| Basic Information | |
|---|---|
| Family ID | F098186 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MVDLSAQKPVRVLSAGEIEQKLASHQLYLKTEYHEGHRADF |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.88 % |
| % of genes near scaffold ends (potentially truncated) | 93.27 % |
| % of genes from short scaffolds (< 2000 bps) | 97.12 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.885 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (44.231 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.808 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.115 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF02798 | GST_N | 6.73 |
| PF13561 | adh_short_C2 | 6.73 |
| PF00106 | adh_short | 3.85 |
| PF00107 | ADH_zinc_N | 2.88 |
| PF00149 | Metallophos | 1.92 |
| PF00805 | Pentapeptide | 1.92 |
| PF07758 | DUF1614 | 1.92 |
| PF09723 | Zn-ribbon_8 | 1.92 |
| PF10282 | Lactonase | 1.92 |
| PF13193 | AMP-binding_C | 0.96 |
| PF03928 | HbpS-like | 0.96 |
| PF00884 | Sulfatase | 0.96 |
| PF07690 | MFS_1 | 0.96 |
| PF08386 | Abhydrolase_4 | 0.96 |
| PF00753 | Lactamase_B | 0.96 |
| PF05199 | GMC_oxred_C | 0.96 |
| PF13701 | DDE_Tnp_1_4 | 0.96 |
| PF00596 | Aldolase_II | 0.96 |
| PF01118 | Semialdhyde_dh | 0.96 |
| PF13610 | DDE_Tnp_IS240 | 0.96 |
| PF14076 | DUF4258 | 0.96 |
| PF01925 | TauE | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 1.92 |
| COG4089 | Uncharacterized membrane protein | Function unknown [S] | 1.92 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.96 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.88 % |
| Unclassified | root | N/A | 22.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001545|JGI12630J15595_10047212 | Not Available | 865 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10391588 | Not Available | 564 | Open in IMG/M |
| 3300005179|Ga0066684_11052178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300005437|Ga0070710_10294868 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300005439|Ga0070711_101331839 | Not Available | 623 | Open in IMG/M |
| 3300009012|Ga0066710_100714495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1529 | Open in IMG/M |
| 3300009137|Ga0066709_103152509 | Not Available | 602 | Open in IMG/M |
| 3300009143|Ga0099792_10194027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1150 | Open in IMG/M |
| 3300009792|Ga0126374_11881265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300010048|Ga0126373_10912721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 943 | Open in IMG/M |
| 3300010048|Ga0126373_13049176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300010343|Ga0074044_11031153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300010360|Ga0126372_11587967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 693 | Open in IMG/M |
| 3300010362|Ga0126377_13563468 | Not Available | 503 | Open in IMG/M |
| 3300010366|Ga0126379_12665481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300010376|Ga0126381_100518284 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
| 3300010376|Ga0126381_100710252 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300010376|Ga0126381_100736721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1412 | Open in IMG/M |
| 3300010376|Ga0126381_100762596 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1387 | Open in IMG/M |
| 3300010376|Ga0126381_100796620 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300010376|Ga0126381_101725413 | Not Available | 904 | Open in IMG/M |
