| Basic Information | |
|---|---|
| Family ID | F098153 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 52 residues |
| Representative Sequence | MTLPEGLEFLKFGWWVVHAIAFLLVYQFGYVRGRGDLKRETRQRELEASRT |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 90.38 % |
| % of genes near scaffold ends (potentially truncated) | 26.92 % |
| % of genes from short scaffolds (< 2000 bps) | 82.69 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.385 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (15.385 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.038 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.346 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.16% β-sheet: 0.00% Coil/Unstructured: 46.84% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00293 | NUDIX | 48.08 |
| PF00106 | adh_short | 15.38 |
| PF13505 | OMP_b-brl | 6.73 |
| PF13561 | adh_short_C2 | 4.81 |
| PF00535 | Glycos_transf_2 | 1.92 |
| PF01058 | Oxidored_q6 | 1.92 |
| PF01883 | FeS_assembly_P | 1.92 |
| PF12483 | GIDE | 0.96 |
| PF00756 | Esterase | 0.96 |
| PF00149 | Metallophos | 0.96 |
| PF13420 | Acetyltransf_4 | 0.96 |
| PF01408 | GFO_IDH_MocA | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 1.92 |
| COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 1.92 |
| COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 1.92 |
| COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 1.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.38 % |
| Unclassified | root | N/A | 9.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001843|RCM34_1010237 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 2168 | Open in IMG/M |
| 3300004058|Ga0055498_10075481 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300004156|Ga0062589_101801292 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300004479|Ga0062595_102530428 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005166|Ga0066674_10193661 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300005330|Ga0070690_101199907 | Not Available | 605 | Open in IMG/M |
| 3300005330|Ga0070690_101205322 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005332|Ga0066388_100855003 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300005340|Ga0070689_100000867 | All Organisms → cellular organisms → Bacteria | 18815 | Open in IMG/M |
| 3300005365|Ga0070688_100165855 | All Organisms → cellular organisms → Bacteria | 1520 | Open in IMG/M |
| 3300005438|Ga0070701_11332538 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005440|Ga0070705_100891197 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300005518|Ga0070699_101877849 | Not Available | 548 | Open in IMG/M |
| 3300005526|Ga0073909_10003849 | All Organisms → cellular organisms → Bacteria | 4422 | Open in IMG/M |
| 3300005563|Ga0068855_102188450 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005587|Ga0066654_10732167 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005617|Ga0068859_101230769 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300005713|Ga0066905_100004080 | All Organisms → cellular organisms → Bacteria | 5913 | Open in IMG/M |
| 3300005713|Ga0066905_101577932 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005719|Ga0068861_100206262 | All Organisms → cellular organisms → Bacteria | 1653 | Open in IMG/M |
| 3300005764|Ga0066903_100068516 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4514 | Open in IMG/M |
