NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F098123

Metagenome / Metatranscriptome Family F098123

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098123
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 46 residues
Representative Sequence MEFRFGSVGLQVQYKYLAATTGTTGKEVKVGGSGVLAGVSIIF
Number of Associated Samples 91
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.96 %
% of genes near scaffold ends (potentially truncated) 99.04 %
% of genes from short scaffolds (< 2000 bps) 94.23 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.21

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (74.038 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(35.577 % of family members)
Environment Ontology (ENVO) Unclassified
(64.423 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(47.115 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.13%    β-sheet: 0.00%    Coil/Unstructured: 78.87%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.21
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF03401TctC 32.69
PF01050MannoseP_isomer 10.58
PF00255GSHPx 9.62
PF00483NTP_transferase 4.81
PF04143Sulf_transp 1.92
PF04892VanZ 0.96
PF06283ThuA 0.96
PF01370Epimerase 0.96
PF01527HTH_Tnp_1 0.96
PF02834LigT_PEase 0.96
PF13505OMP_b-brl 0.96
PF02543Carbam_trans_N 0.96
PF13683rve_3 0.96
PF01381HTH_3 0.96
PF00749tRNA-synt_1c 0.96
PF03737RraA-like 0.96
PF16868NMT1_3 0.96
PF01384PHO4 0.96
PF00501AMP-binding 0.96
PF00072Response_reg 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 32.69
COG0386Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxidesDefense mechanisms [V] 9.62
COG2391Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domainsGeneral function prediction only [R] 1.92
COG0008Glutamyl- or glutaminyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.96
COG0306Phosphate/sulfate permeaseInorganic ion transport and metabolism [P] 0.96
COG0684RNA degradosome component RraA (regulator of RNase E activity)Translation, ribosomal structure and biogenesis [J] 0.96
COG1514RNA 2',3'-cyclic phosphodiesterase (2'-5' RNA ligase)Translation, ribosomal structure and biogenesis [J] 0.96
COG2192Predicted carbamoyl transferase, NodU familyGeneral function prediction only [R] 0.96
COG4813Trehalose utilization proteinCarbohydrate transport and metabolism [G] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.04 %
UnclassifiedrootN/A25.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005172|Ga0066683_10272570All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter1051Open in IMG/M
3300005175|Ga0066673_10904194All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium502Open in IMG/M
3300005176|Ga0066679_10929372All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria546Open in IMG/M
3300005574|Ga0066694_10038585All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium2149Open in IMG/M
3300005764|Ga0066903_108348846All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria529Open in IMG/M
3300005880|Ga0075298_1006736Not Available889Open in IMG/M
3300006163|Ga0070715_10389569All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium771Open in IMG/M
3300006794|Ga0066658_10118521All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter1287Open in IMG/M
3300007258|Ga0099793_10229134All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria894Open in IMG/M
3300009088|Ga0099830_10063401All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2653Open in IMG/M
3300009090|Ga0099827_10482087All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter1065Open in IMG/M
