| Basic Information | |
|---|---|
| Family ID | F098123 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MEFRFGSVGLQVQYKYLAATTGTTGKEVKVGGSGVLAGVSIIF |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.96 % |
| % of genes near scaffold ends (potentially truncated) | 99.04 % |
| % of genes from short scaffolds (< 2000 bps) | 94.23 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.038 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (35.577 % of family members) |
| Environment Ontology (ENVO) | Unclassified (64.423 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (47.115 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.13% β-sheet: 0.00% Coil/Unstructured: 78.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 32.69 |
| PF01050 | MannoseP_isomer | 10.58 |
| PF00255 | GSHPx | 9.62 |
| PF00483 | NTP_transferase | 4.81 |
| PF04143 | Sulf_transp | 1.92 |
| PF04892 | VanZ | 0.96 |
| PF06283 | ThuA | 0.96 |
| PF01370 | Epimerase | 0.96 |
| PF01527 | HTH_Tnp_1 | 0.96 |
| PF02834 | LigT_PEase | 0.96 |
| PF13505 | OMP_b-brl | 0.96 |
| PF02543 | Carbam_trans_N | 0.96 |
| PF13683 | rve_3 | 0.96 |
| PF01381 | HTH_3 | 0.96 |
| PF00749 | tRNA-synt_1c | 0.96 |
| PF03737 | RraA-like | 0.96 |
| PF16868 | NMT1_3 | 0.96 |
| PF01384 | PHO4 | 0.96 |
| PF00501 | AMP-binding | 0.96 |
| PF00072 | Response_reg | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 32.69 |
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 9.62 |
| COG2391 | Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains | General function prediction only [R] | 1.92 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 0.96 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG1514 | RNA 2',3'-cyclic phosphodiesterase (2'-5' RNA ligase) | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 0.96 |
| COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.04 % |
| Unclassified | root | N/A | 25.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005172|Ga0066683_10272570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 1051 | Open in IMG/M |
| 3300005175|Ga0066673_10904194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300005176|Ga0066679_10929372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 546 | Open in IMG/M |
| 3300005574|Ga0066694_10038585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2149 | Open in IMG/M |
| 3300005764|Ga0066903_108348846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 529 | Open in IMG/M |
| 3300005880|Ga0075298_1006736 | Not Available | 889 | Open in IMG/M |
| 3300006163|Ga0070715_10389569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300006794|Ga0066658_10118521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 1287 | Open in IMG/M |
| 3300007258|Ga0099793_10229134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 894 | Open in IMG/M |
| 3300009088|Ga0099830_10063401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2653 | Open in IMG/M |
| 3300009090|Ga0099827_10482087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 1065 | Open in IMG/M |
| 3300009090|Ga0099827_10690627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 882 | Open in IMG/M |
| 3300009137|Ga0066709_101302192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 1065 | Open in IMG/M |
| 3300009143|Ga0099792_10251569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 1029 | Open in IMG/M |
| 3300009148|Ga0105243_11762389 | Not Available | 649 | Open in IMG/M |