| 3300005764|Ga0066903_103409917 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300005764|Ga0066903_107066189 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005841|Ga0068863_100229020 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
| 3300006163|Ga0070715_10058171 | All Organisms → cellular organisms → Bacteria | 1687 | Open in IMG/M |
| 3300006173|Ga0070716_101472232 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300006804|Ga0079221_11776676 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300006846|Ga0075430_100976692 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300006846|Ga0075430_101191865 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300006853|Ga0075420_100413543 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300006903|Ga0075426_10155772 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
| 3300006904|Ga0075424_100344028 | All Organisms → cellular organisms → Bacteria | 1589 | Open in IMG/M |
| 3300006914|Ga0075436_100545582 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300007076|Ga0075435_101845233 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300009094|Ga0111539_10020766 | All Organisms → cellular organisms → Bacteria | 8083 | Open in IMG/M |
| 3300009094|Ga0111539_10110459 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 3226 | Open in IMG/M |
| 3300009147|Ga0114129_10613481 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1408 | Open in IMG/M |
| 3300009147|Ga0114129_11040081 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1029 | Open in IMG/M |
| 3300009156|Ga0111538_10070284 | All Organisms → cellular organisms → Bacteria | 4457 | Open in IMG/M |
| 3300009156|Ga0111538_12666174 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 626 | Open in IMG/M |
| 3300009177|Ga0105248_10663977 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1176 | Open in IMG/M |
| 3300009553|Ga0105249_13000708 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 542 | Open in IMG/M |
| 3300010357|Ga0116249_10992662 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 759 | Open in IMG/M |
| 3300010357|Ga0116249_11070595 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 727 | Open in IMG/M |
| 3300010358|Ga0126370_11461725 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 648 | Open in IMG/M |
| 3300010360|Ga0126372_12376580 | Not Available | 580 | Open in IMG/M |
| 3300010361|Ga0126378_10074524 | All Organisms → cellular organisms → Bacteria | 3265 | Open in IMG/M |
| 3300010362|Ga0126377_11261449 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 810 | Open in IMG/M |
| 3300010366|Ga0126379_10023821 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 4652 | Open in IMG/M |
| 3300010397|Ga0134124_10268289 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 1578 | Open in IMG/M |
| 3300011444|Ga0137463_1005900 | All Organisms → cellular organisms → Bacteria | 4081 | Open in IMG/M |
| 3300012201|Ga0137365_10724807 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 727 | Open in IMG/M |
| 3300012971|Ga0126369_10101438 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 2606 | Open in IMG/M |
| 3300012971|Ga0126369_11535759 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 755 | Open in IMG/M |
| 3300012971|Ga0126369_12258271 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 631 | Open in IMG/M |
| 3300015360|Ga0163144_10000457 | All Organisms → cellular organisms → Bacteria | 94962 | Open in IMG/M |
