| Basic Information | |
|---|---|
| Family ID | F098118 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 38 residues |
| Representative Sequence | QSLFPDQFDELMRQVRQIAAVVGRTVPGIGVRETVGVSK |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.08 % |
| % of genes from short scaffolds (< 2000 bps) | 82.69 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.885 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.577 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.192 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.885 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.87% β-sheet: 0.00% Coil/Unstructured: 73.13% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF03544 | TonB_C | 27.88 |
| PF10282 | Lactonase | 8.65 |
| PF13103 | TonB_2 | 7.69 |
| PF02604 | PhdYeFM_antitox | 4.81 |
| PF02239 | Cytochrom_D1 | 3.85 |
| PF01850 | PIN | 2.88 |
| PF01565 | FAD_binding_4 | 1.92 |
| PF06491 | Disulph_isomer | 1.92 |
| PF00589 | Phage_integrase | 0.96 |
| PF00202 | Aminotran_3 | 0.96 |
| PF00762 | Ferrochelatase | 0.96 |
| PF13432 | TPR_16 | 0.96 |
| PF02321 | OEP | 0.96 |
| PF10150 | RNase_E_G | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 27.88 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 4.81 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 4.81 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG0276 | Protoheme ferro-lyase (ferrochelatase) | Coenzyme transport and metabolism [H] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.85 % |
| Unclassified | root | N/A | 21.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10048912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2546 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100226190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1762 | Open in IMG/M |
| 3300004080|Ga0062385_10260454 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 972 | Open in IMG/M |
| 3300004092|Ga0062389_100600973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1264 | Open in IMG/M |
| 3300005532|Ga0070739_10051050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2685 | Open in IMG/M |
| 3300005537|Ga0070730_10318088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1017 | Open in IMG/M |
| 3300005538|Ga0070731_10049710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2795 | Open in IMG/M |
| 3300005538|Ga0070731_10440494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 867 | Open in IMG/M |
| 3300005576|Ga0066708_10311674 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300005587|Ga0066654_10581839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300005602|Ga0070762_10436948 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300005712|Ga0070764_10583353 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005921|Ga0070766_10385790 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300006050|Ga0075028_100408039 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300006163|Ga0070715_10443387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 731 | Open in IMG/M |
| 3300006173|Ga0070716_101145472 | Not Available | 622 | Open in IMG/M |
| 3300006796|Ga0066665_10036954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3263 | Open in IMG/M |
| 3300006800|Ga0066660_10359158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1186 | Open in IMG/M |
| 3300006893|Ga0073928_11096094 | Not Available | 539 | Open in IMG/M |
