 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F098217 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MIKKIINFIKNMFKCERQDPHLEMYEELRPDKADKIRKKYKGDSE |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 42.31 % |
| % of genes from short scaffolds (< 2000 bps) | 89.42 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (83.654 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (30.769 % of family members) |
| Environment Ontology (ENVO) | Unclassified (82.692 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (94.231 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 75.56% β-sheet: 0.00% Coil/Unstructured: 24.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 83.65 % |
| All Organisms | root | All Organisms | 15.38 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 0.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 30.77% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 21.15% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.62% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.77% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 4.81% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.81% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.81% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 3.85% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.88% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.88% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.92% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.92% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.96% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.96% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.96% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.96% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000149 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
| 3300007956 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300024267 | Seawater microbial communities from Monterey Bay, California, United States - 28D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300028397 | Seawater microbial communities from Monterey Bay, California, United States - 50D | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100801514 | 3300000101 | Marine | MIKKIIIFIKNMFKCERQDPHIEMYEGLRSNKTEKIRRKYKGDSE* |
| DelMOSum2010_101433052 | 3300000101 | Marine | MIKKIIIFIKNMFKCERQDPHIEMYEEVRTDKQEKIRKKYKGDSE* |
| DelMOSum2011_100411692 | 3300000115 | Marine | MIKKIINFIKNMFKCERQDPHLEMYEELRPDKADKIRKKYKEVSE* |
| DelMOSpr2010_101634042 | 3300000116 | Marine | KIIIFIKNMFKCERQDPHIEMYEEVRTDKQEKIRKKYKGDSE* |
| DelMOWin2010_101511451 | 3300000117 | Marine | IIIFIKNMFKCERQDPHIEMYEEVRTDKQEKIRRKYKGDSE* |
| LPaug09P1610mDRAFT_10030802 | 3300000149 | Marine | MIKKIITFIKNMFKCEKQDPHIEMYEGLRSDKAEKIRKKYKGDSE* |
| JGI24006J15134_100785012 | 3300001450 | Marine | MIKKFINFIKNMFKCERQDPHLEMYEELRPDKADKIRKKHQGDSK* |
| JGI24003J15210_100305454 | 3300001460 | Marine | MIKKFINFIKNMFKCERQDPHLEMYEEIRPDKTEKIRKKYKGNSE* |
| JGI24003J15210_100551943 | 3300001460 | Marine | MIKKFINFIKNMFKCERQDPHLEMYEEIRSDKADKIRRKHGGDSK* |