| 3300015372|Ga0132256_100881722 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1011 | Open in IMG/M |
| 3300016341|Ga0182035_11634679 | Not Available | 581 | Open in IMG/M |
| 3300016357|Ga0182032_10212772 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1479 | Open in IMG/M |
| 3300018064|Ga0187773_10633187 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 658 | Open in IMG/M |
| 3300018083|Ga0184628_10332430 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 798 | Open in IMG/M |
| 3300018433|Ga0066667_11144835 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 675 | Open in IMG/M |
| 3300019362|Ga0173479_10068519 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1223 | Open in IMG/M |
| 3300024254|Ga0247661_1004945 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2104 | Open in IMG/M |
| 3300024254|Ga0247661_1058354 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 711 | Open in IMG/M |
| 3300024284|Ga0247671_1011851 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1322 | Open in IMG/M |
| 3300024298|Ga0255178_1090219 | Not Available | 568 | Open in IMG/M |
| 3300025324|Ga0209640_10766931 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 763 | Open in IMG/M |
| 3300025885|Ga0207653_10249826 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 679 | Open in IMG/M |
| 3300025885|Ga0207653_10330233 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 594 | Open in IMG/M |
| 3300025905|Ga0207685_10242558 | Not Available | 868 | Open in IMG/M |
| 3300025910|Ga0207684_10962149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 716 | Open in IMG/M |
| 3300025936|Ga0207670_10000074 | All Organisms → cellular organisms → Bacteria | 70517 | Open in IMG/M |
| 3300025936|Ga0207670_11747431 | Not Available | 529 | Open in IMG/M |
| 3300025939|Ga0207665_10416768 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 1025 | Open in IMG/M |
| 3300025941|Ga0207711_10943503 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 801 | Open in IMG/M |
| 3300025942|Ga0207689_11055351 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 685 | Open in IMG/M |
| 3300027821|Ga0209811_10000765 | All Organisms → cellular organisms → Bacteria | 12068 | Open in IMG/M |
| 3300027874|Ga0209465_10056181 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1891 | Open in IMG/M |
| 3300027874|Ga0209465_10345956 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 745 | Open in IMG/M |
| 3300027880|Ga0209481_10199305 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1000 | Open in IMG/M |
| 3300027907|Ga0207428_10495189 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 888 | Open in IMG/M |
| 3300027909|Ga0209382_11145869 | Not Available | 799 | Open in IMG/M |
| 3300028381|Ga0268264_10032574 | All Organisms → cellular organisms → Bacteria | 4276 | Open in IMG/M |
| 3300028596|Ga0247821_10143638 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300028812|Ga0247825_11076773 | Not Available | 585 | Open in IMG/M |
| 3300031544|Ga0318534_10162758 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1289 | Open in IMG/M |
| 3300031562|Ga0310886_10705650 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 628 | Open in IMG/M |
| 3300031640|Ga0318555_10808727 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 506 | Open in IMG/M |
| 3300031680|Ga0318574_10210745 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1118 | Open in IMG/M |