3300009090|Ga0099827_10690627All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium882Open in IMG/M
3300009137|Ga0066709_101302192All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter1065Open in IMG/M
3300009143|Ga0099792_10251569All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter1029Open in IMG/M
3300009148|Ga0105243_11762389Not Available649Open in IMG/M
3300009609|Ga0105347_1118356All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_64_141013Open in IMG/M
3300009610|Ga0105340_1560551All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales510Open in IMG/M
3300011397|Ga0137444_1006972All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1415Open in IMG/M
3300011408|Ga0137460_1006267All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1550Open in IMG/M
3300011408|Ga0137460_1104111All Organisms → cellular organisms → Bacteria → Proteobacteria561Open in IMG/M
3300011410|Ga0137440_1039978All Organisms → cellular organisms → Bacteria → Proteobacteria875Open in IMG/M
3300011419|Ga0137446_1120558Not Available630Open in IMG/M
3300011429|Ga0137455_1050653All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1172Open in IMG/M
3300011429|Ga0137455_1060175All Organisms → cellular organisms → Bacteria → Proteobacteria1081Open in IMG/M
3300011430|Ga0137423_1264523Not Available507Open in IMG/M
3300011433|Ga0137443_1112811All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp.788Open in IMG/M
3300011433|Ga0137443_1225205Not Available559Open in IMG/M
3300011437|Ga0137429_1039474Not Available1369Open in IMG/M
3300011441|Ga0137452_1027861All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1755Open in IMG/M
3300011441|Ga0137452_1091216Not Available997Open in IMG/M
3300011441|Ga0137452_1129540All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_64_14843Open in IMG/M
3300011442|Ga0137437_1152345Not Available800Open in IMG/M
3300011445|Ga0137427_10188898Not Available855Open in IMG/M
3300011445|Ga0137427_10262611Not Available723Open in IMG/M
3300012040|Ga0137461_1106703All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp.804Open in IMG/M
3300012096|Ga0137389_10512954All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter1029Open in IMG/M
3300012096|Ga0137389_10726447All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria853Open in IMG/M
3300012129|Ga0137345_1033294All Organisms → cellular organisms → Bacteria → Proteobacteria651Open in IMG/M
3300012157|Ga0137353_1080285Not Available607Open in IMG/M
3300012159|Ga0137344_1051308All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300012166|Ga0137350_1031749All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1003Open in IMG/M
3300012167|Ga0137319_1023244All Organisms → cellular organisms → Bacteria → Proteobacteria1251Open in IMG/M
3300012173|Ga0137327_1135905Not Available540Open in IMG/M
3300012189|Ga0137388_11922435All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium521Open in IMG/M
3300012203|Ga0137399_10750117All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium822Open in IMG/M
3300012209|Ga0137379_10713371All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium908Open in IMG/M
3300012228|Ga0137459_1156656Not Available670Open in IMG/M
3300012232|Ga0137435_1140622All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria735Open in IMG/M
3300012359|Ga0137385_10402628All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1167Open in IMG/M
3300012671|Ga0137318_1038840Not Available502Open in IMG/M
3300012917|Ga0137395_10953645All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria617Open in IMG/M