| 3300009609|Ga0105347_1118356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_64_14 | 1013 | Open in IMG/M |
| 3300009610|Ga0105340_1560551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 510 | Open in IMG/M |
| 3300011397|Ga0137444_1006972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1415 | Open in IMG/M |
| 3300011408|Ga0137460_1006267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1550 | Open in IMG/M |
| 3300011408|Ga0137460_1104111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300011410|Ga0137440_1039978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 875 | Open in IMG/M |
| 3300011419|Ga0137446_1120558 | Not Available | 630 | Open in IMG/M |
| 3300011429|Ga0137455_1050653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1172 | Open in IMG/M |
| 3300011429|Ga0137455_1060175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1081 | Open in IMG/M |
| 3300011430|Ga0137423_1264523 | Not Available | 507 | Open in IMG/M |
| 3300011433|Ga0137443_1112811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. | 788 | Open in IMG/M |
| 3300011433|Ga0137443_1225205 | Not Available | 559 | Open in IMG/M |
| 3300011437|Ga0137429_1039474 | Not Available | 1369 | Open in IMG/M |
| 3300011441|Ga0137452_1027861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1755 | Open in IMG/M |
| 3300011441|Ga0137452_1091216 | Not Available | 997 | Open in IMG/M |
| 3300011441|Ga0137452_1129540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_64_14 | 843 | Open in IMG/M |
| 3300011442|Ga0137437_1152345 | Not Available | 800 | Open in IMG/M |
| 3300011445|Ga0137427_10188898 | Not Available | 855 | Open in IMG/M |
| 3300011445|Ga0137427_10262611 | Not Available | 723 | Open in IMG/M |
| 3300012040|Ga0137461_1106703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. | 804 | Open in IMG/M |
| 3300012096|Ga0137389_10512954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 1029 | Open in IMG/M |
| 3300012096|Ga0137389_10726447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 853 | Open in IMG/M |
| 3300012129|Ga0137345_1033294 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 651 | Open in IMG/M |
| 3300012157|Ga0137353_1080285 | Not Available | 607 | Open in IMG/M |
| 3300012159|Ga0137344_1051308 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300012166|Ga0137350_1031749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1003 | Open in IMG/M |
| 3300012167|Ga0137319_1023244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1251 | Open in IMG/M |
| 3300012173|Ga0137327_1135905 | Not Available | 540 | Open in IMG/M |
| 3300012189|Ga0137388_11922435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300012203|Ga0137399_10750117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 822 | Open in IMG/M |
| 3300012209|Ga0137379_10713371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 908 | Open in IMG/M |
| 3300012228|Ga0137459_1156656 | Not Available | 670 | Open in IMG/M |
| 3300012232|Ga0137435_1140622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 735 | Open in IMG/M |
| 3300012359|Ga0137385_10402628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1167 | Open in IMG/M |
| 3300012671|Ga0137318_1038840 | Not Available | 502 | Open in IMG/M |
| 3300012917|Ga0137395_10953645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 617 | Open in IMG/M |
| 3300012918|Ga0137396_10621881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 798 | Open in IMG/M |
