| Basic Information | |
|---|---|
| Family ID | F098139 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MKLALIKFLSAATIVCAADVPITQDELVRRTQELYDA |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.77 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.27 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.192 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.231 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.923 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.462 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 47.69% β-sheet: 0.00% Coil/Unstructured: 52.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00856 | SET | 7.69 |
| PF07885 | Ion_trans_2 | 4.81 |
| PF03466 | LysR_substrate | 3.85 |
| PF00126 | HTH_1 | 2.88 |
| PF02754 | CCG | 2.88 |
| PF05635 | 23S_rRNA_IVP | 1.92 |
| PF09411 | PagL | 0.96 |
| PF12867 | DinB_2 | 0.96 |
| PF01471 | PG_binding_1 | 0.96 |
| PF14534 | DUF4440 | 0.96 |
| PF07676 | PD40 | 0.96 |
| PF00583 | Acetyltransf_1 | 0.96 |
| PF00266 | Aminotran_5 | 0.96 |
| PF12697 | Abhydrolase_6 | 0.96 |
| PF08240 | ADH_N | 0.96 |
| PF01134 | GIDA | 0.96 |
| PF13387 | DUF4105 | 0.96 |
| PF00248 | Aldo_ket_red | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 2.88 |
| COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 2.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.19 % |
| Unclassified | root | N/A | 4.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN02JC4D7 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100446332 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 657 | Open in IMG/M |
| 3300000955|JGI1027J12803_101690002 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 518 | Open in IMG/M |
| 3300002557|JGI25381J37097_1073229 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 557 | Open in IMG/M |
| 3300004156|Ga0062589_101592869 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 647 | Open in IMG/M |
| 3300004157|Ga0062590_102504320 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 547 | Open in IMG/M |
| 3300005167|Ga0066672_10240132 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300005174|Ga0066680_10084987 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1914 | Open in IMG/M |
| 3300005332|Ga0066388_106319140 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 598 | Open in IMG/M |
| 3300005446|Ga0066686_10287160 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300005468|Ga0070707_101979865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 550 | Open in IMG/M |
| 3300005540|Ga0066697_10691878 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005552|Ga0066701_10536376 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 720 | Open in IMG/M |
| 3300005553|Ga0066695_10203694 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300005556|Ga0066707_10536125 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300005556|Ga0066707_10543095 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300005556|Ga0066707_10704013 | Not Available | 633 | Open in IMG/M |
| 3300005556|Ga0066707_10897254 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 544 | Open in IMG/M |
| 3300005575|Ga0066702_10085241 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1776 | Open in IMG/M |
| 3300005598|Ga0066706_10390205 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300005764|Ga0066903_100535834 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2001 | Open in IMG/M |
| 3300006028|Ga0070717_10080482 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2733 | Open in IMG/M |