3300012918|Ga0137396_10621881All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria798Open in IMG/M
3300012918|Ga0137396_11246638All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium520Open in IMG/M
3300012922|Ga0137394_10472016All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1067Open in IMG/M
3300012925|Ga0137419_11384806All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria593Open in IMG/M
3300014262|Ga0075301_1022606Not Available1070Open in IMG/M
3300014269|Ga0075302_1028405Not Available1040Open in IMG/M
3300014308|Ga0075354_1146547All Organisms → cellular organisms → Bacteria → Proteobacteria534Open in IMG/M
3300014870|Ga0180080_1010106All Organisms → cellular organisms → Bacteria1194Open in IMG/M
3300014871|Ga0180095_1042177Not Available791Open in IMG/M
3300014875|Ga0180083_1142191Not Available530Open in IMG/M
3300014877|Ga0180074_1145478All Organisms → cellular organisms → Bacteria → Proteobacteria530Open in IMG/M
3300014879|Ga0180062_1118462Not Available607Open in IMG/M
3300014881|Ga0180094_1065703Not Available795Open in IMG/M
3300014885|Ga0180063_1177697All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → unclassified Rhodocyclaceae → Rhodocyclaceae bacterium680Open in IMG/M
3300015052|Ga0137411_1050079All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter1272Open in IMG/M
3300015254|Ga0180089_1039029All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria915Open in IMG/M
3300015264|Ga0137403_10031415All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales5613Open in IMG/M
3300017997|Ga0184610_1075206All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1039Open in IMG/M
3300018056|Ga0184623_10279122All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium759Open in IMG/M
3300018063|Ga0184637_10700054Not Available554Open in IMG/M
3300018071|Ga0184618_10351296All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria628Open in IMG/M
3300018071|Ga0184618_10502542All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300018468|Ga0066662_10796825All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium916Open in IMG/M
3300018482|Ga0066669_10833848All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria819Open in IMG/M
3300019212|Ga0180106_1091280Not Available597Open in IMG/M
3300019257|Ga0180115_1121591Not Available542Open in IMG/M
3300019883|Ga0193725_1063269All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium924Open in IMG/M
3300019999|Ga0193718_1003230All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3467Open in IMG/M
3300020066|Ga0180108_1245357All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300020068|Ga0184649_1036869All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300021081|Ga0210379_10230574Not Available801Open in IMG/M
3300021086|Ga0179596_10024855All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium2229Open in IMG/M
3300025955|Ga0210071_1047161All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium plurifarium550Open in IMG/M
3300025973|Ga0210145_1044189All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas cichorii522Open in IMG/M
3300026319|Ga0209647_1198799All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium704Open in IMG/M
3300026324|Ga0209470_1325072All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria559Open in IMG/M
3300026328|Ga0209802_1292660All Organisms → cellular organisms → Bacteria → Proteobacteria540Open in IMG/M
3300026335|Ga0209804_1113299All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter1236Open in IMG/M
3300026343|Ga0209159_1083375All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter1433Open in IMG/M