| 3300012918|Ga0137396_11246638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300012922|Ga0137394_10472016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1067 | Open in IMG/M |
| 3300012925|Ga0137419_11384806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 593 | Open in IMG/M |
| 3300014262|Ga0075301_1022606 | Not Available | 1070 | Open in IMG/M |
| 3300014269|Ga0075302_1028405 | Not Available | 1040 | Open in IMG/M |
| 3300014308|Ga0075354_1146547 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300014870|Ga0180080_1010106 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300014871|Ga0180095_1042177 | Not Available | 791 | Open in IMG/M |
| 3300014875|Ga0180083_1142191 | Not Available | 530 | Open in IMG/M |
| 3300014877|Ga0180074_1145478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300014879|Ga0180062_1118462 | Not Available | 607 | Open in IMG/M |
| 3300014881|Ga0180094_1065703 | Not Available | 795 | Open in IMG/M |
| 3300014885|Ga0180063_1177697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → unclassified Rhodocyclaceae → Rhodocyclaceae bacterium | 680 | Open in IMG/M |
| 3300015052|Ga0137411_1050079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 1272 | Open in IMG/M |
| 3300015254|Ga0180089_1039029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 915 | Open in IMG/M |
| 3300015264|Ga0137403_10031415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5613 | Open in IMG/M |
| 3300017997|Ga0184610_1075206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1039 | Open in IMG/M |
| 3300018056|Ga0184623_10279122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 759 | Open in IMG/M |
| 3300018063|Ga0184637_10700054 | Not Available | 554 | Open in IMG/M |
| 3300018071|Ga0184618_10351296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 628 | Open in IMG/M |
| 3300018071|Ga0184618_10502542 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300018468|Ga0066662_10796825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 916 | Open in IMG/M |
| 3300018482|Ga0066669_10833848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 819 | Open in IMG/M |
| 3300019212|Ga0180106_1091280 | Not Available | 597 | Open in IMG/M |
| 3300019257|Ga0180115_1121591 | Not Available | 542 | Open in IMG/M |
| 3300019883|Ga0193725_1063269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 924 | Open in IMG/M |
| 3300019999|Ga0193718_1003230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3467 | Open in IMG/M |
| 3300020066|Ga0180108_1245357 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300020068|Ga0184649_1036869 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300021081|Ga0210379_10230574 | Not Available | 801 | Open in IMG/M |
| 3300021086|Ga0179596_10024855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2229 | Open in IMG/M |
| 3300025955|Ga0210071_1047161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium plurifarium | 550 | Open in IMG/M |
| 3300025973|Ga0210145_1044189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas cichorii | 522 | Open in IMG/M |
| 3300026319|Ga0209647_1198799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 704 | Open in IMG/M |
| 3300026324|Ga0209470_1325072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 559 | Open in IMG/M |
| 3300026328|Ga0209802_1292660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300026335|Ga0209804_1113299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 1236 | Open in IMG/M |
| 3300026343|Ga0209159_1083375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 1433 | Open in IMG/M |