| 3300031719|Ga0306917_11506656 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 517 | Open in IMG/M |
| 3300031793|Ga0318548_10288143 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 807 | Open in IMG/M |
| 3300031797|Ga0318550_10636809 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 512 | Open in IMG/M |
| 3300031799|Ga0318565_10213542 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300031854|Ga0310904_11275882 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 531 | Open in IMG/M |
| 3300031908|Ga0310900_11470169 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 574 | Open in IMG/M |
| 3300032065|Ga0318513_10658599 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 513 | Open in IMG/M |
| 3300032075|Ga0310890_10589893 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 858 | Open in IMG/M |
| 3300032144|Ga0315910_10101959 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
| 3300032174|Ga0307470_10190989 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300032211|Ga0310896_10160015 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300032783|Ga0335079_11445237 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 681 | Open in IMG/M |
| 3300033233|Ga0334722_11106283 | Not Available | 556 | Open in IMG/M |
| 3300033290|Ga0318519_10503802 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 729 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 15.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.73% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 5.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.92% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 1.92% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.96% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.96% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.96% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.96% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.96% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001843 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM34_10102374 | 3300001843 | Marine Plankton | MVLPEGLEFLNGGWWVVHVLAFLLCYQYGYVRGRGAARREQRARDMAARRD* |
| Ga0055498_100754812 | 3300004058 | Natural And Restored Wetlands | MTLPEGLEFLKFGWWVVHAIAFLLVYQFGYVRGRGDSKREIRQRELAKGS* |
| Ga0062589_1018012921 | 3300004156 | Soil | LPEGLEFLKFGWWVVHAIAFLLVYQFGYVRGRGDLKRETRQRELEASRTKG* |
| Ga0062595_1025304282 | 3300004479 | Soil | TMTLPEGLEFLKFGWWVVHAIAFLLVYQFGYVRGRGDLKRETRQRELEASRTKG* |
| Ga0066674_101936611 | 3300005166 | Soil | MTLPDGLQFLKFGWWVVHAIAFLLVYQFGYVRGRGDVKREQRVRELAKGS* |
| Ga0070690_1011999072 | 3300005330 | Switchgrass Rhizosphere | MTLPEGLEFLKFGWWVVHAMAFLLVYQFGYVRGRGAAKREMRERELEGVRTAKP* |
| Ga0070690_1012053221 | 3300005330 | Switchgrass Rhizosphere | MVLPDGLEFLKFGWWVVHAIAFLLVYQFGYARGRGDLRRDLRQREVAGRPAERARQD* |
| Ga0066388_1008550031 | 3300005332 | Tropical Forest Soil | MTLPEGLEFLKFGWFVVHAIAFLLVYQFGYVRGRGDQKREARQRELEASRTKG* |
| Ga0070689_1000008678 | 3300005340 | Switchgrass Rhizosphere | MTLPEGLEFLKFGWWVVHTMAFLLVYQFGYVRGRGDVKREMRQRELEGSSAAKG* |
| Ga0070688_1001658553 | 3300005365 | Switchgrass Rhizosphere | MVLPDGLEFLKFGWWVVHAIAFLLVYQFGYARGRGALRRELRQREVAGRTTERARQD* |
| Ga0070701_113325381 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLPDGLQFLKFGWWVVHAMAFLLVYQFGYVRGRGAVKRELRERELEGARAAKG* |
| Ga0070705_1008911972 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLPDGLQFLKFGWWVVHAIAFMLVYQFGYVRGRGAMRREQREQELAKGSRTA* |