| 3300006163|Ga0070715_10212044 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 990 | Open in IMG/M |
| 3300006791|Ga0066653_10265048 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 874 | Open in IMG/M |
| 3300006844|Ga0075428_100801747 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300007076|Ga0075435_101281042 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300009093|Ga0105240_12566429 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 527 | Open in IMG/M |
| 3300009148|Ga0105243_12272205 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300010322|Ga0134084_10213590 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300010326|Ga0134065_10095523 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 980 | Open in IMG/M |
| 3300010333|Ga0134080_10325468 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300010359|Ga0126376_11380385 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300010359|Ga0126376_11576966 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300010360|Ga0126372_11751774 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300010364|Ga0134066_10224621 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 636 | Open in IMG/M |
| 3300010366|Ga0126379_10457830 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300010373|Ga0134128_10601396 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1224 | Open in IMG/M |
| 3300010376|Ga0126381_100082264 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 4055 | Open in IMG/M |
| 3300010376|Ga0126381_101120889 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1137 | Open in IMG/M |
| 3300010376|Ga0126381_101462266 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300010376|Ga0126381_102032277 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300010398|Ga0126383_13078838 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300011444|Ga0137463_1165842 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 831 | Open in IMG/M |
| 3300012198|Ga0137364_10858509 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300012198|Ga0137364_11179502 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 574 | Open in IMG/M |
| 3300012199|Ga0137383_10315521 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1145 | Open in IMG/M |
| 3300012202|Ga0137363_11753253 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 513 | Open in IMG/M |
| 3300012206|Ga0137380_10226029 | Not Available | 1692 | Open in IMG/M |
| 3300012207|Ga0137381_10180130 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
| 3300012208|Ga0137376_10057386 | All Organisms → cellular organisms → Bacteria | 3202 | Open in IMG/M |
| 3300012208|Ga0137376_11468677 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300012210|Ga0137378_10468499 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1165 | Open in IMG/M |
| 3300012349|Ga0137387_10918590 | Not Available | 632 | Open in IMG/M |
| 3300012351|Ga0137386_11076253 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 569 | Open in IMG/M |
| 3300012354|Ga0137366_10283546 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300012357|Ga0137384_10936992 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 697 | Open in IMG/M |
| 3300012897|Ga0157285_10160650 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 676 | Open in IMG/M |
| 3300012911|Ga0157301_10253612 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300012923|Ga0137359_10188028 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1845 | Open in IMG/M |
| 3300012925|Ga0137419_10919462 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300012927|Ga0137416_11481481 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 616 | Open in IMG/M |