| 3300010376|Ga0126381_102053893 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 823 | Open in IMG/M |
| 3300010376|Ga0126381_102085646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 816 | Open in IMG/M |
| 3300010376|Ga0126381_103009420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300010398|Ga0126383_11454871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 775 | Open in IMG/M |
| 3300010398|Ga0126383_12631003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrolobii | 586 | Open in IMG/M |
| 3300011120|Ga0150983_10253149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300011270|Ga0137391_10328732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1315 | Open in IMG/M |
| 3300012206|Ga0137380_11345075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300012357|Ga0137384_10939522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300012683|Ga0137398_10471021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 861 | Open in IMG/M |
| 3300012971|Ga0126369_10321350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1558 | Open in IMG/M |
| 3300012971|Ga0126369_11030473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 911 | Open in IMG/M |
| 3300015357|Ga0134072_10313438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300016270|Ga0182036_10086907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2087 | Open in IMG/M |
| 3300016270|Ga0182036_10854332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300016294|Ga0182041_11245106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 680 | Open in IMG/M |
| 3300016294|Ga0182041_11413515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300016445|Ga0182038_11448458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
| 3300017822|Ga0187802_10039884 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300020581|Ga0210399_11250495 | Not Available | 587 | Open in IMG/M |
| 3300021178|Ga0210408_10910450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 684 | Open in IMG/M |
| 3300021479|Ga0210410_11505214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300021560|Ga0126371_11079237 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 943 | Open in IMG/M |
| 3300025916|Ga0207663_10573736 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300025928|Ga0207700_11084758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300027635|Ga0209625_1075103 | Not Available | 756 | Open in IMG/M |
| 3300027651|Ga0209217_1074976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 989 | Open in IMG/M |
| 3300028047|Ga0209526_10376688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 946 | Open in IMG/M |
| 3300028906|Ga0308309_11458532 | Not Available | 585 | Open in IMG/M |
| 3300031231|Ga0170824_110434027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300031543|Ga0318516_10135389 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300031545|Ga0318541_10840041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300031546|Ga0318538_10484572 | Not Available | 670 | Open in IMG/M |
| 3300031546|Ga0318538_10506519 | Not Available | 654 | Open in IMG/M |
| 3300031564|Ga0318573_10102398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1471 | Open in IMG/M |
| 3300031679|Ga0318561_10036880 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2393 | Open in IMG/M |
| 3300031679|Ga0318561_10298188 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300031680|Ga0318574_10416620 | Not Available | 785 | Open in IMG/M |