| 3300027512|Ga0209179_1073902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 748 | Open in IMG/M |
| 3300027663|Ga0208990_1152669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300027846|Ga0209180_10282395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 953 | Open in IMG/M |
| 3300027862|Ga0209701_10111926 | Not Available | 1697 | Open in IMG/M |
| 3300027882|Ga0209590_10303263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 1026 | Open in IMG/M |
| 3300028793|Ga0307299_10167340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 827 | Open in IMG/M |
| 3300032180|Ga0307471_102745566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300032180|Ga0307471_104152422 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300033813|Ga0364928_0002974 | All Organisms → cellular organisms → Bacteria | 2794 | Open in IMG/M |
| 3300033813|Ga0364928_0041945 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 986 | Open in IMG/M |
| 3300033814|Ga0364930_0080444 | Not Available | 1112 | Open in IMG/M |
| 3300033814|Ga0364930_0261308 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300034114|Ga0364938_004271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1773 | Open in IMG/M |
| 3300034176|Ga0364931_0168198 | Not Available | 710 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 35.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.69% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 5.77% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 4.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.88% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005880 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300011397 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2 | Environmental | Open in IMG/M |
| 3300011408 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT723_2 | Environmental | Open in IMG/M |
| 3300011410 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2 | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012129 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT530_2 | Environmental | Open in IMG/M |
| 3300012157 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2 | Environmental | Open in IMG/M |
| 3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
| 3300012166 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2 | Environmental | Open in IMG/M |
| 3300012167 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT333_2 | Environmental | Open in IMG/M |
| 3300012173 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012671 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT300_2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
| 3300014871 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1Da | Environmental | Open in IMG/M |
| 3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300014879 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D | Environmental | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019212 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019257 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020066 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT45_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020068 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025955 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025973 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034114 | Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066683_102725702 | 3300005172 | Soil | GMEFRFGSVGLQVQYKYLAATTGTTSKEVKVGGSGVLAGVSIIF* |
| Ga0066673_109041942 | 3300005175 | Soil | GGPAFQGLAGMEFRFGSVGLNVQYKYLASTTGKTGSDVKVGGRGVLAGVSIAF* |
| Ga0066679_109293721 | 3300005176 | Soil | YQGLVGMEFRFGSVGLQVQYKYLAATTGTTGKEVKVGGSGVLAGVSIIF* |
| Ga0066694_100385854 | 3300005574 | Soil | PAFQGLAGMEFRFGSVGLNVQYKYLASTTGKTGSDVKVGGRGVLAGVSIAF* |
| Ga0066903_1083488461 | 3300005764 | Tropical Forest Soil | DFRFSDVVGLYVEYKYLGATTADKGGQTVKAGGSGILAGISIVF* |
| Ga0075298_10067361 | 3300005880 | Rice Paddy Soil | AGAEFRFRQVGFQVQYKYLGSTTGNPGKEVKIGGRGILAGVSFAF* |
| Ga0070715_103895691 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | KGTAGGAAFQGLAGLEFRFDRVGLLVQYKYLAATTGKNGNDVKVGGSGVLAGVSIAF* |
| Ga0066658_101185211 | 3300006794 | Soil | MEFRFGSVGLQVQYKYLAATTGTTGKEVKVGGSGVLAGVSIIF* |
| Ga0099793_102291342 | 3300007258 | Vadose Zone Soil | GMEFRFGSVGLQVQYKYLSSTTGKSGKDVKVGGGGVLAGVSIIF* |
| Ga0099830_100634011 | 3300009088 | Vadose Zone Soil | GLTGNATGPAFQGLAGMEFRFSHIGLNVQYRYLDSTTGGNGKDVKVGGSGILAGVSIVF* |
| Ga0099827_104820871 | 3300009090 | Vadose Zone Soil | TQGGTAYQGLVGMEFRFGSVGLQVQYKHLASTTGKSGKDVKVGGSGVLAGVSIIF* |
| Ga0099827_106906271 | 3300009090 | Vadose Zone Soil | AAGAAFQGLAGLEFRFDRVGLLVQYKYLAATTGKNGNDVKVGGSGVLAGVSIAF* |
| Ga0066709_1013021921 | 3300009137 | Grasslands Soil | GMEFRFDQVGVLLQYKHLAATTGKSGSDVKIGGSGVLAGISIAF* |
| Ga0099792_102515691 | 3300009143 | Vadose Zone Soil | GTAYQGLVGMEFRFGSVGLQVQYKHLAATTGKSGSDVKVGGSGVLAGVSIIF* |
| Ga0105243_117623891 | 3300009148 | Miscanthus Rhizosphere | RIGISVQYKYLDATTGDSDRELKVGGSGILAGVSIAF* |
| Ga0105347_11183562 | 3300009609 | Soil | AYQGMAGMEFRFGRVGLQLQYKYLAAAAGGSGKDLKVGGSGVLAGVSVAF* |
| Ga0105340_15605512 | 3300009610 | Soil | LAGMEFRFKPVGLYLQYKYLSSKTGDVGKEVNVGGSGILAGVSIIF* |
| Ga0137444_10069723 | 3300011397 | Soil | MEFRFKPVGVYVQYKYLSAKTGDTGNEVKVGGSGVLAGVSISF* |
| Ga0137460_10062672 | 3300011408 | Soil | GLAYQGMAGMEFRFKPVGLYVQYKNLASKWITGDAGREVKVGGSGILAGVSISF* |
| Ga0137460_11041111 | 3300011408 | Soil | KPVGLYVQYKYLAATTGDTGNEVKVGGSGILAGVSILF* |
| Ga0137440_10399782 | 3300011410 | Soil | YQGLAGLELRFKPVGLYVQYKYLAATTGDTGNEVKVGGSGILAGVSIIF* |
| Ga0137446_11205581 | 3300011419 | Soil | YQGLAGMEFRFKPVGVYVQYKNLSAKTGDTGNEVKVGGSGVFAGVSVSF* |
| Ga0137455_10506531 | 3300011429 | Soil | ATGLAFQGLAGMEFRIKPVGIYLQYKNLSAKTGDSGKEIKVGGSGFLAGISISF* |
| Ga0137455_10601753 | 3300011429 | Soil | FRFKSVGLYVQYKNLASKTGDAGKEVKVGGSGILAGVSIAF* |
| Ga0137423_12645232 | 3300011430 | Soil | TGTASGLAYQGLAGFEIRFKPVGVYVQYKYLASDVGDSGREVKVGGSGILAGIRISF* |
| Ga0137443_11128111 | 3300011433 | Soil | TATGLAYQGLVGMEFRFKQIGVNLQYKYLSATTGDSGEEVKVGGSGILAGVSISF* |
| Ga0137443_12252051 | 3300011433 | Soil | GMEFRFKPVGVYVQYKNLSAKTGDSGNEVKVGGSGVFAGVSIGF* |
| Ga0137429_10394742 | 3300011437 | Soil | ASGLAYQGLAGFEIRFKPVGVYVQYKYLASDVGDSGREVKVGGSGILAGIRISF* |
| Ga0137452_10278611 | 3300011441 | Soil | RGLAYQGLVGMEFRFKPVGPYVQYKYVASTTGDTSNEVKVGGSGILAGVSIVF* |
| Ga0137452_10912161 | 3300011441 | Soil | EFRFNRIGVSLQYKYLDATTGDTEKVKVGGSGILAGVSIAF* |
| Ga0137452_11295402 | 3300011441 | Soil | YQGMAGMEFRFGPVGLQVQYKYLAATTGSSGKDTKVGGSGVLAGVSVAF* |
| Ga0137437_11523451 | 3300011442 | Soil | QGLAGMEFRIKPVGLYVQYKYLSPKPGDAGREVKVGGSGVLAGISISF* |
| Ga0137427_101888981 | 3300011445 | Soil | GMEFRFKPVGLYVQYKKLFAKTGDTGREVEVGGSGILAGISITF* |
| Ga0137427_102626112 | 3300011445 | Soil | RFNRIGINVQYKYLDATTGSSSKEVKVGGSGILAGVSFAF* |
| Ga0137461_11067032 | 3300012040 | Soil | VAYQGLAGMEFRFKPVGLYVQYKNFDSKWITGDTGKEVKVGGSGIFAGVSISF* |