| JGI24003J15210_101020932 | 3300001460 | Marine | MIKKFINFIKNMFKCQRQDPHLEMYEETRTDKKDKILRKYGESK* |
| JGI24003J15210_101605962 | 3300001460 | Marine | MIKKIITFIKNMFTCERQDPHLEMYEDVRLDKKEKIKRKYKDSSE* |
| JGI24004J15324_100165091 | 3300001472 | Marine | INFIKNMFKCERQDPHLEMYEELRPDKADKIRKKYKEVSE* |
| JGI24004J15324_100919391 | 3300001472 | Marine | NFIKNMFKCERQDPHLQMYEELRPDKADKIRRKHGGDSK* |
| JGI24004J15324_101100662 | 3300001472 | Marine | FIKNMFKCERQDPHLEMYEELRPDKADKIRKKYKEVSE* |
| Ga0055584_1012218961 | 3300004097 | Pelagic Marine | MIKKIITFIKNMFKCERQDPHIEMYEGLRSDKAEKIRKKYKGDSE* |
| Ga0073579_10123493 | 3300005239 | Marine | MIKKIIIFIKNMFKCERQDPHLEMYEEVRTDKQEKIRKKYKGDSE* |
| Ga0075466_11118882 | 3300006029 | Aqueous | IIFIKNMFKCERQDPHIEMYEEVRTDKQEKIRRKYKGDSE* |
| Ga0098037_12349442 | 3300006737 | Marine | MIKKIINFIKNMFTCERQDPHLEMYENVRLDKKEKIKRKYKDISE* |
| Ga0098042_10271362 | 3300006749 | Marine | MIKKIITFIKNMFRCERQDPHLEMYEEVRPDKAEKIRRKYGGDSK* |
| Ga0070754_102535312 | 3300006810 | Aqueous | SMIKKIIIFIKNMFKCERQDPHIEMYEEVRTDKQEKIRRKYKGDSE* |
| Ga0070746_105396292 | 3300006919 | Aqueous | MIKKFINFIKNMFKCERQDPHLEMYEEVRSDKADKIRRKHGGDSK* |
| Ga0070748_13683082 | 3300006920 | Aqueous | IFIKNMFKCERQDPHIEMYEEVRTDKQEKIRRKYKGDSE* |
| Ga0098045_10743602 | 3300006922 | Marine | MIKKFINFIKNMFKCERQDPHLEMYEELRPDKAKKINKKYSGDSE* |
| Ga0075468_101003802 | 3300007229 | Aqueous | MIKKIIIFIKNMFKCERQDPHIEMYEEVRTDKQEKIRRKYKGDSE* |
| Ga0105744_10523303 | 3300007863 | Estuary Water | MIKKIITFIKNMFTCERQDPHLEMYEDVRLNKKEKIKRKYKDSSE* |
| Ga0105741_10337452 | 3300007956 | Estuary Water | MIKKIINFIKNMFKCERQDPHLEMYEEIRPDKTEKIRKKYKGNSE* |
| Ga0105748_100500164 | 3300007992 | Estuary Water | MIKKIINFIKNMFKCERQDPHLEMYEELRPDKADKIRKKYKGDSE* |
| Ga0105748_103101801 | 3300007992 | Estuary Water | MIKKIINFIKNMFKCERQDPHLEMYEETRTDKKDKIRRKYGESK* |
| Ga0114904_10637521 | 3300008218 | Deep Ocean | MIKKIINFIKNMFKRERQDPHLEMYESLRSDKANKISKKYKEVSK* |
| Ga0102816_11060672 | 3300008999 | Estuarine | MIKKFINFIKNMFKCERQDPHLQMYEELRPDKADKIRRKHGGDSK* |
| Ga0102816_12437172 | 3300008999 | Estuarine | INFIKNMFKCERQDPHLEMYEETRTDKKDKIRRKYGESK* |
| Ga0102854_12141952 | 3300009058 | Estuarine | MIKKFINFIKNMFKCERQDPHLEMYEETRTDKKDKIRRKYGESK* |
| Ga0115564_101908401 | 3300009505 | Pelagic Marine | NYISMIKKIIIFIKNMFKCERQDPHIEMYEEVRTDKQEKIRRKYKGDSE* |
| Ga0098059_12169062 | 3300010153 | Marine | INWIKNIFRPERQDPHLEMYEEARPDKVEKIRKKYGGSD* |
| Ga0181369_10177164 | 3300017708 | Marine | MIKKFINFIKNMFKCERQDPHLEMYEELRPDKAKKINKKYSGDSE |
| Ga0181403_10383692 | 3300017710 | Seawater | MIKKIINFIKNMFKCERQDPHLDMYEETRTDKKDKIRRK |
| Ga0181404_11202471 | 3300017717 | Seawater | KIITFIKNMFTCERQDPHLEMYEDVRLDKKEKIKRKYKDSSE |
| Ga0181383_11876762 | 3300017720 | Seawater | MIKKIITFIKNMFRCERQDPHLEMYEDVRLNKKEKIKRKYKDSSE |
| Ga0181373_10722032 | 3300017721 | Marine | IKNMFRCERQDPHLEMYEEVRPDKAEKIRRKYGGDSK |
| Ga0181388_11663642 | 3300017724 | Seawater | MIKKIITFIKNMFKCERQDPHIEMYEGLRSDKAEKIRKKYKGDYE |