| 3300031719|Ga0306917_10248958 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300031719|Ga0306917_11456140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300031724|Ga0318500_10560365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300031744|Ga0306918_10169349 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300031748|Ga0318492_10542432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300031768|Ga0318509_10117318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1448 | Open in IMG/M |
| 3300031770|Ga0318521_10148597 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300031777|Ga0318543_10325082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 688 | Open in IMG/M |
| 3300031777|Ga0318543_10378399 | Not Available | 634 | Open in IMG/M |
| 3300031793|Ga0318548_10155376 | Not Available | 1116 | Open in IMG/M |
| 3300031793|Ga0318548_10368998 | Not Available | 704 | Open in IMG/M |
| 3300031796|Ga0318576_10545833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300031797|Ga0318550_10442278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300031845|Ga0318511_10247347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 800 | Open in IMG/M |
| 3300031879|Ga0306919_10018240 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4178 | Open in IMG/M |
| 3300031879|Ga0306919_10630597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 826 | Open in IMG/M |
| 3300031893|Ga0318536_10598769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300031894|Ga0318522_10237493 | Not Available | 691 | Open in IMG/M |
| 3300031896|Ga0318551_10231327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1029 | Open in IMG/M |
| 3300031897|Ga0318520_10067917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1926 | Open in IMG/M |
| 3300031897|Ga0318520_11076323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300031910|Ga0306923_10379352 | Not Available | 1611 | Open in IMG/M |
| 3300031912|Ga0306921_12662712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300031942|Ga0310916_11587419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300031945|Ga0310913_11194619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300031946|Ga0310910_11004430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300031946|Ga0310910_11421358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300031947|Ga0310909_10384508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1179 | Open in IMG/M |
| 3300031947|Ga0310909_10712062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → unclassified Aestuariivirga → Aestuariivirga sp. YIM B02566 | 833 | Open in IMG/M |
| 3300031947|Ga0310909_10761125 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300032035|Ga0310911_10399509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 795 | Open in IMG/M |
| 3300032052|Ga0318506_10321570 | Not Available | 686 | Open in IMG/M |
| 3300032059|Ga0318533_11252349 | Not Available | 542 | Open in IMG/M |
| 3300032060|Ga0318505_10483865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300032063|Ga0318504_10584070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300032066|Ga0318514_10291886 | Not Available | 861 | Open in IMG/M |
| 3300032076|Ga0306924_10498979 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300032091|Ga0318577_10096674 | Not Available | 1379 | Open in IMG/M |
| 3300032091|Ga0318577_10576041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300032094|Ga0318540_10329271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → unclassified Aestuariivirga → Aestuariivirga sp. YIM B02566 | 737 | Open in IMG/M |