| Ga0137389_105129542 | 3300012096 | Vadose Zone Soil | GLVGMEFRFGSVGLQVQYKYLAATTGKSGSDGKVGGSGVLAGVSIIF* |
| Ga0137389_107264472 | 3300012096 | Vadose Zone Soil | FQGMAGMEFRFGSVGLNVQYKYLAATTGKSGNDVKIGGGGVLAGVSIAF* |
| Ga0137345_10332942 | 3300012129 | Soil | AGMEFRFKPVGLYLQYKYLSSKTGDVGKEVNVGGSGILAGVSIIF* |
| Ga0137353_10802852 | 3300012157 | Soil | LVGMEFRFKPVGLYVQYKNLASKTGSTGNEVKVAAAVFLPE* |
| Ga0137344_10513081 | 3300012159 | Soil | TGTASGLAYQGLAGFEIRFKPVGIYVQYKYLASDVGESGREVKVGGSGILAGIRISF* |
| Ga0137350_10317493 | 3300012166 | Soil | GMEFRFKPVGVYVQYKNLSAKTGDTGNEVKVGGSGVFAGVSVSF* |
| Ga0137319_10232444 | 3300012167 | Soil | RFKPVGIYVQYKNLSSETGDTGREVKVGGSGVLAGISISF* |
| Ga0137327_11359051 | 3300012173 | Soil | EIRFKPVGVYVQYKYLASDVGDSGRDVKVGGSGILGGIRISF* |
| Ga0137388_119224352 | 3300012189 | Vadose Zone Soil | GMEFRFEHVGLLVQYKYLASTTGKSGNDVKVGGGGVLAGVSIAF* |
| Ga0137399_107501171 | 3300012203 | Vadose Zone Soil | VLVQYKYLASTTGKSGSDVKVGGGGVLAGLSIIF* |
| Ga0137379_107133712 | 3300012209 | Vadose Zone Soil | RFGPVGLHVQYKHLASTTGKTGKDVKVGGSGVLAGVSIAF* |
| Ga0137459_11566561 | 3300012228 | Soil | SGLAYQGLAGMEFRFKPVGVYVQYKYLSAKPGDTGNEVKVGGSGVFAGVSIGF* |
| Ga0137435_11406221 | 3300012232 | Soil | MEFRFKPVGLYVQYKKLSAKTGDTGREVEVGGSGILAGISITF* |
| Ga0137385_104026283 | 3300012359 | Vadose Zone Soil | VGLLVQYKYLASTTGKSGSDVKVGGGGVLAGVSIAF* |
| Ga0137318_10388402 | 3300012671 | Soil | ASGLAYQGLAGFEIRFKPVGIYVQYKYLASDVGESGREVKVGGSGILAGIRISF* |
| Ga0137395_109536451 | 3300012917 | Vadose Zone Soil | EPVGLYVQYKHLASTTGKTGKEVKVGGSGVLAGVSIAF* |
| Ga0137396_106218812 | 3300012918 | Vadose Zone Soil | GGLTGTQGGTAYQGLVGMEFRFGSVGLQVQYKHLASTTGKSGKDVKVGGGGVLAGVSIIF |
| Ga0137396_112466382 | 3300012918 | Vadose Zone Soil | GGLTGTQGGTAYQGLVGMEFRFGSVGLQVQYKHLASTTGKTGKDVKVGGGGVLAGVSIIF |
| Ga0137394_104720162 | 3300012922 | Vadose Zone Soil | GGLAYQGLAGMEFRFGPVGLHLQYKYLAATAGKDDKKVKVGGGGVLAGVSFLF* |
| Ga0137419_113848061 | 3300012925 | Vadose Zone Soil | GLNVQYKHLAATTGKSGNDVKVGGSGVLAGVSIAF* |
| Ga0075301_10226062 | 3300014262 | Natural And Restored Wetlands | FKPVGIYLQYKYLSSETGDSGKKVKVGGSGVLGGISISF* |
| Ga0075302_10284051 | 3300014269 | Natural And Restored Wetlands | QIGFYVQYKYLASTTGDPGKQVKVGGSGIVAGVSLAF* |
| Ga0075354_11465471 | 3300014308 | Natural And Restored Wetlands | MAGVEFRFKPAGIYVQYKNLASKPGSTGDEVKVGGSGVLAGVSI |
| Ga0180080_10101062 | 3300014870 | Soil | YQGLAGMEFRFKPVGLYLQYKYLSSKTGDVGKEVNVGGSGILAGVSIIF* |
| Ga0180095_10421771 | 3300014871 | Soil | FKPVGVYVQYKNLSAKTGDTGKEVKVGGSGVLAGISISF* |
| Ga0180083_11421911 | 3300014875 | Soil | FNRIGVNVQYKYLASTTGENGKEVKVGGGGILAGVSIAF* |
| Ga0180074_11454781 | 3300014877 | Soil | LYVQYKYLASTTGDTGNEVKVGGSGILAGVSIIF* |
| Ga0180062_11184622 | 3300014879 | Soil | YQGLAGMEFRFKPVGIYVQYKNLSAKTGDTGNEVKVGGSGVFAGVSISF* |
| Ga0180094_10657032 | 3300014881 | Soil | FRFKPVGLYVQYKNLASKTGSTGNEVKVGGSGILAGVSIIF* |
| Ga0180063_11776972 | 3300014885 | Soil | GLAIQGLAGMEFRFNRIGVSLQYKYLDATTGDTEEVKVGGSGVLAGVSIAF* |
| Ga0137411_10500792 | 3300015052 | Vadose Zone Soil | VLVQYKYLAATTGKSGNDVKIGGGGVLAGVSIAF* |
| Ga0180089_10390291 | 3300015254 | Soil | FRFKPVGIYVQYKNLSAKTGDTGNEVKVGGSGVFAGVSISF* |
| Ga0137403_100314151 | 3300015264 | Vadose Zone Soil | AYQGLAGMEFRFGSVGLHLQYKYLAATAGNGDKKVKIGGGGILAGVSFLF* |
| Ga0184610_10752063 | 3300017997 | Groundwater Sediment | AGMEFRFGQVGLYLQYKHLASTTGKSGNDVKVGGGGVLAGVSIAF |
| Ga0184623_102791222 | 3300018056 | Groundwater Sediment | YQGLAGMEFRFGQVGLYLQYKHLASTTGKSGNDVKVGGGGVLAGVSIAF |