| 3300007982|Ga0102924_1036042 | All Organisms → cellular organisms → Bacteria | 3153 | Open in IMG/M |
| 3300009038|Ga0099829_10107531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2178 | Open in IMG/M |
| 3300009524|Ga0116225_1059510 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
| 3300009525|Ga0116220_10231772 | Not Available | 804 | Open in IMG/M |
| 3300009700|Ga0116217_10028856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4254 | Open in IMG/M |
| 3300009759|Ga0116101_1090095 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300010359|Ga0126376_12065623 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300010360|Ga0126372_12507713 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300010361|Ga0126378_11341852 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300010375|Ga0105239_12274681 | Not Available | 631 | Open in IMG/M |
| 3300010376|Ga0126381_100472600 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
| 3300010398|Ga0126383_12755218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300010859|Ga0126352_1051382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300011090|Ga0138579_1054916 | Not Available | 530 | Open in IMG/M |
| 3300012189|Ga0137388_10095289 | All Organisms → cellular organisms → Bacteria | 2544 | Open in IMG/M |
| 3300012202|Ga0137363_10773230 | Not Available | 814 | Open in IMG/M |
| 3300012363|Ga0137390_10463448 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300012683|Ga0137398_10552045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300014167|Ga0181528_10796982 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300014169|Ga0181531_10790881 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300014169|Ga0181531_10991607 | Not Available | 527 | Open in IMG/M |
| 3300014201|Ga0181537_10166288 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300014489|Ga0182018_10597824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300014489|Ga0182018_10634866 | Not Available | 559 | Open in IMG/M |
| 3300014654|Ga0181525_10333116 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300015245|Ga0137409_11172960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300015265|Ga0182005_1132028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300015265|Ga0182005_1268529 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300017659|Ga0134083_10552814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300017924|Ga0187820_1240803 | Not Available | 578 | Open in IMG/M |
| 3300017928|Ga0187806_1130217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
| 3300017936|Ga0187821_10482715 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300017943|Ga0187819_10029328 | All Organisms → cellular organisms → Bacteria | 3241 | Open in IMG/M |
| 3300017961|Ga0187778_11252239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300017973|Ga0187780_10200701 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300017975|Ga0187782_10100201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2133 | Open in IMG/M |
| 3300017999|Ga0187767_10008373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1957 | Open in IMG/M |
| 3300018043|Ga0187887_10018566 | All Organisms → cellular organisms → Bacteria | 4517 | Open in IMG/M |
| 3300018060|Ga0187765_10186667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1191 | Open in IMG/M |
| 3300018090|Ga0187770_10311040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1227 | Open in IMG/M |