| Ga0181398_10568952 | 3300017725 | Seawater | MIKKIINFIKNMFTCERQDPHLEMYEEVRPDKAEKIRRKYGGDSK |
| Ga0181401_10827282 | 3300017727 | Seawater | INFIKNMFTCERQDPHLEMYEEVRPDKAEKIRRKYGGDSK |
| Ga0181401_11188482 | 3300017727 | Seawater | IGMIKKIITFIKNMFTCERQDPHLEMYEDVRLDKKEKIKRKYKDSSE |
| Ga0181419_10807331 | 3300017728 | Seawater | MIKKIINFIKSMFKCERQDPHLEMYEEVRTDKVEKIRRKYGGDSK |
| Ga0181416_10865452 | 3300017731 | Seawater | MIKKIITFIKNMFTCERQDTHLEMYEDVRLDKKEQIKRKYTDSSE |
| Ga0181431_11013952 | 3300017735 | Seawater | MIKKIINFIKNMFTCERQDPHLEMYDNVRLDKKEKIK |
| Ga0187218_10991042 | 3300017737 | Seawater | NFIKNMFKCERQDPHLEMYEEIRSDKADKIRRKHGGDSK |
| Ga0181428_10603201 | 3300017738 | Seawater | WLFNRTHNNIGMIKKIINFIKNMFTCERQDPHLEMYEDVRLDKKEKIKRKYKDSSE |
| Ga0181418_10724122 | 3300017740 | Seawater | MIKKIINFIKSMFKCERQDPHLEMYEELRSDKKDKIRRKYGESK |
| Ga0181418_10885172 | 3300017740 | Seawater | MIKKFINFIKNMFKCERQDPHLEMYEETRTDKKDKIRRK |
| Ga0181399_11514561 | 3300017742 | Seawater | THNYISMIKKIIKFIKNMFKCERQDPHIEMYEGLRSDKAEKIRKKYKGDSE |
| Ga0181397_10820411 | 3300017744 | Seawater | NISMIKKIINFIKNMFKCERQDPHLEMYEEARPDKVEKIRRKYGGDSK |
| Ga0181397_11150831 | 3300017744 | Seawater | KNMFTCERQDPHLEMYEDVRLDKKEKIKRKYKDSSE |
| Ga0181389_11183912 | 3300017746 | Seawater | IKNMFTCERQDPHLEMYEDVRLDKKEKIKRKYKDSSE |
| Ga0181392_10935531 | 3300017749 | Seawater | NRTHNNISMIKKIINFIKNMFTCERQDPHLEMYENVRLDKKEKIKRKYKDISE |
| Ga0181410_11604152 | 3300017763 | Seawater | MIKKIIKFIKNMFKCERQDPHLEMYEGLRSDKAEKIRKKYKGDSE |
| Ga0181413_10134132 | 3300017765 | Seawater | MIKKIINFIKNMFTCERQDPHLEMYELRSNKAEKRRRKHKRDSK |
| Ga0187221_11132441 | 3300017769 | Seawater | FIKNMFKCERQDPHIEIYEGLRSDKAEKIRKKYKGDSE |
| Ga0181425_11489931 | 3300017771 | Seawater | INFIKNMFKCERQDPHLEMYEETRTDKKDKIRRKYGESK |
| Ga0181425_11521652 | 3300017771 | Seawater | MIKKFINFIKNMFKCQRQDPHLEMYEETRTDKKDKIRRKYGESK |
| Ga0181430_11410782 | 3300017772 | Seawater | MIKKIINFIKNMFTCERQDPHLEMYEDVRLDKKEKIKRKYKDSSE |
| Ga0181430_11785622 | 3300017772 | Seawater | MIKKIIKFIKNMFKCERQDPHLEMYEEVRTDKQEKIRKKYKKVSE |
| Ga0181423_11514321 | 3300017781 | Seawater | KKNFIKNMFTCERQDPHLEMYEDVRLDKKEKIKRKYKDSSE |
| Ga0181423_12364711 | 3300017781 | Seawater | MIKKIITFIKNMFTCERQDPHLEMYEDVRLDKKEKIKRKYKDS |
| Ga0181424_101253183 | 3300017786 | Seawater | MIKKFINFIKNMFKCERQDPHLEMYEETRTDKKDKIRRKYG |
| Ga0181424_101833823 | 3300017786 | Seawater | KNMFKCERQDPHLEMYEETRTDKKDKIRRKYGESK |
| Ga0181424_104018252 | 3300017786 | Seawater | MIKKIINFNKNMFKCERQDPHLEMYEEVRTDKQEKIRKKYKKVSE |
| Ga0211576_100677122 | 3300020438 | Marine | MIKKFINFIKNMFKCQRQDPHLEMYEETRTDKKDKILRKYGESK |
| Ga0211576_102404652 | 3300020438 | Marine | MIKKIINFIKSMFKCERQDPHLEMYEETRTDKKDKIRRKYGESK |
| Ga0211576_103413502 | 3300020438 | Marine | MIKKIINFIKNMFTCERQDPHLEMYENVRLDKKEKIKRKYKDISE |
| Ga0211576_106655021 | 3300020438 | Marine | FIKNMFTCERQDPHLEMYEDVRLDKKEKIKRKYKDSSE |
| Ga0211577_101054603 | 3300020469 | Marine | MIKKIINFIKNMFKCERQDPHLEMYEETRTDKKDKIRRKYGESK |
| Ga0211577_102829802 | 3300020469 | Marine | MIKKFINFIKNMFKCERQDPHLEMYEEIRSDKADKIRRKHGGDSK |