3300027512|Ga0209179_1073902All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria748Open in IMG/M
3300027663|Ga0208990_1152669All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium610Open in IMG/M
3300027846|Ga0209180_10282395All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium953Open in IMG/M
3300027862|Ga0209701_10111926Not Available1697Open in IMG/M
3300027882|Ga0209590_10303263All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter1026Open in IMG/M
3300028793|Ga0307299_10167340All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium827Open in IMG/M
3300032180|Ga0307471_102745566All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium625Open in IMG/M
3300032180|Ga0307471_104152422All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300033813|Ga0364928_0002974All Organisms → cellular organisms → Bacteria2794Open in IMG/M
3300033813|Ga0364928_0041945All Organisms → cellular organisms → Bacteria → Proteobacteria986Open in IMG/M
3300033814|Ga0364930_0080444Not Available1112Open in IMG/M
3300033814|Ga0364930_0261308All Organisms → cellular organisms → Bacteria → Proteobacteria585Open in IMG/M
3300034114|Ga0364938_004271All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1773Open in IMG/M
3300034176|Ga0364931_0168198Not Available710Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil35.58%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil22.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.69%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment5.77%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment4.81%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.88%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.88%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.92%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.96%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005880Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300011397Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2EnvironmentalOpen in IMG/M
3300011408Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT723_2EnvironmentalOpen in IMG/M
3300011410Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2EnvironmentalOpen in IMG/M
3300011419Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2EnvironmentalOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300011433Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300011441Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2EnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012040Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012129Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT530_2EnvironmentalOpen in IMG/M
3300012157Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2EnvironmentalOpen in IMG/M
3300012159Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2EnvironmentalOpen in IMG/M
3300012166Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2EnvironmentalOpen in IMG/M
3300012167Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT333_2EnvironmentalOpen in IMG/M
3300012173Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012228Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2EnvironmentalOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012671Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT300_2EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014262Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1EnvironmentalOpen in IMG/M
3300014269Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1EnvironmentalOpen in IMG/M
