASDYLAR |
| Ga0310914_104488841 | 3300033289 | Soil | MLTLNDYKELAARCTELASESSEPTVAEALRALASDYLARAAKLHF |
| Ga0247830_109801602 | 3300033551 | Soil | MLTSNDYKELAAQCTELASEFSEPAVAEALSALASDYLARAANLHHQTAD |
| ⦗Top⦘ |