| 3300012929|Ga0137404_11585045 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300012957|Ga0164303_10152653 | Not Available | 1224 | Open in IMG/M |
| 3300012957|Ga0164303_10615240 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 718 | Open in IMG/M |
| 3300012960|Ga0164301_10213889 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300012960|Ga0164301_10521039 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 862 | Open in IMG/M |
| 3300012971|Ga0126369_12049857 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 660 | Open in IMG/M |
| 3300012985|Ga0164308_10342421 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300012985|Ga0164308_11071157 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300012986|Ga0164304_11434851 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300012989|Ga0164305_10379723 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1075 | Open in IMG/M |
| 3300014154|Ga0134075_10180236 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300014154|Ga0134075_10332443 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 664 | Open in IMG/M |
| 3300014166|Ga0134079_10381245 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300015200|Ga0173480_10050827 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1865 | Open in IMG/M |
| 3300015359|Ga0134085_10034472 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1983 | Open in IMG/M |
| 3300018072|Ga0184635_10151103 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300018482|Ga0066669_11844546 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300019356|Ga0173481_10313702 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 734 | Open in IMG/M |
| 3300019361|Ga0173482_10045849 | Not Available | 1398 | Open in IMG/M |
| 3300019880|Ga0193712_1062718 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 812 | Open in IMG/M |
| 3300019885|Ga0193747_1088436 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 758 | Open in IMG/M |
| 3300021168|Ga0210406_10465181 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300022756|Ga0222622_10636597 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 772 | Open in IMG/M |
| 3300025915|Ga0207693_10655133 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300025933|Ga0207706_10060363 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium | 3339 | Open in IMG/M |
| 3300025937|Ga0207669_10698321 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300026078|Ga0207702_10032478 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4356 | Open in IMG/M |
| 3300026297|Ga0209237_1103855 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1239 | Open in IMG/M |
| 3300026310|Ga0209239_1102975 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1208 | Open in IMG/M |
| 3300026329|Ga0209375_1236230 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300026547|Ga0209156_10255242 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 811 | Open in IMG/M |
| 3300027050|Ga0209325_1021971 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 748 | Open in IMG/M |
| 3300027635|Ga0209625_1104576 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300027907|Ga0207428_10067780 | All Organisms → cellular organisms → Bacteria | 2809 | Open in IMG/M |
| 3300028715|Ga0307313_10089518 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 930 | Open in IMG/M |
| 3300028799|Ga0307284_10278352 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300028807|Ga0307305_10391039 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300028876|Ga0307286_10106885 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 986 | Open in IMG/M |