| Ga0070699_1018778492 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLPEGLEFLKFGWWVVHAIAFLLVYQFGYVRGRGAVKRELRERELEGARAAKG* |
| Ga0073909_100038493 | 3300005526 | Surface Soil | MTLPEGLEFLKFGWWVVHAIMFLLVYQFGYVRGRGDLKRETRQRELEASRTKG* |
| Ga0068855_1021884501 | 3300005563 | Corn Rhizosphere | RDPWRNTQTMTLPEGLEFLKFGWWVVHAIAFLLVYQFGYVRGRGDLKRETRQRELEASRTKG* |
| Ga0066654_107321672 | 3300005587 | Soil | MALPDGLQFLKFGWWVVHSIAFLLVYQFGFARGRGALRREQRQRAIAQGGRGPVQRVG* |
| Ga0068859_1012307691 | 3300005617 | Switchgrass Rhizosphere | MTLPEGLEFLKFGWWVVHTMAFLLVYQFGYVRGRGDVKREMRQRELEGSRAAKG* |
| Ga0066905_1000040802 | 3300005713 | Tropical Forest Soil | MVLPDGLQFLKLGWWVVHVIAFLLVYQFGYARGRGDLRREQRQRELAAKRD* |
| Ga0066905_1015779322 | 3300005713 | Tropical Forest Soil | MTLPDGLQFLRFGWWVVHAIAFLLVYQFGYVRGRGSLRREMR |
| Ga0068861_1002062623 | 3300005719 | Switchgrass Rhizosphere | MTLPEGLEFLKFGWWVVHAIAFLLVYQFGYVRGRGDLKRETRQRELEASRTKG* |
| Ga0066903_1000685162 | 3300005764 | Tropical Forest Soil | MTLPDGLQFLKFGWWVVHAIAFLLVYQFGYVKGRGDMRREQRQRELQGIAAPRAAKG* |
| Ga0066903_1034099172 | 3300005764 | Tropical Forest Soil | MTLPEGLEFLKFGWFVVHAIAFLLVYQFGYVRGRGDQKRETRQRELEASRTAKN* |
| Ga0066903_1070661891 | 3300005764 | Tropical Forest Soil | MSLPDGLQFLKFGWWAVHAIAFLLVYQFGYVRGRGALRREQRARELQGIRTAR* |
| Ga0068863_1002290203 | 3300005841 | Switchgrass Rhizosphere | MTLPEGLEFLKFGWWVVHAIAFLLVYQFGYVRGRGDLKRETRQRELEASRTKS* |
| Ga0070715_100581713 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLPDGLQFLRFGWWAVHAIAFMLVYQFGYVRGRGALRREQRERELQGIRAAKG* |
| Ga0070716_1014722323 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MALPDGLQFLKFGWWVVHAIAFLLVYQFGFVRGRGAMRREQRQ |
| Ga0079221_117766761 | 3300006804 | Agricultural Soil | MTLPEGLEFLRLGWWVVHAIAFLLVYQFGYVRGRGDVKREMRQREVAKGS* |
| Ga0075430_1009766921 | 3300006846 | Populus Rhizosphere | MTLPEGLEFLKFGWWVVHTIAFLLVYQYGYARGRGDARREQRERDVAARR* |
| Ga0075430_1011918651 | 3300006846 | Populus Rhizosphere | MVLPDGLEFLKFGWWVVHAIAFLLVYQFGYARGRGSWRREQRQREVAGRSSERRR* |
| Ga0075420_1004135431 | 3300006853 | Populus Rhizosphere | MVLPDGLEFLKFGWWVVHAIAFLLVYQFGYARGRGSWRREQRQREVAGRSSERGR* |
| Ga0075426_101557722 | 3300006903 | Populus Rhizosphere | MTLPEGLEFLKFGWWVVHATAFLLVYQFGYVRGRGDLKRETRQRELEASRTKG* |
| Ga0075424_1003440283 | 3300006904 | Populus Rhizosphere | MTLPDGLQFLKFGWWVVHAIAFLLVYQFGYVRGRGDLKRETRQRELEASRTKG* |
| Ga0075436_1005455821 | 3300006914 | Populus Rhizosphere | MTLPDGLQFLKFGWWVVHAIAFLLVYQFGYVRGRGALRREQRQRELQGIRAAKG* |
| Ga0075435_1018452332 | 3300007076 | Populus Rhizosphere | MTLPDGLQFLKFGWWVVHAIAFLLVYQFGYVRGRGDVKREQRLREIEGVRAAKG* |
| Ga0111539_100207665 | 3300009094 | Populus Rhizosphere | MTLPDGLQFLKFGWWVVHAMAFLLVYQFGYVRGRGAVKREMRERELEGARAAKG* |
| Ga0111539_101104591 | 3300009094 | Populus Rhizosphere | MVLPDGLEFLKFGWWVVHAIAFLLVYQFGYARGRGSWRREQRQREVAGRSSER |
| Ga0114129_106134813 | 3300009147 | Populus Rhizosphere | MTLPDGLQFLHFGWWVVHAIAFLLVYQFGFVKGRGEARREQRQRDLLASRRVPE* |
| Ga0114129_110400811 | 3300009147 | Populus Rhizosphere | MTLPDGLQFLKFGWWVVHAMAFLLVYQFGYVRGRG |
| Ga0111538_100702843 | 3300009156 | Populus Rhizosphere | MVLPDGLEFLKFGWWVVHAIAFLLVYQFGYARGRGDLRREQRQREVAGRSAEHGR* |
| Ga0111538_126661741 | 3300009156 | Populus Rhizosphere | MTLPEGLEFLKFGWWVVHAMAFLLVYQFGYVRGRGAAKREMRERELEG |
| Ga0105248_106639773 | 3300009177 | Switchgrass Rhizosphere | LPEGLEFLKFGWWVVHAIMFLLVYQFGYVRGRGDLKRETRQRELEASRTKG* |