3300014308Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1EnvironmentalOpen in IMG/M
3300014870Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10DEnvironmentalOpen in IMG/M
3300014871Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1DaEnvironmentalOpen in IMG/M
3300014875Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10DEnvironmentalOpen in IMG/M
3300014877Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10DEnvironmentalOpen in IMG/M
3300014879Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10DEnvironmentalOpen in IMG/M
3300014881Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1DaEnvironmentalOpen in IMG/M
3300014885Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10DEnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019212Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019257Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019999Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1EnvironmentalOpen in IMG/M
3300020066Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT45_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020068Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300025955Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025973Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300027512Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027663Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033813Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17EnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034114Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066683_1027257023300005172SoilGMEFRFGSVGLQVQYKYLAATTGTTSKEVKVGGSGVLAGVSIIF*
Ga0066673_1090419423300005175SoilGGPAFQGLAGMEFRFGSVGLNVQYKYLASTTGKTGSDVKVGGRGVLAGVSIAF*
Ga0066679_1092937213300005176SoilYQGLVGMEFRFGSVGLQVQYKYLAATTGTTGKEVKVGGSGVLAGVSIIF*
Ga0066694_1003858543300005574SoilPAFQGLAGMEFRFGSVGLNVQYKYLASTTGKTGSDVKVGGRGVLAGVSIAF*
Ga0066903_10834884613300005764Tropical Forest SoilDFRFSDVVGLYVEYKYLGATTADKGGQTVKAGGSGILAGISIVF*
Ga0075298_100673613300005880Rice Paddy SoilAGAEFRFRQVGFQVQYKYLGSTTGNPGKEVKIGGRGILAGVSFAF*
Ga0070715_1038956913300006163Corn, Switchgrass And Miscanthus RhizosphereKGTAGGAAFQGLAGLEFRFDRVGLLVQYKYLAATTGKNGNDVKVGGSGVLAGVSIAF*
Ga0066658_1011852113300006794SoilMEFRFGSVGLQVQYKYLAATTGTTGKEVKVGGSGVLAGVSIIF*
Ga0099793_1022913423300007258Vadose Zone SoilGMEFRFGSVGLQVQYKYLSSTTGKSGKDVKVGGGGVLAGVSIIF*
Ga0099830_1006340113300009088Vadose Zone SoilGLTGNATGPAFQGLAGMEFRFSHIGLNVQYRYLDSTTGGNGKDVKVGGSGILAGVSIVF*
Ga0099827_1048208713300009090Vadose Zone SoilTQGGTAYQGLVGMEFRFGSVGLQVQYKHLASTTGKSGKDVKVGGSGVLAGVSIIF*
Ga0099827_1069062713300009090Vadose Zone SoilAAGAAFQGLAGLEFRFDRVGLLVQYKYLAATTGKNGNDVKVGGSGVLAGVSIAF*
Ga0066709_10130219213300009137Grasslands SoilGMEFRFDQVGVLLQYKHLAATTGKSGSDVKIGGSGVLAGISIAF*
Ga0099792_1025156913300009143Vadose Zone SoilGTAYQGLVGMEFRFGSVGLQVQYKHLAATTGKSGSDVKVGGSGVLAGVSIIF*
Ga0105243_1176238913300009148Miscanthus RhizosphereRIGISVQYKYLDATTGDSDRELKVGGSGILAGVSIAF*
Ga0105347_111835623300009609SoilAYQGMAGMEFRFGRVGLQLQYKYLAAAAGGSGKDLKVGGSGVLAGVSVAF*
Ga0105340_156055123300009610SoilLAGMEFRFKPVGLYLQYKYLSSKTGDVGKEVNVGGSGILAGVSIIF*
Ga0137444_100697233300011397SoilMEFRFKPVGVYVQYKYLSAKTGDTGNEVKVGGSGVLAGVSISF*
Ga0137460_100626723300011408SoilGLAYQGMAGMEFRFKPVGLYVQYKNLASKWITGDAGREVKVGGSGILAGVSISF*
Ga0137460_110411113300011408SoilKPVGLYVQYKYLAATTGDTGNEVKVGGSGILAGVSILF*
Ga0137440_103997823300011410SoilYQGLAGLELRFKPVGLYVQYKYLAATTGDTGNEVKVGGSGILAGVSIIF*
Ga0137446_112055813300011419SoilYQGLAGMEFRFKPVGVYVQYKNLSAKTGDTGNEVKVGGSGVFAGVSVSF*
Ga0137455_105065313300011429SoilATGLAFQGLAGMEFRIKPVGIYLQYKNLSAKTGDSGKEIKVGGSGFLAGISISF*