| 3300020580|Ga0210403_10171608 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
| 3300020583|Ga0210401_10014326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7678 | Open in IMG/M |
| 3300020583|Ga0210401_11138870 | Not Available | 639 | Open in IMG/M |
| 3300021170|Ga0210400_10751701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300021181|Ga0210388_10263315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1513 | Open in IMG/M |
| 3300021403|Ga0210397_11120649 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300021403|Ga0210397_11504806 | Not Available | 522 | Open in IMG/M |
| 3300021405|Ga0210387_11604271 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300021477|Ga0210398_10070332 | All Organisms → cellular organisms → Bacteria | 2848 | Open in IMG/M |
| 3300022557|Ga0212123_10194641 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300022717|Ga0242661_1104698 | Not Available | 595 | Open in IMG/M |
| 3300022722|Ga0242657_1143826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300022873|Ga0224550_1025541 | Not Available | 837 | Open in IMG/M |
| 3300026078|Ga0207702_10921232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300027326|Ga0209731_1058985 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. CCMP2456 | 587 | Open in IMG/M |
| 3300027674|Ga0209118_1184319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300027853|Ga0209274_10010080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4255 | Open in IMG/M |
| 3300027869|Ga0209579_10340292 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300027903|Ga0209488_10708506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300028047|Ga0209526_10163063 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300028047|Ga0209526_10756824 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300028776|Ga0302303_10303209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300029917|Ga0311326_10488913 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300029951|Ga0311371_11862854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300030007|Ga0311338_10971085 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300030503|Ga0311370_10142180 | All Organisms → cellular organisms → Bacteria | 3320 | Open in IMG/M |
| 3300030813|Ga0265750_1005452 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300030815|Ga0265746_1016161 | Not Available | 876 | Open in IMG/M |
| 3300031231|Ga0170824_104179828 | Not Available | 505 | Open in IMG/M |
| 3300031231|Ga0170824_108003699 | Not Available | 731 | Open in IMG/M |
| 3300031234|Ga0302325_11775003 | Not Available | 775 | Open in IMG/M |
| 3300031474|Ga0170818_107740381 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300031708|Ga0310686_101395995 | Not Available | 538 | Open in IMG/M |
| 3300031708|Ga0310686_115833044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300031753|Ga0307477_10014580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5364 | Open in IMG/M |
| 3300031754|Ga0307475_10804573 | Not Available | 746 | Open in IMG/M |
| 3300031837|Ga0302315_10616999 | Not Available | 577 | Open in IMG/M |
| 3300031962|Ga0307479_10742832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 959 | Open in IMG/M |
| 3300032828|Ga0335080_10873806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 924 | Open in IMG/M |
| 3300032893|Ga0335069_10924227 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300032954|Ga0335083_10309760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1383 | Open in IMG/M |