| Ga0105249_130007082 | 3300009553 | Switchgrass Rhizosphere | MTLPEGLEFLKFGWWVVHAIAFLLVYQFGYVRGRGDLKREMRQRELEASRTKG* |
| Ga0116249_109926623 | 3300010357 | Anaerobic Digestor Sludge | MALPDGLQFLKLGWWVVHVMAFLLAYQFGYARGRGDEKRE |
| Ga0116249_110705952 | 3300010357 | Anaerobic Digestor Sludge | MALPDGLQFLKLGWWVVHVMAFLLAYQFGYARGRGDAKREQRIREIAKGQ* |
| Ga0126370_114617253 | 3300010358 | Tropical Forest Soil | MTLPEGLEFLKFGWWVVHATAFLLVYQFGYVRGRGALKREMR |
| Ga0126372_123765802 | 3300010360 | Tropical Forest Soil | MTLPEGLEFLKFGWFVVHAIAFLLVYQFGYVRGRGAMKRELRQHELAKGN* |
| Ga0126378_100745244 | 3300010361 | Tropical Forest Soil | MTLPEGLEFLKFGWWVVHAIAFMLVYQFGYVRGRGAMKREMREREVAKGS* |
| Ga0126377_112614492 | 3300010362 | Tropical Forest Soil | MTLPEGLEFLKFGWWVVHAIAFLLVYQFGYVRGRGEAKREQRQRELAKGS* |
| Ga0126379_100238217 | 3300010366 | Tropical Forest Soil | MTLPEGLEFLKFGWFVVHAIAFLLVYQFGYVRGRGDVKRETRQRELEASRTKG* |
| Ga0134124_102682893 | 3300010397 | Terrestrial Soil | MTLPEGLEFLKFGWWVVHAMAFLLVYQFGYVRGRGAAKREMRERELEGVRAAKP* |
| Ga0137463_10059003 | 3300011444 | Soil | MVLPDGLEFLKFGWWVVHAIAFLLVYQFGYARGRGDLRRELRQREVAGRSAERARQD* |
| Ga0137365_107248071 | 3300012201 | Vadose Zone Soil | MPLPEGLEFLKFGWWVVHTIAFLLVYQFGYARGRGALRREQRQRELAKRN* |
| Ga0126369_101014384 | 3300012971 | Tropical Forest Soil | MTLPEGLEFLKFGWFVVHAIAFLLVYQFGYVRGRGDQKRETRQRELEASRTAKD* |
| Ga0126369_115357592 | 3300012971 | Tropical Forest Soil | SCARWGRAAEKGTTMALPDGLQFLKFGWWVVHAIAILLVYQFGYVKGRGEARREQRQRELQGIATPRAAKG* |
| Ga0126369_122582711 | 3300012971 | Tropical Forest Soil | MTLPDGLQFLKFGWWVVHAIAFLLVYQFGYVRGRGDQKRETRQRELEASRTAKN* |
| Ga0163144_1000045779 | 3300015360 | Freshwater Microbial Mat | MVLPEGLEFLKGGWWVVHAIAFLIVYQYGFVRGRGEARREQRQRELERGDR* |
| Ga0132256_1008817223 | 3300015372 | Arabidopsis Rhizosphere | MTLPEGLEFLKFGWWVVHAIAFLLVYQFGYVRGRGDLKRE |
| Ga0182035_116346791 | 3300016341 | Soil | GLEFLKFGWWVVHAIAFLLVYQFGYVRGRGDQKRETRQRELEASRSGKN |
| Ga0182032_102127722 | 3300016357 | Soil | MTLPEGLEFLKFGWFVVHAIAFLLVYQFGYVRGRGDQKREMRQREVEKGRSNP |
| Ga0187773_106331872 | 3300018064 | Tropical Peatland | MTLPDGLQFLKFGWFVVHAIAFLLVYQFGYVRGRGDQKREARQRELEASRTAKN |
| Ga0184628_103324303 | 3300018083 | Groundwater Sediment | MVLPDGLEFLKFGWWVVHAIAFLLVYQFGYARGRGDLRRELRQREVA |
| Ga0066667_111448352 | 3300018433 | Grasslands Soil | MALPDGLQFLKFGWWVVHAIAFLLVYQFGFARGRGAPRREQRQRAIAQGGRGPVQRVG |
| Ga0173479_100685191 | 3300019362 | Soil | MTLPEGLEFLKFGWWVVHAIAFLLVYQFGYVRGRGDLKRETRQRELEASRTKG |
| Ga0247661_10049454 | 3300024254 | Soil | MTLPEGLEFLKFGWWVVHSIAFLLVYQFGYVRGRGDLKRETRQRELEASRTKG |
| Ga0247661_10583542 | 3300024254 | Soil | MVLPDGLEFLKFGWWVVHAIAFLLVYQFGYARGRGDLRREQRQREVAGRSTERGR |
| Ga0247671_10118512 | 3300024284 | Soil | MTLPEGLEFLKFGWWVVHAIAFLLVYQFGYVRGRGDLKRETRQRELEVSRTKG |
| Ga0255178_10902192 | 3300024298 | Freshwater | MHLPEGLEFLKSGWWVVHAIAVMLTYQWGYARGRAEARREQRAREIASRKG |
| Ga0209640_107669312 | 3300025324 | Soil | MVLPEGLEFLKLGWWAVHVIAFLLVYQFGYARGRGDQRREQRQRELAAKRD |
| Ga0207653_102498261 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLPEGLEFLKFGWWVVHAMAFLLVYQFGYVRGRGAAKREMRERELEGVRTAKP |
| Ga0207653_103302331 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLPEGLEFLKFGWWVVHAIAFLLVYQFGYVRGRGDLKRETRQRELEASRT |
| Ga0207685_102425582 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLPDGLQFLRFGWWAVHAIAFMLVYQFGYVRGRGALRREQRERELQGIRAAKG |
| Ga0207684_109621492 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLPDGLQFLKFGWWVVHAMAFLLVYQFGYVRGRGAVKRELRERELEGARAAKG |