| 3300028884|Ga0307308_10336434 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 723 | Open in IMG/M |
| 3300030972|Ga0075400_11728070 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300031057|Ga0170834_103515445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1097 | Open in IMG/M |
| 3300031231|Ga0170824_104541943 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300031231|Ga0170824_124458570 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.23% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.92% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030972 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_01574980 | 2170459013 | Grass Soil | MKLALIKFLSAATIVCAADIPITQDELVRRTQELY |
| INPhiseqgaiiFebDRAFT_1004463323 | 3300000364 | Soil | MFRVMKLVLVIIFATTLAXAADXPXTXDXLVRXTXXLYXAVA |
| JGI1027J12803_1016900022 | 3300000955 | Soil | MKLAFVASFFAATLACAMDVPITQDELVRRTQELY |
| JGI25381J37097_10732292 | 3300002557 | Grasslands Soil | MKLLALIAFTSAATFACAVNIPLTQEELVRRTQELYDXVAXAN |
| Ga0062589_1015928691 | 3300004156 | Soil | MKQLTLIKFLSAATLVCAADVPITQDELVRRTQELYDALV |
| Ga0062590_1025043202 | 3300004157 | Soil | MKQLALIKFLFVATVVCAADVPITQDELVRRTQELYDSLVSGDQ |
| Ga0066672_102401321 | 3300005167 | Soil | MFSVMKLALVIIFATTFVHAADVPITQDEFIRRTQELYDAIVPGNQ |
| Ga0066680_100849874 | 3300005174 | Soil | MFSVMKLALVIIFTTTLAYAGDVPITQDELVHRTQELYDAIVPGNQ |
| Ga0066388_1063191401 | 3300005332 | Tropical Forest Soil | MKQLALIKFLFAATIVCAADVPITQDELVRRTQELYDAVVPG |
| Ga0066686_102871602 | 3300005446 | Soil | MKLPLVTFFFAVTIACATDVPITQDELVHRTQELYDAIVPGNQA |
| Ga0070707_1019798652 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLAFTTFFLAVTITCAADVPITQDELVRRTQELYDAVVPG |
| Ga0066697_106918782 | 3300005540 | Soil | MFSVMKLVLVIFATTLAHTADAPIAQDELVRRTQELYDA |
| Ga0066701_105363761 | 3300005552 | Soil | MKLALVIIFTTTLAYTGDVPITQDELVRRTQELYDAIV |
| Ga0066695_102036944 | 3300005553 | Soil | MKLALVTFFSAVTLVSAADVPITQNELVRRTQELYDAI |
| Ga0066707_105361251 | 3300005556 | Soil | MKLALVIIFTTTLAYTGDVPITQDELVRRTQELYDAIVPG |
| Ga0066707_105430952 | 3300005556 | Soil | MKLALITFLSAVTLACAADVPITQDELVRRTQELY |
| Ga0066707_107040131 | 3300005556 | Soil | MKVALVTLCFGVTLACAEDVPITQDELVGRTQELY |
| Ga0066707_108972542 | 3300005556 | Soil | MKLALIKFLSVATIVCAADLPITQDELVRRTQELYDAVVPG |
| Ga0066702_100852411 | 3300005575 | Soil | MKFALTTFLFAVALARAADVPITQEELVRRTQELYDAIVPGN |
| Ga0066706_103902051 | 3300005598 | Soil | MFSVMKLVLVIFATTLAHTADAPIAQDELVRRTQELYDAIVPGNQ |
| Ga0066903_1005358341 | 3300005764 | Tropical Forest Soil | MILVKQIAVIKFLSAAIIVCAADVPITQDDLVRRTQELYDAV |
| Ga0070717_100804826 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MILMKQLVLIKFLSAATIVCAADVPITQDELVRRTQELYDA |
| Ga0070715_102120441 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKQLVLIKFLSAATIVCAADVPIAQDELVRRTQELYDALVPGN |
| Ga0066653_102650481 | 3300006791 | Soil | MKLALVTFFSTVTLACAADVPITQDELVRRTQELYDAIV |
| Ga0075428_1008017473 | 3300006844 | Populus Rhizosphere | MKLALISFLSAATVVCAADVPITQDELARRTQELY |
| Ga0075435_1012810421 | 3300007076 | Populus Rhizosphere | MKQLALIKFLSAATIVYAADVAITQDELVRRTQELYDAV |
| Ga0105240_125664292 | 3300009093 | Corn Rhizosphere | MKQLMLIKFLSAATLVCAADVPITQDELVRRTQELYDALVSGNQ |
| Ga0105243_122722052 | 3300009148 | Miscanthus Rhizosphere | MILMKRLMLIGFLSFATVVCAADVPITQDELIRRTQEL |
| Ga0134084_102135902 | 3300010322 | Grasslands Soil | MKLALIKFLSAATIVCAADVPITQDELVRRTQELYDAVVP |
| Ga0134065_100955231 | 3300010326 | Grasslands Soil | MKLLPVIIFATALAHAADAPITQDELVRRTQELYDA |
| Ga0134080_103254681 | 3300010333 | Grasslands Soil | MKQFALIKFLSAVTIVCAADVPITQDELVRRTQELYDS |
| Ga0126376_113803852 | 3300010359 | Tropical Forest Soil | MKRLMLIGFLSLATIVCAADAPITQNELIRRTQELYDSLVSGN |
| Ga0126376_115769662 | 3300010359 | Tropical Forest Soil | MKLALIQFLSAATIVCAADVPITQEELVRRTQELYDAVVPG |
| Ga0126372_117517741 | 3300010360 | Tropical Forest Soil | MKLQLVIFFSAVTIAYPTDVPITPDELVRRTQELYDAIVP |
| Ga0134066_102246211 | 3300010364 | Grasslands Soil | MKLALVTFFSAVTLACAADVPITQDELVRRTQELYDALVPGN |
| Ga0126379_104578301 | 3300010366 | Tropical Forest Soil | MKQLALIKFLCAATVVCAADVPITQDELVRRTQELYYSLVSGN |
| Ga0134128_106013963 | 3300010373 | Terrestrial Soil | MKQLALIKFLAAATIVCAADVPITQDELVRRTQELYDSLVSGD |
| Ga0126381_1000822641 | 3300010376 | Tropical Forest Soil | MIAMKRFMLIGFLSLATVVCAEEVPISQDELIRRTQELYDS |
| Ga0126381_1011208891 | 3300010376 | Tropical Forest Soil | MKQLALIAFTSVTTFACAANTAITEEELVRRTQELYDAVAS |
| Ga0126381_1014622661 | 3300010376 | Tropical Forest Soil | MKHTLIIFLFAATIVCAADVPITQDELVRRTQELYD |
| Ga0126381_1020322771 | 3300010376 | Tropical Forest Soil | MKRFMLIGFLSLATVVCAEEVPISQDELIRRTQELYDS |
| Ga0126383_130788382 | 3300010398 | Tropical Forest Soil | MKRLMLSGFLSLATVVCAADVAITQDELVRRTQELY |
| Ga0137463_11658422 | 3300011444 | Soil | MKQLALIKFLSAATIVCAADVPIMQDELVRRTQELYDAV |
| Ga0137364_108585092 | 3300012198 | Vadose Zone Soil | MKLALVTFFFTATIACAAEVPITQDELVRRTQELYDALVPGNQ |
| Ga0137364_111795021 | 3300012198 | Vadose Zone Soil | MKLALVIIFTTTLAYAADVPITQDELVRRTQELYDAV |
| Ga0137383_103155214 | 3300012199 | Vadose Zone Soil | MKQLAFIKFLSAATIVCAADVPIMQDELVRRTQELYDAIVSG |
| Ga0137363_117532531 | 3300012202 | Vadose Zone Soil | MKQLAFINFLSAATIVCAADAPIAQDDLVRRTQELYDAV |
| Ga0137380_102260291 | 3300012206 | Vadose Zone Soil | MKLLFVIIFATKLTHAAAADLPITQQELVRRTQEL |
| Ga0137381_101801301 | 3300012207 | Vadose Zone Soil | MKQLALIKFLSAATIVCAADVPITQDELVRRTQELYDAVVP |
| Ga0137376_100573861 | 3300012208 | Vadose Zone Soil | MKQLALIKFLSAATILCAADVPITQDELVRRTQELYDAV |
| Ga0137376_114686771 | 3300012208 | Vadose Zone Soil | MKLALIKFLSAATIVCAADVPITQDELVRRTQELYDAVVS |
| Ga0137378_104684993 | 3300012210 | Vadose Zone Soil | MFSIMKLALVIIFATILVHAADLPITQDELVRRTQELYDAIVPGN |
| Ga0137387_109185902 | 3300012349 | Vadose Zone Soil | MKLLFVIIFATKLTHAAAADLPITQQELVRRTQELCDAIAPG |
| Ga0137386_110762532 | 3300012351 | Vadose Zone Soil | MKLVLIKFLSAATIVCAADIPITQDELVRRTQELYDAVVPG |
| Ga0137366_102835463 | 3300012354 | Vadose Zone Soil | MKQLALINFWSAATIVCAADVPITQDELVRRTQELYDAVV |
| Ga0137384_109369921 | 3300012357 | Vadose Zone Soil | MKQLAFIKFLSAATIVCAADVPITQDELVRRTQELYDAV |
| Ga0157285_101606501 | 3300012897 | Soil | MKQLALIKFLSAATIVCAADVPIAHDELVRRTQELYDAVV |
| Ga0157301_102536121 | 3300012911 | Soil | MKQLALIKFLSAATIVCAADVPIAHDELVRRTQELYDAVVPGNQ |
| Ga0137359_101880281 | 3300012923 | Vadose Zone Soil | MKLLALIAFTSAATLACAVNIPLTQEELVRRTQELYDAVAFANQA |
| Ga0137419_109194621 | 3300012925 | Vadose Zone Soil | MKLALIKFLSAATIVCAADVPITQNELVRRTQELYDAVVP |
| Ga0137416_114814811 | 3300012927 | Vadose Zone Soil | MKLPLVTFFSGVTIACATDVPITQDELVRRTQELYDA |
| Ga0137404_115850451 | 3300012929 | Vadose Zone Soil | MKLALVTFFSAVTLACAADVPITQDELVRRTQELYD |
| Ga0164303_101526531 | 3300012957 | Soil | LALIKFLFAATIVSAADVPITQDELLRRTQELYDSLVSGDQAP* |
| Ga0164303_106152401 | 3300012957 | Soil | MIFMKQLALIKFLSAATIVCAADVPITQDELVRRTQELYDALVPGNQGP |
| Ga0164301_102138893 | 3300012960 | Soil | MKFALITFLFAVTLACGADVQITPDELIRRTQELYDAIVPG |
| Ga0164301_105210391 | 3300012960 | Soil | MKLVLLGFLYLTTIACAGDVPITQEELIRRSQELYDSLVSGDQAP |
| Ga0126369_120498572 | 3300012971 | Tropical Forest Soil | MKQLALITFLSAGTIGCAADVPIVQDELVRRTQELYDA |
| Ga0164308_103424211 | 3300012985 | Soil | MKQLMLIKFLSAATIVCAADVPITQDELVRRTQELYDALVPGNQ |
| Ga0164308_110711573 | 3300012985 | Soil | MKLVLIKFLSAATIVCAADVPLTQDELVRRTQELYDALVPGN |
| Ga0164304_114348511 | 3300012986 | Soil | MKLVLIEFLSAATIVCAADVPITQDELIRRTQELYDSLVSG |
| Ga0164305_103797233 | 3300012989 | Soil | MKQLVLIKFLSAATIVCAADVPITQDELVRRTQELYDALVPG |
| Ga0134075_101802362 | 3300014154 | Grasslands Soil | MKLALVTFFYTVTLVFAADVPITQDELVRRTQELYD |
| Ga0134075_103324431 | 3300014154 | Grasslands Soil | MKLALVTFFSTVTLVYPADVRITQDELVRRTQELYD |
| Ga0134079_103812452 | 3300014166 | Grasslands Soil | MKLLALIAFTSAATFACAVNIPLTQEELVRRTQELYDAVASANQA |
| Ga0173480_100508272 | 3300015200 | Soil | MKQLTLIKFLSAATLVCAADVPITQDELVRRTQELYDALVSG |
| Ga0134085_100344724 | 3300015359 | Grasslands Soil | MKLALVIIFTTTLAYTGDVPITQDELVRRTQELYD |
| Ga0184635_101511032 | 3300018072 | Groundwater Sediment | MFSVMKLVLVIIFATALVHAADAPITQEELVRRTQEL |
| Ga0066669_118445462 | 3300018482 | Grasslands Soil | MILMKQLAFIKFLSAATIVCAADIPITQDELVRRTQELYDAVVPG |
| Ga0173481_103137022 | 3300019356 | Soil | MKQLALIKFLSAATIVCAADVPIAHDELVRRTQEL |
| Ga0173482_100458491 | 3300019361 | Soil | MKQLALITFLSAATIVCAADVPITHDELRRRTQELYD |
| Ga0193712_10627181 | 3300019880 | Soil | MILMKQLALIKFLSAATIVCAADVPITQEELVRRTQELYDSL |
| Ga0193747_10884361 | 3300019885 | Soil | MILMKQLVLIKFLSAATIVCAADVPITQDELIQRTQELYD |
| Ga0210406_104651811 | 3300021168 | Soil | MKLVLINFLSAATIVCAADVPLTQDELVRRTQELYDAVVP |
| Ga0222622_106365971 | 3300022756 | Groundwater Sediment | MKLVLITIFVTIFATTLAYAADAPITQDELVRRTQE |
| Ga0207693_106551332 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKQLALIKFLSAATIVCAAADIPITRDELVRRTQEL |
| Ga0207706_100603633 | 3300025933 | Corn Rhizosphere | MKQLALITFLFAATIVCAADVPITQDELVRRTQELYDALVSG |
| Ga0207669_106983211 | 3300025937 | Miscanthus Rhizosphere | MKLALIKFLSAATIVCAADVPITQDELVRRTQELYDALVSGN |
| Ga0207702_100324785 | 3300026078 | Corn Rhizosphere | MKQLALITFLFAATIVCAADVPITQDELVRRTQELYDA |
| Ga0209237_11038551 | 3300026297 | Grasslands Soil | MKLVPVIIFATTLAHAADVPITEDELVRRTQELCDAIAPGNQTP |
| Ga0209239_11029754 | 3300026310 | Grasslands Soil | MKLALIKFLSAATIVCAADVPITQDELVRRTQELYDAVVPG |
| Ga0209375_12362302 | 3300026329 | Soil | MKLALITFLSAVTLACAADVPITQDELVRRTQELYD |
| Ga0209156_102552421 | 3300026547 | Soil | MILMKQLVLIKFLSATTIVCAADVPITQDELVRRTQELY |
| Ga0209325_10219711 | 3300027050 | Forest Soil | MKLALIKFLSAATIVCAADVPITQDELVRCTQELYDALVPGDQAP |
| Ga0209625_11045761 | 3300027635 | Forest Soil | MKLPLVTFFSAVTIACATDVPITQDELVRRTQELYDAIVPG |
| Ga0207428_100677801 | 3300027907 | Populus Rhizosphere | MKQLALISFLSAATVVCAADVPITQDELARRTQELYDSLVSGDR |
| Ga0307313_100895181 | 3300028715 | Soil | MKPALVTFFSVVTLACAADFPITQDELVHRTQELY |
| Ga0307284_102783522 | 3300028799 | Soil | MKFALTTFLFAVALAGAADVPITQEELVRRTQELYDAIVPGN |
| Ga0307305_103910391 | 3300028807 | Soil | MKQLALIKFLSAATIVCAADVPITQEELVRRTQELYDSL |
| Ga0307286_101068851 | 3300028876 | Soil | MKLALIKFLSAATIVCAADVPITQDELVRRTQELYDA |
| Ga0307308_103364341 | 3300028884 | Soil | MILMKQLALIKFLSAATIVCAADVPITQDELVRRTQELYDA |
| Ga0075400_117280702 | 3300030972 | Soil | MKLALIKFLSAATIVCAADVPITQDELIRRTQELY |
| Ga0170834_1035154453 | 3300031057 | Forest Soil | MKLALVTFFYTVTLVYAADVPITQDELVRQTQELYDAVVPG |
| Ga0170824_1045419432 | 3300031231 | Forest Soil | MFSLMKLVLVIIFATTLAHAADVPITQDELVRRTQEL |
| Ga0170824_1244585702 | 3300031231 | Forest Soil | MFSVMKLVLVIIFATTLAHAADVPITQDELVRRTQELYDAIVPG |
| ⦗Top⦘ |