| 3300032180|Ga0307471_101757789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 773 | Open in IMG/M |
| 3300032261|Ga0306920_101019275 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300033289|Ga0310914_10540959 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300033289|Ga0310914_11646642 | Not Available | 545 | Open in IMG/M |
| 3300033290|Ga0318519_11078732 | Not Available | 501 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 44.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 19.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12630J15595_100472121 | 3300001545 | Forest Soil | MADLSARKPVRVLSPDEIDRTLAEHGLYLETESRQGHRTHL* |
| JGIcombinedJ51221_103915882 | 3300003505 | Forest Soil | MADLSARTPLRVLSPDEIERALVEHRLYLETEYHEGHRANF |
| Ga0066684_110521781 | 3300005179 | Soil | MADFSARTPVRVLSPDEIEQMLASHRLYLETEYHEGHRANF |
| Ga0070710_102948682 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MAALLARAPVRVLSPDEIEQMLAGHRLYLETEYHQGHRAN |
| Ga0070711_1013318391 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MADLTARTPVRVLSPDEIERMLAEHRLYLETEYHQGHRANFSS |
| Ga0066710_1007144951 | 3300009012 | Grasslands Soil | MADFSARPPVRVRSPDEIEQMYSAHRLYLETEWRQGHRANFASAD |
| Ga0066709_1031525091 | 3300009137 | Grasslands Soil | MADLTARTPVRVLSPDEIERMLVEHRLYLETEYHQGHRANLSSADLTGRDF |
| Ga0099792_101940272 | 3300009143 | Vadose Zone Soil | MADLSARTPVRVPSPDEIERMLAEHRLYLETEYHQGHRALGR* |
| Ga0126374_118812651 | 3300009792 | Tropical Forest Soil | MADLSARGPVRVLSADEIEQMLASHRLYLRTEYHEGHRANFSSAD |
| Ga0126373_109127211 | 3300010048 | Tropical Forest Soil | MAALAERTPVRVLSRDEIEQMLASHRLYLETEYHEGHRAN |
| Ga0126373_130491761 | 3300010048 | Tropical Forest Soil | MADLSAKRPTRVLSADEFEEMLASHRLYLKTEYHEGHRADFSSADLTG |
| Ga0074044_110311531 | 3300010343 | Bog Forest Soil | MADFSAQRPVRVLSADEINQMLASHQLYLKTEYHEGHRA |
| Ga0126372_115879672 | 3300010360 | Tropical Forest Soil | MADFAGPRPIRVLSSEEIAQMLASHRLYRETEYHEGANAGN* |
| Ga0126377_135634681 | 3300010362 | Tropical Forest Soil | MAEFSARAPIRVLSPDKIEQLLVSHQLYLETEYHEGH |
| Ga0126379_126654811 | 3300010366 | Tropical Forest Soil | MADLSARAPIRVLSPDKIEQLLVSHQLYLETEYHEGHRANFSPADLIRR |
| Ga0126381_1005182843 | 3300010376 | Tropical Forest Soil | MTDLSSGRSVRVLSLDEIEQMLALHRLYLDTEYREGHRANFASVDLTG* |
| Ga0126381_1007102522 | 3300010376 | Tropical Forest Soil | MADFSAQPPVRVLSPDQIEQMLAEHQLYLETEYHQGHRANF |
| Ga0126381_1007367214 | 3300010376 | Tropical Forest Soil | MADLSVRKPLRVLSLDEIEQMLALHRRYLDTEYHEGHRANFASVDLTGR |
| Ga0126381_1007625964 | 3300010376 | Tropical Forest Soil | MADFSARPPVRVLSADEIEQLLASHRLYLETEYHEGHRA |
| Ga0126381_1007966201 | 3300010376 | Tropical Forest Soil | MADLAERKPIRMLSRDEMEQMLALHRLYLETEYHEGHRAN |
| Ga0126381_1017254132 | 3300010376 | Tropical Forest Soil | MADFEGREPIRVLSLEEIAQTLASHRHYRETEYHEGHRA |
| Ga0126381_1020538931 | 3300010376 | Tropical Forest Soil | MADLSARAPIRVLSPDQIQQILASHQLYLETEYHEGHRANF |
| Ga0126381_1020856461 | 3300010376 | Tropical Forest Soil | MADFAGRKAIRVLSAEKIAQMLASHRLYRETEYHEGHRANFSSVDLTGR |
| Ga0126381_1030094201 | 3300010376 | Tropical Forest Soil | MADFAGLRPIRVLTAEEIAQMLAWHRLYRETEYHEGHRADFSSVDL |
| Ga0126383_114548712 | 3300010398 | Tropical Forest Soil | MADLADRKPVRVLSHDEIEQMLASHRVYLETEYHQGHRANFAS |
| Ga0126383_126310032 | 3300010398 | Tropical Forest Soil | ADLSVRLPLRVLSPDEIEQMLASHRRYLDTEYHEGHRANFASVDLTG* |
| Ga0150983_102531491 | 3300011120 | Forest Soil | MADFSTRPPVRVLSPDEIERMLAEHRLYLETEYHQGHRANFASADLSG |
| Ga0137391_103287321 | 3300011270 | Vadose Zone Soil | MADLTDRTPGRVLSPNEIERMLAEHQLYLDTEYHQGHRANFS |