| Ga0213869_100444394 | 3300021375 | Seawater | MIKKIIIFIKNMFKCERQDPHIEMYEEVRTDKQEKIRKKYKGDSE |
| Ga0222717_100861704 | 3300021957 | Estuarine Water | MIKKFINFIKNMFKCERQDPHLEMYEETRTDKKDKIRRKYGESK |
| Ga0222717_103855802 | 3300021957 | Estuarine Water | MIKKIITFIKNMFTCERQDPHLEMYEDVRLDKKEKIKRKYKDSSE |
| Ga0222718_104745462 | 3300021958 | Estuarine Water | MIKKIINFIKNMFKCERQDPHLEMYEETRTDKKDKILRKYGESK |
| Ga0222716_101455374 | 3300021959 | Estuarine Water | ITMIKKFINFIKNMFKCERQDPHLEMYEETRTDKKDKIRRKYGESK |
| Ga0222716_103850321 | 3300021959 | Estuarine Water | MIKKIINFIKNMFKCERQDPHLEMYEEARPDKVEKIRRKYGGDSK |
| Ga0212028_10596562 | 3300022071 | Aqueous | MIKKIINFIKNMFKCEKQDPHLEMYEELRPDKAEKIR |
| Ga0224906_10687251 | 3300022074 | Seawater | IITFIKNMFKCERQDPHIEMYEGLRSDKAEKIRKKYKGDSE |
| Ga0212022_10654661 | 3300022164 | Aqueous | MIKKFINFIKNMFKCERQDPHLEMYEEVRSDKADKIRRKHGGDSK |
| Ga0228623_10120051 | 3300024267 | Seawater | NNISMIKKIINFIKSMFKCERQDPHLEMYEETRTDKKDKIRRKYGESK |
| Ga0244775_102045663 | 3300024346 | Estuarine | MIKKFINFIKNMFKCQRQDPHLEMYEEIRSDKADKIRRKHGGDSK |
| Ga0207905_10034643 | 3300025048 | Marine | MIKKIINFIKNMFKCERQDPHLEMYEELRPDKADKIRKKYKEVSE |
| Ga0208667_10019409 | 3300025070 | Marine | MIKKIITFIKNMFRCERQDPHLEMYEEVRPDKAEKIRRKYGGDSK |
| Ga0207896_10230612 | 3300025071 | Marine | MIKKFINFIKNMFKCERQDPHLEMYEELRPDKADKIRKKHQGDSK |
| Ga0207890_10248322 | 3300025079 | Marine | MIKKFINFIKNMFKCERQDPHLQMYEELRPDKADKIRRKHGGDSK |
| Ga0209535_10364922 | 3300025120 | Marine | MIKKIITFIKNMFKCEKQDPHIEMYEGLRSDKAEKIRKKYKGDSE |
| Ga0209535_10987303 | 3300025120 | Marine | MIKKFINFIKNMFKCERQDPHLEMYEEIRPDKTEKIRKKYKGNSE |
| Ga0209336_100429113 | 3300025137 | Marine | MIKKIINFIKNMFKCERQDPHLEMYEELRPDKADKIRK |
| Ga0209336_101263531 | 3300025137 | Marine | NFIKNMFKCERQDPHLEMYEELRPDKADKIRKKYKEVSE |
| Ga0208643_11830422 | 3300025645 | Aqueous | IFIKNMFKCERQDPHIEMYEEVRTDKQEKIRRKYKGDSE |
| Ga0208134_11043952 | 3300025652 | Aqueous | SMIKKIIIFIKNMFKCERQDPHIEMYEEVRTDKQEKIRRKYKGDSE |
| Ga0208899_11388091 | 3300025759 | Aqueous | MIKKIIIFIKNMFKCERQDPHIEMYEEVRTDKQEKIRRKYKGDSE |
| Ga0209193_11241361 | 3300025816 | Pelagic Marine | MIKKIITFIKNMFKCERQDPHIEMYEGLRSDKAEKIRKKYKGDSE |
| Ga0209425_104210651 | 3300025897 | Pelagic Marine | MIKKIIIFIKNMFKCERQDPHIEMYEEVRTDKQEK |
| (restricted) Ga0233414_101112103 | 3300028045 | Seawater | MIKKIINFIKNMFKCERQDPHLEMYEELRPDKADKIRKKYKGDSE |
| Ga0228639_11347772 | 3300028397 | Seawater | MIKKIINFIKNMFTCERQDPHLEMYENVRLDKKEKIKRKYKDSSE |
| Ga0315331_100135182 | 3300031774 | Seawater | MIKKFINFIKNMFKCERQDPHLKMYEEVRTDKQEKIRRKYGESE |
| Ga0315316_102082753 | 3300032011 | Seawater | MIKKIINFIKNMFKCERQDPHLKMYEEVRTDKQEKIRRKYGESE |
| Ga0315315_108273112 | 3300032073 | Seawater | MIKKIINFIKNMFNCVRQDPHLEMYEETRTDKKDKIRRKYGESK |
| Ga0315321_100509191 | 3300032088 | Seawater | IKSMFKCERQDPHLEMYEETRTDKKDKIRRKYGESK |
| Ga0315321_102305833 | 3300032088 | Seawater | MIKKFINFIKNMFKCERQDPHLEMYEETRTDKKDKIR |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |