| Basic Information | |
|---|---|
| Family ID | F098104 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 52 residues |
| Representative Sequence | MAELTPKYIDATNLKALAMLALVGAGAYVVVGGLPVVAGSLVVALVLTVYHHAL |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 67.31 % |
| % of genes near scaffold ends (potentially truncated) | 36.54 % |
| % of genes from short scaffolds (< 2000 bps) | 97.12 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (11.539 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.808 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (64.423 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 61.11% β-sheet: 5.56% Coil/Unstructured: 33.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF01145 | Band_7 | 21.15 |
| PF12704 | MacB_PCD | 10.58 |
| PF00392 | GntR | 0.96 |
| PF08530 | PepX_C | 0.96 |
| PF06537 | DHOR | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.96 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.50 % |
| Unclassified | root | N/A | 12.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_106315692 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300001305|C688J14111_10082382 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300002568|C688J35102_118050824 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300002568|C688J35102_120050916 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300004081|Ga0063454_101941559 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300004156|Ga0062589_100177556 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300004479|Ga0062595_101556328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300004633|Ga0066395_10613188 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300004643|Ga0062591_100883885 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300005163|Ga0066823_10099915 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005165|Ga0066869_10015727 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300005169|Ga0066810_10127137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300005293|Ga0065715_11064577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300005329|Ga0070683_101243392 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300005329|Ga0070683_101889469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300005329|Ga0070683_102143963 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005330|Ga0070690_100562034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300005331|Ga0070670_100245998 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300005331|Ga0070670_100460813 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300005331|Ga0070670_102139197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300005335|Ga0070666_10012953 | All Organisms → cellular organisms → Bacteria | 5278 | Open in IMG/M |
| 3300005338|Ga0068868_102388419 | Not Available | 505 | Open in IMG/M |
| 3300005345|Ga0070692_11224193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300005354|Ga0070675_101324458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300005364|Ga0070673_102209814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum | 523 | Open in IMG/M |
| 3300005434|Ga0070709_11330955 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005458|Ga0070681_12011858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 506 | Open in IMG/M |
| 3300005526|Ga0073909_10095676 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300005530|Ga0070679_101461867 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300005535|Ga0070684_100339438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1381 | Open in IMG/M |
| 3300005539|Ga0068853_101683692 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005543|Ga0070672_101430240 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005563|Ga0068855_101903259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300005616|Ga0068852_102689607 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005617|Ga0068859_100948570 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300005618|Ga0068864_102054477 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005719|Ga0068861_101606670 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300005719|Ga0068861_102711512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300005764|Ga0066903_102123255 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300005764|Ga0066903_105154523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300005764|Ga0066903_106448805 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005840|Ga0068870_10203507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1202 | Open in IMG/M |
| 3300005842|Ga0068858_100760243 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300005842|Ga0068858_101461930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300005843|Ga0068860_101801319 | Not Available | 634 | Open in IMG/M |
| 3300005844|Ga0068862_101123687 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300005844|Ga0068862_102497756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300006163|Ga0070715_10665944 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300006163|Ga0070715_10671140 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300006354|Ga0075021_11073902 | Not Available | 526 | Open in IMG/M |
| 3300006580|Ga0074049_11107022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300006953|Ga0074063_13825004 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300009177|Ga0105248_11682687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300009177|Ga0105248_11779154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21 | 699 | Open in IMG/M |
| 3300009177|Ga0105248_12518599 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300009545|Ga0105237_11903345 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300012212|Ga0150985_100814884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1854 | Open in IMG/M |
| 3300012212|Ga0150985_111217473 | Not Available | 541 | Open in IMG/M |
| 3300012212|Ga0150985_112874744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300012212|Ga0150985_117861554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1367 | Open in IMG/M |
| 3300012469|Ga0150984_100206624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300012924|Ga0137413_11838596 | Not Available | 501 | Open in IMG/M |