| Ga0137380_113450752 | 3300012206 | Vadose Zone Soil | MVDISARTPVRVLSPGEIERLLAEHRLYLETEYQEGHRANFASA |
| Ga0137384_109395221 | 3300012357 | Vadose Zone Soil | MVDLSARTPVRVLSFGEIERLLAEHRLYLETEYHQ |
| Ga0137398_104710213 | 3300012683 | Vadose Zone Soil | MADLSDRTPVRVLSPDEIERPLAEHRLYLETEYHEGHRANFASA |
| Ga0126369_103213501 | 3300012971 | Tropical Forest Soil | MADFAERKPVRVLSRDEIEQMLASHRLYLETEYHEGHRANFASAD |
| Ga0126369_110304733 | 3300012971 | Tropical Forest Soil | MADLAERKPIRMLSRDEMEQMLALHRLYLETEYHEGHRANFASADLSGRDF |
| Ga0134072_103134381 | 3300015357 | Grasslands Soil | MADFSVRTPVRALSPDEIERMLAEHRLYLETEYHQGHRAN |
| Ga0182036_100869073 | 3300016270 | Soil | MADLSAQKLIRVLSGDEIEQMLASHRLYLKTEYHEGHRADFSSADLTGL |
| Ga0182036_108543322 | 3300016270 | Soil | MVDLSAQKPVRVLSAGKIEQKLASHQLYLKTEYHEGHRADFSSA |
| Ga0182041_112451061 | 3300016294 | Soil | MADLSARGPLRVLSADEIEQMLASHRLYLKTEYHEGHRADFS |
| Ga0182041_114135151 | 3300016294 | Soil | MVDLSAQKPVRVLSAGEIEQKLASHQLYLKTEYHEGHRAD |
| Ga0182038_114484582 | 3300016445 | Soil | MTDLSAQRPVRELPPDEIEQMLALHRLYLETEYHEGHRANFSSTDLTG |
| Ga0187802_100398841 | 3300017822 | Freshwater Sediment | MAELSDRKPVRVLSTAEIERTLALHQLYLNTEYHDGQRAN |
| Ga0210399_112504951 | 3300020581 | Soil | MVDLSAQKPVRVLSAGEIEQKLASHQLYLKTEYHEGHR |
| Ga0210408_109104501 | 3300021178 | Soil | MADLSARTPVRVLSPVEIERMLAEHRLYLETEYHQGHRANFSSA |
| Ga0210410_115052141 | 3300021479 | Soil | SARTPLRVLLSDEIERMLAEHRLYLETEYHQGQRANFSSADLT |
| Ga0126371_110792371 | 3300021560 | Tropical Forest Soil | MADFAARTPLRMLSPDEIERMLAEHRLYLETEYHGGH |
| Ga0207663_105737362 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MADLSARTPVRALSPVEIERMLAEHRLYLEMEYHQGHRANF |
| Ga0207700_110847581 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MADFSARASLPVLSPDDIERMLAEHRLYLETEYHEGQARISHQPI |
| Ga0209625_10751032 | 3300027635 | Forest Soil | MADLSARPPLRVLSPGEIERMLAEHRLYLETEYHEGHRANFSSADLA |
| Ga0209217_10749761 | 3300027651 | Forest Soil | MADLAARAPVRLLSPDEIERLLAEHRLYLETEYHEG |
| Ga0209526_103766881 | 3300028047 | Forest Soil | MADLSARTPVRALSADEIERMLAEHQLYLETEYHQGHR |
| Ga0308309_114585322 | 3300028906 | Soil | MADLSARTPLRVLSPDEIERALVEHRLYLETEYHEGHRANFSSADLSGR |
| Ga0170824_1104340271 | 3300031231 | Forest Soil | MADLLARTPLRMLSPDEIERMLAEHRLYLETEYHQGHRANFSSA |
| Ga0318516_101353891 | 3300031543 | Soil | MADLSAQKLIRVLSGDEIEQMLASHQLYLKTEYHE |
| Ga0318541_108400411 | 3300031545 | Soil | MVDLSTQKPVRVLSAGEIEQKLASHQLYLKTEYHEGHRADCSSA |
| Ga0318538_104845721 | 3300031546 | Soil | MVDLSTQKPVRVLSAGEIEQKLASHQLYLKTEYHECHRADFS |
| Ga0318538_105065191 | 3300031546 | Soil | MVDLSTQKPVRVLSAGEIEEKLASHQLYLKTEYHEG |
| Ga0318573_101023983 | 3300031564 | Soil | MADLSAQRPIRVLSGDEIDQTLASHQLYLKTEYRDGH |
| Ga0318561_100368801 | 3300031679 | Soil | MVDLSAQKPVRVLSAGEIKQKLASHQLYLKTEYHEGHRADFS |
| Ga0318561_102981881 | 3300031679 | Soil | MADLSAQKLIRVLSGDEIEQMLASHQLYLKTEYHEGHRADFS |
| Ga0318574_104166202 | 3300031680 | Soil | MVDLSAQKVLSAGEIEQKLASHQLYVKTEYHEGHR |
| Ga0306917_102489581 | 3300031719 | Soil | MADLSAQKLIRVLSGDEIEQMLASHQLYLKTEYHEGHRAD |
| Ga0306917_114561401 | 3300031719 | Soil | MADLSAQKPVRVPSAGEIEQKLAWHQLYLKTEYHEGHRADFSSVDLT |
| Ga0318500_105603651 | 3300031724 | Soil | MADLSAQKLIRVLSGDEIEQMLASHQLYLKTEYHEGHRADFSWADLTGLD |
| Ga0306918_101693493 | 3300031744 | Soil | MVDLSTQKPVRVLSAGEIEQKLASHQLYLKTEYHEGLRA |
| Ga0318492_105424321 | 3300031748 | Soil | MVDLSAQKPVRVLSAGEIKQKLASHQLYLKTEYHEGHRADFSSADLTRFD |
| Ga0318509_101173183 | 3300031768 | Soil | MADLSAQRPVHVLSAHEINQMLASHQLYLKTEYHEG |