| Ga0184637_107000542 | 3300018063 | Groundwater Sediment | LAGMEFRFKPVGVYVQYKNLSAKTGDSGKEIKVGGSGFLAGISISF |
| Ga0184618_103512961 | 3300018071 | Groundwater Sediment | GLVGMEFRFGSVGLQVQYKYLAATTGKSGSDVKVGGSGVLGGVSIIF |
| Ga0184618_105025421 | 3300018071 | Groundwater Sediment | GLVGMEFRFGSVGLQVQYKYLAATTGKSGSDVKVGGSGVLAGVSIIF |
| Ga0066662_107968252 | 3300018468 | Grasslands Soil | VGLLVQYKYLASTTGKSGSDVKVGGGGVLAGVSIAF |
| Ga0066669_108338481 | 3300018482 | Grasslands Soil | MEFRFDQVGVLLQYKHLAATTGKSGNDVKVGGGGVLAGVSIAF |
| Ga0180106_10912803 | 3300019212 | Groundwater Sediment | GLTGDATGLAFQALAGMEFRFNRIGVSLQYRYLDATTGDTEEVKVGGSGILAGVSIAF |
| Ga0180115_11215912 | 3300019257 | Groundwater Sediment | GLTGDATGLAYQGLVGMEFRFKRIGVNLQYKYLSATTGDSGEEVKVGGSGILAGVSIVF |
| Ga0193725_10632692 | 3300019883 | Soil | LAGMEFRFGPVGLHVQYKYLAATAGKSDKEVKVGGSGVLAGVSFLF |
| Ga0193718_10032301 | 3300019999 | Soil | GLVGIEYRFESVGVRVEYRYLAATAGKSGSDVKVGGSGILAGVSFTF |
| Ga0180108_12453571 | 3300020066 | Groundwater Sediment | KPVGIYVQYKYLASDVGDSGREVKVGGSGILAGIRISF |
| Ga0184649_10368692 | 3300020068 | Groundwater Sediment | VGLYVQYKNLASTIGDTGKEVKVGGSGVLAGVSIIF |
| Ga0210379_102305741 | 3300021081 | Groundwater Sediment | YQGLAGMEFRFKPVGLYLQYKYLASKPGDAGKEINVGGSGVLAGISIIF |
| Ga0179596_100248551 | 3300021086 | Vadose Zone Soil | AGMEFRFEHVGLLVQYKYLASTTGKSGNDVKVGGGGVLAGVSIAF |
| Ga0210071_10471611 | 3300025955 | Natural And Restored Wetlands | YQGLAGAEFRFKQIGLYLQYKYLSSTTGDPGKEVKIGGTGILAGLSFAF |
| Ga0210145_10441892 | 3300025973 | Natural And Restored Wetlands | GLSAQYKYFTAKTGDSGREVKVGGSGIFGGVSISF |
| Ga0209647_11987991 | 3300026319 | Grasslands Soil | FDRVGLLVQYKHLAATTGKNGNDVKVGGSGVLAGVSIAF |
| Ga0209470_13250722 | 3300026324 | Soil | YQGLVGMEFRFGSVGLQVQYKYLASTTGTTGKEVKVGGSGVLAGVSIIF |
| Ga0209802_12926602 | 3300026328 | Soil | DLKGTAGGAAFQGMAGMEFRFENVGLLVQYKYLASTTGKSGSDVKVGGGGVLAGVSIAF |
| Ga0209804_11132992 | 3300026335 | Soil | FRFDQVGVLFQYKHLAATTGKSGSDVKIGGSGVLAGVSIAF |
| Ga0209159_10833751 | 3300026343 | Soil | GTSGGPAFQGLAGMEFRFGSVGLNVQYKYLASTTGKTGSDVKVGGRGVLAGVSIAF |
| Ga0209179_10739021 | 3300027512 | Vadose Zone Soil | YQGLAGMEFRFGSVGLHLQYKYLAATAGKSDKQVKLGGGGVLAGVSFLF |
| Ga0208990_11526692 | 3300027663 | Forest Soil | AGMEFRFEHVGVLVQYKYLASTTGKSGSDVKVGGGGVLAGLSIIF |
| Ga0209180_102823951 | 3300027846 | Vadose Zone Soil | FRFEPVGLYVQYKHLASTTGKTGKEVKVGGSGVLAGVSIAF |
| Ga0209701_101119264 | 3300027862 | Vadose Zone Soil | GLTGNATGPAFQGLAGMEFRFSHIGLNVQYRYLDSTTGGNGKDVKVGGSGILAGVSIVF |
| Ga0209590_103032632 | 3300027882 | Vadose Zone Soil | EFRFGSVGLQVQYKHLAATTGKSGSDVKVGGSGVLAGVSIIF |
| Ga0307299_101673401 | 3300028793 | Soil | GMEFRFGQVGLYLQYKHLASTTGKSGNDVKVGGGGVLAGVSIAF |
| Ga0307471_1027455661 | 3300032180 | Hardwood Forest Soil | AYQGLVGIEYRFESVGLRVEYKYFAATAGKSGSEVKVGGSGILAGVSIAF |
| Ga0307471_1041524222 | 3300032180 | Hardwood Forest Soil | FRFDRVGVQVQYKHLTATTGKSGNQVKIGGGGVLAGVSIAF |
| Ga0364928_0002974_2679_2792 | 3300033813 | Sediment | QIGVNVQYKYLDSSTGDTGKEVKVGGSGILAGVSIIF |
| Ga0364928_0041945_3_161 | 3300033813 | Sediment | GLAYQGLAGMEFRFKPVGLYVQYKNLVSKTGATGTDVKVGGSGVLAGVSISF |
| Ga0364930_0080444_3_155 | 3300033814 | Sediment | AYQGLAGMEFRFKPVGLYLQYKYLSSKTGDTGNEVKVGGSGVLAGVSITF |
| Ga0364930_0261308_452_583 | 3300033814 | Sediment | MEFRFKPVGLYVQYKNLASKTGSTGNEVKVGGSGILAGVSISF |
| Ga0364938_004271_1656_1772 | 3300034114 | Sediment | KPVGIYVQYKNLSAKTGDTGNEVKVGGSGVFAGVSISF |
| Ga0364931_0168198_561_692 | 3300034176 | Sediment | VEFRFKPVGVYVQYKNLSAKTGDTGKEVKVGGSGFLAGISISF |
| ⦗Top⦘ |