Ga0137455_106017533300011429SoilFRFKSVGLYVQYKNLASKTGDAGKEVKVGGSGILAGVSIAF*
Ga0137423_126452323300011430SoilTGTASGLAYQGLAGFEIRFKPVGVYVQYKYLASDVGDSGREVKVGGSGILAGIRISF*
Ga0137443_111281113300011433SoilTATGLAYQGLVGMEFRFKQIGVNLQYKYLSATTGDSGEEVKVGGSGILAGVSISF*
Ga0137443_122520513300011433SoilGMEFRFKPVGVYVQYKNLSAKTGDSGNEVKVGGSGVFAGVSIGF*
Ga0137429_103947423300011437SoilASGLAYQGLAGFEIRFKPVGVYVQYKYLASDVGDSGREVKVGGSGILAGIRISF*
Ga0137452_102786113300011441SoilRGLAYQGLVGMEFRFKPVGPYVQYKYVASTTGDTSNEVKVGGSGILAGVSIVF*
Ga0137452_109121613300011441SoilEFRFNRIGVSLQYKYLDATTGDTEKVKVGGSGILAGVSIAF*
Ga0137452_112954023300011441SoilYQGMAGMEFRFGPVGLQVQYKYLAATTGSSGKDTKVGGSGVLAGVSVAF*
Ga0137437_115234513300011442SoilQGLAGMEFRIKPVGLYVQYKYLSPKPGDAGREVKVGGSGVLAGISISF*
Ga0137427_1018889813300011445SoilGMEFRFKPVGLYVQYKKLFAKTGDTGREVEVGGSGILAGISITF*
Ga0137427_1026261123300011445SoilRFNRIGINVQYKYLDATTGSSSKEVKVGGSGILAGVSFAF*
Ga0137461_110670323300012040SoilVAYQGLAGMEFRFKPVGLYVQYKNFDSKWITGDTGKEVKVGGSGIFAGVSISF*
Ga0137389_1051295423300012096Vadose Zone SoilGLVGMEFRFGSVGLQVQYKYLAATTGKSGSDGKVGGSGVLAGVSIIF*
Ga0137389_1072644723300012096Vadose Zone SoilFQGMAGMEFRFGSVGLNVQYKYLAATTGKSGNDVKIGGGGVLAGVSIAF*
Ga0137345_103329423300012129SoilAGMEFRFKPVGLYLQYKYLSSKTGDVGKEVNVGGSGILAGVSIIF*
Ga0137353_108028523300012157SoilLVGMEFRFKPVGLYVQYKNLASKTGSTGNEVKVAAAVFLPE*
Ga0137344_105130813300012159SoilTGTASGLAYQGLAGFEIRFKPVGIYVQYKYLASDVGESGREVKVGGSGILAGIRISF*
Ga0137350_103174933300012166SoilGMEFRFKPVGVYVQYKNLSAKTGDTGNEVKVGGSGVFAGVSVSF*
Ga0137319_102324443300012167SoilRFKPVGIYVQYKNLSSETGDTGREVKVGGSGVLAGISISF*
Ga0137327_113590513300012173SoilEIRFKPVGVYVQYKYLASDVGDSGRDVKVGGSGILGGIRISF*
Ga0137388_1192243523300012189Vadose Zone SoilGMEFRFEHVGLLVQYKYLASTTGKSGNDVKVGGGGVLAGVSIAF*
Ga0137399_1075011713300012203Vadose Zone SoilVLVQYKYLASTTGKSGSDVKVGGGGVLAGLSIIF*
Ga0137379_1071337123300012209Vadose Zone SoilRFGPVGLHVQYKHLASTTGKTGKDVKVGGSGVLAGVSIAF*
Ga0137459_115665613300012228SoilSGLAYQGLAGMEFRFKPVGVYVQYKYLSAKPGDTGNEVKVGGSGVFAGVSIGF*
Ga0137435_114062213300012232SoilMEFRFKPVGLYVQYKKLSAKTGDTGREVEVGGSGILAGISITF*
Ga0137385_1040262833300012359Vadose Zone SoilVGLLVQYKYLASTTGKSGSDVKVGGGGVLAGVSIAF*
Ga0137318_103884023300012671SoilASGLAYQGLAGFEIRFKPVGIYVQYKYLASDVGESGREVKVGGSGILAGIRISF*
Ga0137395_1095364513300012917Vadose Zone SoilEPVGLYVQYKHLASTTGKTGKEVKVGGSGVLAGVSIAF*
Ga0137396_1062188123300012918Vadose Zone SoilGGLTGTQGGTAYQGLVGMEFRFGSVGLQVQYKHLASTTGKSGKDVKVGGGGVLAGVSIIF
Ga0137396_1124663823300012918Vadose Zone SoilGGLTGTQGGTAYQGLVGMEFRFGSVGLQVQYKHLASTTGKTGKDVKVGGGGVLAGVSIIF
Ga0137394_1047201623300012922Vadose Zone SoilGGLAYQGLAGMEFRFGPVGLHLQYKYLAATAGKDDKKVKVGGGGVLAGVSFLF*
Ga0137419_1138480613300012925Vadose Zone SoilGLNVQYKHLAATTGKSGNDVKVGGSGVLAGVSIAF*
Ga0075301_102260623300014262Natural And Restored WetlandsFKPVGIYLQYKYLSSETGDSGKKVKVGGSGVLGGISISF*
Ga0075302_102840513300014269Natural And Restored WetlandsQIGFYVQYKYLASTTGDPGKQVKVGGSGIVAGVSLAF*
Ga0075354_114654713300014308Natural And Restored WetlandsMAGVEFRFKPAGIYVQYKNLASKPGSTGDEVKVGGSGVLAGVSI
Ga0180080_101010623300014870SoilYQGLAGMEFRFKPVGLYLQYKYLSSKTGDVGKEVNVGGSGILAGVSIIF*
Ga0180095_104217713300014871SoilFKPVGVYVQYKNLSAKTGDTGKEVKVGGSGVLAGISISF*
Ga0180083_114219113300014875SoilFNRIGVNVQYKYLASTTGENGKEVKVGGGGILAGVSIAF*
Ga0180074_114547813300014877SoilLYVQYKYLASTTGDTGNEVKVGGSGILAGVSIIF*
Ga0180062_111846223300014879SoilYQGLAGMEFRFKPVGIYVQYKNLSAKTGDTGNEVKVGGSGVFAGVSISF*
Ga0180094_106570323300014881SoilFRFKPVGLYVQYKNLASKTGSTGNEVKVGGSGILAGVSIIF*
Ga0180063_117769723300014885SoilGLAIQGLAGMEFRFNRIGVSLQYKYLDATTGDTEEVKVGGSGVLAGVSIAF*