| Ga0207670_1000007448 | 3300025936 | Switchgrass Rhizosphere | MTLPEGLEFLKFGWWVVHTMAFLLVYQFGYVRGRGDVKREMRQRELEGSSAAKG |
| Ga0207670_117474312 | 3300025936 | Switchgrass Rhizosphere | MTLPEGLEFLKFGWWVVHTMAFLLVYQFGYVRGRGDVKREMRQRELEGSRAAKG |
| Ga0207665_104167682 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MALPDGLQFLKFGWWVVHAIAFLLVYQFGFVRGRGAMRREQRQRDLARAGREPQQRVS |
| Ga0207711_109435033 | 3300025941 | Switchgrass Rhizosphere | MTLPEGLEFLKFGWWVVHAIAFMLVYQFGYVRGRGAMRREQREQELAKGSRT |
| Ga0207689_110553511 | 3300025942 | Miscanthus Rhizosphere | EFLKFGWWVVHAIAFLLVYQFGYVRGRGDLKRETRQRELEASRTKG |
| Ga0209811_1000076511 | 3300027821 | Surface Soil | MTLPEGLEFLKFGWWVVHAIMFLLVYQFGYVRGRGDLKRETRQRELEASRTKG |
| Ga0209465_100561813 | 3300027874 | Tropical Forest Soil | MALPDGLQFLKFGWWVVHAIAILLVYQFGYVKGRGEARREQRQRELQGIATPRAAKG |
| Ga0209465_103459561 | 3300027874 | Tropical Forest Soil | MTLPEGLEFLKFGWFVVHAIAFLLVYQFGYVRGRGDQKRETRQRELEASRTAKD |
| Ga0209481_101993053 | 3300027880 | Populus Rhizosphere | MVLPDGLEFLKFGWWVVHAIAFLLVYQFGYARGRGSWRREQRQREVAGRSSERRR |
| Ga0207428_104951892 | 3300027907 | Populus Rhizosphere | MTLPDGLQFLKFGWWVVHAMAFLLVYQFGYVRGRGAVKREMRERELEGARAAKG |
| Ga0209382_111458692 | 3300027909 | Populus Rhizosphere | MTLPEGLEFLKFGWWVVHTIAFLLVYQYGYARGRGDARREQRERDVAARELR |
| Ga0268264_100325745 | 3300028381 | Switchgrass Rhizosphere | MTLPDGLQFLKFGWWVVHAIAFMLVYQFGYVRGRGAMRREQREQELAKGSRTA |
| Ga0247821_101436381 | 3300028596 | Soil | MVLPDGLEFLKFGWWVVHAIAFLLVYQFGYARGRGSWRREQRQREVAGRSSERGR |
| Ga0247825_110767732 | 3300028812 | Soil | MVLPDGLEFLKFGWWVVHAIAFLLVYQFGYARGRGDLRRELRQREVAGRTTERARQD |
| Ga0318534_101627583 | 3300031544 | Soil | MTLPEGLEFLKFGWFVVHAIAFLLVYQFGYVRGRGDQKRETRQRELEASRSGKN |
| Ga0310886_107056502 | 3300031562 | Soil | MTLPEGLEFLKFGWWVVHAMAFLLVYQFGYVRGRGAVKRELRERELEGVRAAKR |
| Ga0318555_108087271 | 3300031640 | Soil | MTLPEGLEFLKFGWWVVHAIAFLLVYQFGYVRGRGAMKREMREHEVAKGS |
| Ga0318574_102107452 | 3300031680 | Soil | MTLPEGLEFLKFGWFVVHAIAFLLVYQFGYVRGRGDQKRETRQRELEASRSGRN |
| Ga0306917_115066561 | 3300031719 | Soil | MTLPEGLEFLKFGWFVVHAIAFLLVYQFGYVRGRGDQKRETRQRELEAS |
| Ga0318548_102881433 | 3300031793 | Soil | MTLPEGLEFLKFGWFVVHAIAFLLVYQFGYVRGRGDQKRETRQRELEASR |
| Ga0318550_106368091 | 3300031797 | Soil | MTLPEGLEFLKFGWFVVHAIAFLLVYQFGYVRGRGDQKRETRQRELEA |
| Ga0318565_102135421 | 3300031799 | Soil | ATRRGQRIMTLPEGLEFLKFGWFVVHAIAFLLVYQFGYVRGRGDQKRETRQRELEASRSGKN |
| Ga0310904_112758823 | 3300031854 | Soil | EGLEFLKFGWWVVHAMAFLLVYQFGYVRGRGAVKRELRERELEGVRATKR |
| Ga0310900_114701691 | 3300031908 | Soil | MTLPEGLEFLKFGWWVVHAMAFLLVYQFGYVRGRGAVKRELRERELEGVRATKR |
| Ga0318513_106585992 | 3300032065 | Soil | MPLPKGLEFLHFGWWVVHVIAILLVYTIAYRRGRRD |
| Ga0310890_105898933 | 3300032075 | Soil | MVLPDGLEFLKFGWWVVHAIAFLLVYQFGYARGRGSWRREQRQREVAGRS |
| Ga0315910_101019592 | 3300032144 | Soil | MVLPDGLEFLKFGWWVVHAIAFLLVYQLGYAKGRGDLRREQRQRDVAGRSGERTRPD |
| Ga0307470_101909892 | 3300032174 | Hardwood Forest Soil | MTLPDGLQFLRFGWWAVHAIAFLLVYQFGYVRGRGALRREQRQRELQGIPAAKG |
| Ga0310896_101600152 | 3300032211 | Soil | MELPDGLEFLKFGWWVVHAIALLLVYQFGYARGRGSWRREQRQREVAGRSSERGR |
| Ga0335079_114452372 | 3300032783 | Soil | MPLPNGLRFLSLGWWVLHAIVVLLVYQFGFVRGRGEARREQRQRDLEKRR |
| Ga0334722_111062831 | 3300033233 | Sediment | MTLPDGLQFFKFGWWVVHAIAFLLVFQFGYVRGRGSLRRELRQRELHGVRAPKG |
| Ga0318519_105038021 | 3300033290 | Soil | MTLPEGLEFLKFGWFVVHAIAFLLVYQFGYVRGRGDQKRETRQRELEASRSGK |
| ⦗Top⦘ |