| 3300032955|Ga0335076_11629107 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300033402|Ga0326728_10466182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1043 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.73% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.77% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.81% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.85% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.92% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.96% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.96% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_100489121 | 3300001356 | Peatlands Soil | GPQSLFPDQFDELMMQVRQIATVVGRTVPGIGVRETVALSK* |
| JGIcombinedJ26739_1002261904 | 3300002245 | Forest Soil | SLFPDQFDELMKQVRQIAAVVGRTVPGIEVREAVGVK* |
| Ga0062385_102604543 | 3300004080 | Bog Forest Soil | SLFPDQFDELMTQVRQIAAVVGRTVPGIGVRETVGLISSP* |
| Ga0062389_1006009731 | 3300004092 | Bog Forest Soil | GPQSLFPDQFDELMVQVRQIAGVVGRTVPGIGVRETVGVGK* |
| Ga0070739_100510501 | 3300005532 | Surface Soil | FDELMKQVRQIAAVVGRTVPGIGERATVGAAKAR* |
| Ga0070730_103180881 | 3300005537 | Surface Soil | QSLFPDQFDELMLQVRQIAAVVGRTVPAIGVRETAAVSK* |
| Ga0070731_100497103 | 3300005538 | Surface Soil | QSLFPDQFDELMGQVRQIAAVVGRTVPEISARETAEVASK* |
| Ga0070731_104404943 | 3300005538 | Surface Soil | FPDQFDQLMLQVRQIAAVVGRTVPEIRVGETVAVSN* |
| Ga0066708_103116741 | 3300005576 | Soil | YPDQFDDLMLQVRQIAPVVGRVVPGIGERAAVRAVST* |
| Ga0066654_105818391 | 3300005587 | Soil | DQFDVLMEQVRQIAAVVARSVPEIGVRETAAVTK* |
| Ga0070762_104369482 | 3300005602 | Soil | PDQFDELMKQVRQIAAVVGRTVPEIGVREPVAVSK* |
| Ga0070764_105833533 | 3300005712 | Soil | GPQSLFPDQFDELMVQVRQIAAVVGRTVPGIVVRETVAVGN* |
| Ga0070766_103857902 | 3300005921 | Soil | DELMKQVRQIAAVVGRTVPGIGVRETVELASKSGPF* |
| Ga0075028_1004080391 | 3300006050 | Watersheds | DGPQSLYPDQFEELMTQVRQIAVVVGRTVPAIGVRETVAASK* |
| Ga0070715_104433871 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | DGPQSLFPDQFDLLMEQVRQIAAVVGRTVPEIGVRETVASE* |
| Ga0070716_1011454722 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | FPDQFDELMKQVRQIAAVVGRSVPEIGVRETVAAK* |
| Ga0068871_1008163301 | 3300006358 | Miscanthus Rhizosphere | SDGMQSLYPEQFEELMLQVRQIAGVVGRTIVEIGEPVAVKAS* |
| Ga0066665_100369545 | 3300006796 | Soil | FDELMVQVRQIAAVVGRTVPAIGLREMVGVTKEVEVDSR* |
| Ga0066660_103591581 | 3300006800 | Soil | DQFDLLMEQVRQIAAVVGRSVPEIGVRETAAVSK* |
| Ga0073928_110960941 | 3300006893 | Iron-Sulfur Acid Spring | PDQFDELMKQVRQIAAVVGRTVPGIEVKETVGVSR* |
| Ga0102924_10360424 | 3300007982 | Iron-Sulfur Acid Spring | PQSLFPDQFDELMKQVRQIAAVVGRTVPAIGVRETVGVK* |
| Ga0099829_101075314 | 3300009038 | Vadose Zone Soil | QSLYPDQFDELMAQVRQIAPVVRRTVVAIGARESAAVVSN* |
| Ga0116225_10595104 | 3300009524 | Peatlands Soil | PDQFDELMLQVRQIAAVLGRTVPAIGVREQVAVSK* |
| Ga0116220_102317721 | 3300009525 | Peatlands Soil | DQFDELMMQVRQIAAVVGRTVPGIEVKETVGVSQ* |
| Ga0116217_100288566 | 3300009700 | Peatlands Soil | PQSLFPDQFDELMSQVRQIAAVVGRTVPGIGVRETVALSK* |
| Ga0116101_10900951 | 3300009759 | Peatland | PQSLFPDQFDELMKQVRQIAAVVGRTVPAIEVSEPAVISK* |
| Ga0126376_120656233 | 3300010359 | Tropical Forest Soil | LDQFDELMKQVCQIAAVVGRSVPEIGVRETVAAK* |
| Ga0126372_125077131 | 3300010360 | Tropical Forest Soil | LFPDQFDELMKQVRQIAAVVGRSVPEIGIRETVPAK* |
| Ga0126378_113418522 | 3300010361 | Tropical Forest Soil | DQFDELMVEVRQIAAVVGRTVPEIGVRETAAVSK* |