| Ga0318521_101485971 | 3300031770 | Soil | MVDLSAQKPVRVLSAGEIEQKLASHQVYLKKEYHEGHR |
| Ga0318543_103250822 | 3300031777 | Soil | MVDLSAQKPVRVLSAGEIEQKLASHQLYLKTEYHEGHRADF |
| Ga0318543_103783992 | 3300031777 | Soil | MVDLSAQKVLSAGEIEQKLASHQLYVKTEYHEGHRADCSS |
| Ga0318548_101553762 | 3300031793 | Soil | MADLSAQRVIRVLSADEIEQILASHRLYLKTEYHDGHRAD |
| Ga0318548_103689981 | 3300031793 | Soil | MVDLSAQKPVRVLSAGEIEQKLASHQVYLKKEYHEGHRAD |
| Ga0318576_105458331 | 3300031796 | Soil | MVDLSAEKPVRVLSAGEIEQKLASHQLYLKTEYHEGHRAD |
| Ga0318550_104422781 | 3300031797 | Soil | MVDLSTQKPVRVLSAGEIEQKLASHQLYLKTEYHEGHRADCS |
| Ga0318511_102473472 | 3300031845 | Soil | MVDLSTQKPVRVLSAGEIEQKLASHQLYLKTEYHEGHRADFSSADLT |
| Ga0306919_100182404 | 3300031879 | Soil | MANLSTKRPVRVLFPDEIEQMLALHRLYLETEYHEGHRANFS |
| Ga0306919_106305971 | 3300031879 | Soil | MVDLSTQKPVRVLSAGEIEQKLASHQLYLKTEYHEGHRADFSSADLAGFD |
| Ga0318536_105987691 | 3300031893 | Soil | MVDLSTQKPVRVLSAGEIEQKLASHQLYLKTEYHEGHRADFSSADLTGF |
| Ga0318522_102374931 | 3300031894 | Soil | MVDLSTQKPVRVLSAGEIEQKLASHQLYLKTEYHEGH |
| Ga0318551_102313271 | 3300031896 | Soil | MADLSAQRPVRVLSAYEINQMLASHQLYLKTEYHEGHRADFSSADLTG |
| Ga0318520_100679173 | 3300031897 | Soil | MADLSAQNPVRVPSAGEIEQKLAWHQLYLKTEYHEGH |
| Ga0318520_110763231 | 3300031897 | Soil | MVDLSAQKPVRVLSAGKIEQKLASHQLYLKTEYHEGHRADFSSADLTRF |
| Ga0306923_103793521 | 3300031910 | Soil | MADLAERTPVRVLSRDEIEQMLASHRLYRETEYHEGHRADFSSVDLTG |
| Ga0306921_126627121 | 3300031912 | Soil | MGDLSAQKPVRVPSVDEIEQKLASHRLYLKTEYHDG |
| Ga0310916_115874191 | 3300031942 | Soil | MVDLSTQKPVRVLSAGEIEQKLASHQLYLKTEYHEGHRADCSSADLTRFD |
| Ga0310913_111946192 | 3300031945 | Soil | MVDLSAQKPVRVLSAGEIEQKLASHQVYLKKEYHEGHRADFSSADLTRF |
| Ga0310910_110044302 | 3300031946 | Soil | MADLSAQKPIRVLSGDEIEQMLASHRLYLKTEYHEGHRADFS |
| Ga0310910_114213581 | 3300031946 | Soil | MVDLSTQKPVRVLSAGEIEQKLASHQLYLKTEYHEGHRADFSSA |
| Ga0310909_103845081 | 3300031947 | Soil | MVDLSAQKVLSAGEIEQKLASHQLYVKTEYHEGHRADCS |
| Ga0310909_107120621 | 3300031947 | Soil | MADLSAQRPVHVLSAHEINQMLASHQLYLKTEYHEGHRADFSSA |
| Ga0310909_107611251 | 3300031947 | Soil | MPDFSARTPVRVLSLDLIEQMLAEHQLYLKTEYHQGHRANFASA |
| Ga0310911_103995091 | 3300032035 | Soil | MVDLSAQKPVRVLSAGKIEQKLASHQLYLKTEYHEGHRADFSS |
| Ga0318506_103215701 | 3300032052 | Soil | MADLSAQKPVRVPSAGEIEQKLAWHQLYLTTEYHE |
| Ga0318533_112523492 | 3300032059 | Soil | MVDLSAQTPVRVLSAGEIEQKLASHQLYLKTEYHEGPR |
| Ga0318505_104838651 | 3300032060 | Soil | MADLSAQKLIRVLSGDEIEQMLASHQLYLKTEYHEGHRADFSW |
| Ga0318504_105840701 | 3300032063 | Soil | MVDLSTQKPVRVLSAGEIEQKLASHQLYLKTEYHEGHRADFSSADLTG |
| Ga0318514_102918861 | 3300032066 | Soil | MVDLSAQKPVRVLSAGEIEQKLASHQLYLKTEYHEGHRA |
| Ga0306924_104989791 | 3300032076 | Soil | MVDLSAQKPVRVLSAGEIEQKLASHQVYLKKEYHEGHRADF |
| Ga0318577_100966741 | 3300032091 | Soil | MVDLSAQKVLSAGEIEQKLASHQLYVKTEYHEGHRADCSSADLTRFD |
| Ga0318577_105760412 | 3300032091 | Soil | MANFSAETPVRVLSPDEIDKMLADHSLHLEMEYHT |
| Ga0318540_103292711 | 3300032094 | Soil | MADLSAQRPVHVLSAHEINQMLASHQLYLKTEYHEGH |
| Ga0307471_1017577893 | 3300032180 | Hardwood Forest Soil | MADFSARPPVRVLSDDEIERMLADHRLYLEIVPQGLV |
| Ga0306920_1010192751 | 3300032261 | Soil | MVDLSAQKPVRVLSAGEIKQKLASHQLYLKTEYHEGHRAD |
| Ga0310914_105409591 | 3300033289 | Soil | MVDLSAQKPVRVLSAGEIKQKLASHQLYLKTEYHEGH |
| Ga0310914_116466421 | 3300033289 | Soil | MVDLSAQKPVRVLSAGEIEQKLASHQVYLKKEYHEGQ |
| Ga0318519_110787322 | 3300033290 | Soil | MADLTERNPVRVLSRDEIEQMLFLHRLYLETEYRE |
| ⦗Top⦘ |