Ga0137411_105007923300015052Vadose Zone SoilVLVQYKYLAATTGKSGNDVKIGGGGVLAGVSIAF*
Ga0180089_103902913300015254SoilFRFKPVGIYVQYKNLSAKTGDTGNEVKVGGSGVFAGVSISF*
Ga0137403_1003141513300015264Vadose Zone SoilAYQGLAGMEFRFGSVGLHLQYKYLAATAGNGDKKVKIGGGGILAGVSFLF*
Ga0184610_107520633300017997Groundwater SedimentAGMEFRFGQVGLYLQYKHLASTTGKSGNDVKVGGGGVLAGVSIAF
Ga0184623_1027912223300018056Groundwater SedimentYQGLAGMEFRFGQVGLYLQYKHLASTTGKSGNDVKVGGGGVLAGVSIAF
Ga0184637_1070005423300018063Groundwater SedimentLAGMEFRFKPVGVYVQYKNLSAKTGDSGKEIKVGGSGFLAGISISF
Ga0184618_1035129613300018071Groundwater SedimentGLVGMEFRFGSVGLQVQYKYLAATTGKSGSDVKVGGSGVLGGVSIIF
Ga0184618_1050254213300018071Groundwater SedimentGLVGMEFRFGSVGLQVQYKYLAATTGKSGSDVKVGGSGVLAGVSIIF
Ga0066662_1079682523300018468Grasslands SoilVGLLVQYKYLASTTGKSGSDVKVGGGGVLAGVSIAF
Ga0066669_1083384813300018482Grasslands SoilMEFRFDQVGVLLQYKHLAATTGKSGNDVKVGGGGVLAGVSIAF
Ga0180106_109128033300019212Groundwater SedimentGLTGDATGLAFQALAGMEFRFNRIGVSLQYRYLDATTGDTEEVKVGGSGILAGVSIAF
Ga0180115_112159123300019257Groundwater SedimentGLTGDATGLAYQGLVGMEFRFKRIGVNLQYKYLSATTGDSGEEVKVGGSGILAGVSIVF
Ga0193725_106326923300019883SoilLAGMEFRFGPVGLHVQYKYLAATAGKSDKEVKVGGSGVLAGVSFLF
Ga0193718_100323013300019999SoilGLVGIEYRFESVGVRVEYRYLAATAGKSGSDVKVGGSGILAGVSFTF
Ga0180108_124535713300020066Groundwater SedimentKPVGIYVQYKYLASDVGDSGREVKVGGSGILAGIRISF
Ga0184649_103686923300020068Groundwater SedimentVGLYVQYKNLASTIGDTGKEVKVGGSGVLAGVSIIF
Ga0210379_1023057413300021081Groundwater SedimentYQGLAGMEFRFKPVGLYLQYKYLASKPGDAGKEINVGGSGVLAGISIIF
Ga0179596_1002485513300021086Vadose Zone SoilAGMEFRFEHVGLLVQYKYLASTTGKSGNDVKVGGGGVLAGVSIAF
Ga0210071_104716113300025955Natural And Restored WetlandsYQGLAGAEFRFKQIGLYLQYKYLSSTTGDPGKEVKIGGTGILAGLSFAF
Ga0210145_104418923300025973Natural And Restored WetlandsGLSAQYKYFTAKTGDSGREVKVGGSGIFGGVSISF
Ga0209647_119879913300026319Grasslands SoilFDRVGLLVQYKHLAATTGKNGNDVKVGGSGVLAGVSIAF
Ga0209470_132507223300026324SoilYQGLVGMEFRFGSVGLQVQYKYLASTTGTTGKEVKVGGSGVLAGVSIIF
Ga0209802_129266023300026328SoilDLKGTAGGAAFQGMAGMEFRFENVGLLVQYKYLASTTGKSGSDVKVGGGGVLAGVSIAF
Ga0209804_111329923300026335SoilFRFDQVGVLFQYKHLAATTGKSGSDVKIGGSGVLAGVSIAF
Ga0209159_108337513300026343SoilGTSGGPAFQGLAGMEFRFGSVGLNVQYKYLASTTGKTGSDVKVGGRGVLAGVSIAF
Ga0209179_107390213300027512Vadose Zone SoilYQGLAGMEFRFGSVGLHLQYKYLAATAGKSDKQVKLGGGGVLAGVSFLF
Ga0208990_115266923300027663Forest SoilAGMEFRFEHVGVLVQYKYLASTTGKSGSDVKVGGGGVLAGLSIIF
Ga0209180_1028239513300027846Vadose Zone SoilFRFEPVGLYVQYKHLASTTGKTGKEVKVGGSGVLAGVSIAF
Ga0209701_1011192643300027862Vadose Zone SoilGLTGNATGPAFQGLAGMEFRFSHIGLNVQYRYLDSTTGGNGKDVKVGGSGILAGVSIVF
Ga0209590_1030326323300027882Vadose Zone SoilEFRFGSVGLQVQYKHLAATTGKSGSDVKVGGSGVLAGVSIIF
Ga0307299_1016734013300028793SoilGMEFRFGQVGLYLQYKHLASTTGKSGNDVKVGGGGVLAGVSIAF
Ga0307471_10274556613300032180Hardwood Forest SoilAYQGLVGIEYRFESVGLRVEYKYFAATAGKSGSEVKVGGSGILAGVSIAF
Ga0307471_10415242223300032180Hardwood Forest SoilFRFDRVGVQVQYKHLTATTGKSGNQVKIGGGGVLAGVSIAF
Ga0364928_0002974_2679_27923300033813SedimentQIGVNVQYKYLDSSTGDTGKEVKVGGSGILAGVSIIF
Ga0364928_0041945_3_1613300033813SedimentGLAYQGLAGMEFRFKPVGLYVQYKNLVSKTGATGTDVKVGGSGVLAGVSISF
Ga0364930_0080444_3_1553300033814SedimentAYQGLAGMEFRFKPVGLYLQYKYLSSKTGDTGNEVKVGGSGVLAGVSITF
Ga0364930_0261308_452_5833300033814SedimentMEFRFKPVGLYVQYKNLASKTGSTGNEVKVGGSGILAGVSISF
Ga0364938_004271_1656_17723300034114SedimentKPVGIYVQYKNLSAKTGDTGNEVKVGGSGVFAGVSISF
Ga0364931_0168198_561_6923300034176SedimentVEFRFKPVGVYVQYKNLSAKTGDTGKEVKVGGSGFLAGISISF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.