| Ga0105239_122746811 | 3300010375 | Corn Rhizosphere | QSLYPEQFDELMSQVGQIAPVVGRTVQGIGERSTTTAGNAV* |
| Ga0126381_1004726003 | 3300010376 | Tropical Forest Soil | PDQFDVLMTQVRQIAAVVGRTVPEIGVRETVAASP* |
| Ga0126383_127552183 | 3300010398 | Tropical Forest Soil | PDQFDQLMPQVRQIATVVGRTVPAIGERVAVGVAKV* |
| Ga0126352_10513823 | 3300010859 | Boreal Forest Soil | DQFDELMVQVRQIASVVGRTVPGIGVRETVEVSK* |
| Ga0138579_10549161 | 3300011090 | Peatlands Soil | PDQFDELMMQVRQIAAVVGRTVPGIEVKETVGVSQ* |
| Ga0137388_100952895 | 3300012189 | Vadose Zone Soil | FPDQFDELMTQVRQIAAVVGRTVPAIGVSETVGVSK* |
| Ga0137363_107732302 | 3300012202 | Vadose Zone Soil | QSLFPDQFDDLNLQVRRLNVVVGRTVLGIGVGETVAAK* |
| Ga0137390_104634484 | 3300012363 | Vadose Zone Soil | SLFPDQFDELMKQVRQIAAVVGRTVPAIGMRETAGVTK* |
| Ga0137398_105520453 | 3300012683 | Vadose Zone Soil | FPDQFDELMKQVRQIASVVGRTVPEIGVRETVAASK* |
| Ga0181528_107969822 | 3300014167 | Bog | QSLFPDQFDELMVQVRQIAAVVGRTVPAIAAAEDVVASR* |
| Ga0181531_107908813 | 3300014169 | Bog | SLFPDQFDELMKQVRQIAAVVGRTVPEIGVRETAGVSR* |
| Ga0181531_109916071 | 3300014169 | Bog | SLFPDQFDELMTQVRQIAAVVRRTVPSIGVTDTVAAK* |
| Ga0181537_101662881 | 3300014201 | Bog | PDQFDELMAQVRQIAAVVGKTVPAIGVRETVAAK* |
| Ga0182018_105978241 | 3300014489 | Palsa | PDQFDELMTQVRQIAAVVGRTVPEIGVREAVGVSK* |
| Ga0182018_106348661 | 3300014489 | Palsa | QSLFPDQFDELMVQVRQIAAVVGRTVPGIGIRETMSVSN* |
| Ga0181525_103331163 | 3300014654 | Bog | SLFPDQFDELMKQVRQIAAVVGRTVPEIGVREVVTSALRA* |
| Ga0137409_111729601 | 3300015245 | Vadose Zone Soil | PDQFDELMMQVRQIAAVVGRTVPGIGVRETVGVSK* |
| Ga0182005_11320282 | 3300015265 | Rhizosphere | PQSLFPDQFDLLMEQVRQIAAVVGRTVPEIGVRETVASE* |
| Ga0182005_12685292 | 3300015265 | Rhizosphere | QSLFPDQFDSLMEQVRQIAAVVGRTVPKIGTTETAALSKS* |
| Ga0134083_105528142 | 3300017659 | Grasslands Soil | PEQFDVLMTQVRQIAAVVGRTVPAIGARETLAVSK |
| Ga0187820_12408032 | 3300017924 | Freshwater Sediment | GPQSLFPDQFDELMKQVRQIAVVVGRSVPEIGVRETVAAK |
| Ga0187806_11302171 | 3300017928 | Freshwater Sediment | QSLFPDQFDELMTQVRQIAVVQRRSVPEIGVRETVAAK |
| Ga0187821_104827151 | 3300017936 | Freshwater Sediment | GPQSLFPDQFDELMVQVRQIAAVVGRTVPAIGVQEPAAASK |
| Ga0187819_100293285 | 3300017943 | Freshwater Sediment | QSLFPDQFDELMVQVRQIAAVVGRTVPEIGVRETAAVSK |
| Ga0187778_112522391 | 3300017961 | Tropical Peatland | LFPDQFDELMEQVRQIAAVVGRTVPEIRVRETVAAK |
| Ga0187780_102007011 | 3300017973 | Tropical Peatland | MQSLYPDQFDELMAQVRQIAAVVGRTVTGIGVRETVVMHK |
| Ga0187782_101002011 | 3300017975 | Tropical Peatland | SLFPDQFDELMAQIRQIAAVLGRTVPGIGVRETVAVSK |
| Ga0187767_100083735 | 3300017999 | Tropical Peatland | FPDQFDELMVQVRQIAAVVGRTVPTIGVPEAIAVSK |
| Ga0187887_100185666 | 3300018043 | Peatland | SLFPDQFDELMTQVRQIAAVVGKTVPAIGVRETVGVK |
| Ga0187765_101866671 | 3300018060 | Tropical Peatland | MQSLYPDQFDELMAQVRQIAAVVGRTVTGVGAREPVVASK |
| Ga0187770_103110401 | 3300018090 | Tropical Peatland | LFPDQFDELMTQVRQIAAVLGRTVPAVGTRETAAVSQ |
| Ga0210403_101716085 | 3300020580 | Soil | FPDQFDELMKQVRQIASVVGRTVPEIGVREPVGVSK |
| Ga0210401_100143261 | 3300020583 | Soil | PDQFDELMTQVRQIAAVVGRTVPEIGVRETVGVAK |
| Ga0210401_111388701 | 3300020583 | Soil | LFPDQFDELMVQVRQIAAVVGRTVPGIVVRETVAVGN |
| Ga0210400_107517013 | 3300021170 | Soil | PDQFDELMTQVRQIAAVVGRTVPEIGVREPVTVSK |
| Ga0210388_102633152 | 3300021181 | Soil | SLFPDQFDELMVQVRQIAAVVGRTVPGIVVRETVAVGN |
| Ga0210397_111206491 | 3300021403 | Soil | FPDQFDELMQQVRQIAPVVGRTIPEIGVRETVAAK |
| Ga0210397_115048062 | 3300021403 | Soil | FPDQFDTLMEQVRQIAAVVGRTVPAIGVREPVAVSK |
| Ga0210387_116042712 | 3300021405 | Soil | GPQSLLPDQFDELMVQVRQIAAVVGRTVPALGVGVAVAVSK |
| Ga0210398_100703321 | 3300021477 | Soil | SLYPDQFDDLMTQIRQIAAVVGRTVPGIEVTEPVAASR |
| Ga0212123_101946411 | 3300022557 | Iron-Sulfur Acid Spring | PQSLFPDQFDELMKQVRQIAAVVGRTVPAIGVRETVGVK |
| Ga0242661_11046981 | 3300022717 | Soil | PQSLFPDQFDTLMEQVRQIAAVVGRTVPAIGVREPVAVSK |
| Ga0242657_11438261 | 3300022722 | Soil | PQSLFPDQFDELMKQVRQIAAVVGRTVPAIGVREPVVATK |
| Ga0224550_10255411 | 3300022873 | Soil | SLFPDQFDELMAQVRQIASVVGRTVPGIGVRETVGVRK |
| Ga0207702_109212322 | 3300026078 | Corn Rhizosphere | GPQSLFPDQFDLLMEQVRQIAAVVGRTVPEIGVRETVASE |
| Ga0209731_10589851 | 3300027326 | Forest Soil | SLFPDQFDELMLQVRQIAAVVERTVPAIGVRETVTVSK |
| Ga0209118_11843192 | 3300027674 | Forest Soil | QSLFPDQFDELMVQVRQIAAVVGRTVPAIGVREKTAVSK |
| Ga0209274_100100801 | 3300027853 | Soil | LYPDQFDELMTQVRQIAAVVGRTVPGIGVRETAVVR |
| Ga0209579_103402923 | 3300027869 | Surface Soil | FPDQFDQLMLQVRQIAAVVGRTVPEIRVGETVAVSN |
| Ga0209488_107085061 | 3300027903 | Vadose Zone Soil | PDQFDELMLQVRQIAAVVGRTVPAIGVREPVAVSK |
| Ga0209526_101630631 | 3300028047 | Forest Soil | LFPDQFDDLMEQVRQIAAVLGRTVPAIGVRETVAAK |
| Ga0209526_107568242 | 3300028047 | Forest Soil | DQFDELMVQVRQIAAVVGRTVPAIGVRETVGVAGK |
| Ga0302303_103032091 | 3300028776 | Palsa | GPQSLFPDQFDELMVQVRQIAAVVGRTVPAIATRETATVSK |
| Ga0311326_104889131 | 3300029917 | Bog | PDQFDELMKQVRQIADVVGRTVPEIGVRETVVTVLRS |
| Ga0311371_118628541 | 3300029951 | Palsa | FPDQFDELMTQVRQIAAVVGRTVPEIGVRETVGVK |
| Ga0311338_109710851 | 3300030007 | Palsa | QSLFPDQFDELMRQVRQIAAVVGRTVPGIGVRETVGVSK |
| Ga0311370_101421805 | 3300030503 | Palsa | QSLYPDQFDELMKQVRQIAAVLGRTVPAIGVREPAAISK |
| Ga0265750_10054523 | 3300030813 | Soil | FPDQFDELMTQVRQIAAVVGRTVPGIGVRETVEAGKT |
| Ga0265746_10161612 | 3300030815 | Soil | FPDQFDELMTQVRQIAAVVGRTVPGIGVRETAGVSK |
| Ga0170824_1041798282 | 3300031231 | Forest Soil | YGPQSLYPHQFDELMAQVRQIAAVVGRTVPAIGAREAVAVSK |
| Ga0170824_1080036991 | 3300031231 | Forest Soil | LYPDQFDELMTQVRQIAAVVGRTVPAIGAREPAVVSK |
| Ga0302325_117750032 | 3300031234 | Palsa | LFPDQFDELMAQVRQIAAVVGRTVPGIGVRETVGLSK |
| Ga0170818_1077403812 | 3300031474 | Forest Soil | SLYPDQFDELMTQVRQIAVVVGRTVPAIGVGETVAVSK |
| Ga0310686_1013959952 | 3300031708 | Soil | FPDQFDELMKQVRQIAAVVGRTVPGIEVRETVWVIR |
| Ga0310686_1158330441 | 3300031708 | Soil | PDQFDELMKQVRQIAAVVGRTVPAIGVRETVAVTK |
| Ga0307477_100145807 | 3300031753 | Hardwood Forest Soil | QSLFPDQFDELMVQVRQIAAVVGRTVPAIGVRETAAVSK |
| Ga0307475_108045731 | 3300031754 | Hardwood Forest Soil | FPDQFDELMVQVRQIASVVGRTVPGIGVRETVTVST |
| Ga0302315_106169992 | 3300031837 | Palsa | QSLFPDQFDELMKQVRQIAAVVGRTVPEIGVRETVEIGK |
| Ga0307479_107428321 | 3300031962 | Hardwood Forest Soil | PQSLFPDQFDELMVQVRQIAAVVGRTVPAIGLRETAGVTK |
| Ga0335080_108738061 | 3300032828 | Soil | PQSLFPDQFDELMEQVRQIAAVVGRTVPEIGVREAVAVRN |
| Ga0335069_109242271 | 3300032893 | Soil | LFPHQFEELMQQVRQIAAVVGRSVPEIGVKETAAVSK |
| Ga0335083_103097601 | 3300032954 | Soil | LFPDQFDELMTQVRQIAAVVGRTVPAIGVAEPVVVSK |
| Ga0335076_116291072 | 3300032955 | Soil | PDQFDELMAQVRQIAAVLARTVPASEVSQPATVSK |
| Ga0335084_120581951 | 3300033004 | Soil | MQSLYPEQFEELMVQVRQIAAVVGRTIVEIGEPVGVKA |
| Ga0326728_104661821 | 3300033402 | Peat Soil | SLFPDQFDTLMEQVRQIAAVVGRTVPAIGVREQVAVSK |
| ⦗Top⦘ |