| 3300012930|Ga0137407_11956068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300013306|Ga0163162_12567306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300014969|Ga0157376_10017206 | All Organisms → cellular organisms → Bacteria | 5508 | Open in IMG/M |
| 3300015199|Ga0167647_1144742 | Not Available | 522 | Open in IMG/M |
| 3300015242|Ga0137412_10237496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1445 | Open in IMG/M |
| 3300015264|Ga0137403_11381334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300016294|Ga0182041_10286118 | Not Available | 1359 | Open in IMG/M |
| 3300020034|Ga0193753_10082711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1637 | Open in IMG/M |
| 3300021178|Ga0210408_10729218 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300024288|Ga0179589_10631254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300025900|Ga0207710_10012695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3546 | Open in IMG/M |
| 3300025908|Ga0207643_10224252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1151 | Open in IMG/M |
| 3300025918|Ga0207662_10464788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 867 | Open in IMG/M |
| 3300025925|Ga0207650_10185669 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300025925|Ga0207650_10473575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300025925|Ga0207650_10641364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 895 | Open in IMG/M |
| 3300025940|Ga0207691_10686816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300025941|Ga0207711_10999575 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300025944|Ga0207661_10543636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1064 | Open in IMG/M |
| 3300025944|Ga0207661_10916727 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300025945|Ga0207679_11135595 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300025986|Ga0207658_11136219 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300026023|Ga0207677_10412011 | Not Available | 1149 | Open in IMG/M |
| 3300026035|Ga0207703_11834975 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300026041|Ga0207639_12235790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300026095|Ga0207676_11640772 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300026142|Ga0207698_11425464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300027821|Ga0209811_10075056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1188 | Open in IMG/M |
| 3300027874|Ga0209465_10367178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 721 | Open in IMG/M |
| 3300027894|Ga0209068_10646566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 617 | Open in IMG/M |
| 3300028380|Ga0268265_11621739 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300028768|Ga0307280_10065713 | Not Available | 1159 | Open in IMG/M |
| 3300031170|Ga0307498_10307930 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300031231|Ga0170824_114154986 | Not Available | 503 | Open in IMG/M |
| 3300031366|Ga0307506_10022077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1597 | Open in IMG/M |
| 3300031544|Ga0318534_10158269 | Not Available | 1308 | Open in IMG/M |
| 3300031561|Ga0318528_10517383 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300031573|Ga0310915_10718885 | Not Available | 705 | Open in IMG/M |
| 3300031682|Ga0318560_10105828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1460 | Open in IMG/M |
| 3300031795|Ga0318557_10260443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300031897|Ga0318520_10281352 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300032001|Ga0306922_10465711 | Not Available | 1349 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 11.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 8.65% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.88% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.92% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.92% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015199 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1063156922 | 3300000955 | Soil | MAELTPKYIDATNLRALAFLALVGAGAYVVVGGVPVVAGSLVIALVL |
| C688J14111_100823822 | 3300001305 | Soil | MADMNPKYIDATNLRALAMLALVGGMAYVVVGGVPVVAGGLTVAAALALYHRAL* |
| C688J35102_1180508242 | 3300002568 | Soil | DVMAELTPKYIDATNLRALAFLALVGAGAYIVVGGVPVVAGSLVVALVLTVYHHAL* |
| C688J35102_1200509162 | 3300002568 | Soil | MAELTPKYIDATNLRALAFLALVGAGAYVVVGGVPVVAGSLVVALVLTVYHHAL* |
| Ga0063454_1019415592 | 3300004081 | Soil | MAELTPKYIDATNLRALAFLALVGAGAYIVVGGVPVVAGSLVVALVLTVYHHAL* |
| Ga0062589_1001775562 | 3300004156 | Soil | MSEISPKYIDATNLKALAMLAFVGAGAYVVVGGLPVVAGSLVVALVLTVYHHAL* |
| Ga0062595_1015563282 | 3300004479 | Soil | KALAMLALVGAGAYVVVGGLPVVAGSLVVALVLTVYHHAL* |
| Ga0066395_106131881 | 3300004633 | Tropical Forest Soil | MAELTPKYIDTTNLKALAMLALVGAGAYVVVGGLPVVAGSLVVALVLTVYHHAM* |
| Ga0062591_1008838852 | 3300004643 | Soil | MTDISPKYIDATNLKALAMLALVGAGAYVVVGGVPVVAGGLAVAAVLAIYHHGL* |
| Ga0066823_100999152 | 3300005163 | Soil | MAELTPKYIDVTNLKALAMLALVGAGAYVVVGGLPVVAGSLVVALVLTVYHHAL* |
| Ga0066869_100157272 | 3300005165 | Soil | MAQLTPKYIDATNLKALAVLALVGAGAYVVVGGLPVVAGSLVVALVLTVYHHAL* |
| Ga0066810_101271372 | 3300005169 | Soil | PKYIDATNLKALAVLALVGAGAYVVVGGLPVVAGSLVVALVLTVYHHAL* |
| Ga0065715_110645772 | 3300005293 | Miscanthus Rhizosphere | MTDISPKYIDATNLKALAMLAVVGGLAYVVVGGVPVVAGGLAVAMALTIYHHAV* |
| Ga0070683_1012433922 | 3300005329 | Corn Rhizosphere | MSEISPKYIDATNLKALAMLALVGAGAYVVVGGLPVVAGSLLVALVLTVYHHAL* |
| Ga0070683_1018894691 | 3300005329 | Corn Rhizosphere | KYIDATNLKALAMLAFVGAGAYVVVGGLPVVAGSLVVALVLTVYHHAL* |
| Ga0070683_1021439632 | 3300005329 | Corn Rhizosphere | MAEITPRYIDATNLKALAMLALVGAGAYIVVGGVPVVAGSLVVALVLTVYHHAM* |
| Ga0070690_1005620342 | 3300005330 | Switchgrass Rhizosphere | ALAMLALVGAGAYIVVGGVPVVAGSLVVALVLTVYHHAL* |
| Ga0070670_1002459982 | 3300005331 | Switchgrass Rhizosphere | MSEISPKYIDATNLKALAMLAVVGGLAYVVVGGVPVVAGGLTVAAALAIYHHTV* |
| Ga0070670_1004608132 | 3300005331 | Switchgrass Rhizosphere | MAELTPKYIDATNLKALAMLALVGAGAYVVVGGLPVVTGSLVVALVLAVYHRAL* |
| Ga0070670_1021391972 | 3300005331 | Switchgrass Rhizosphere | ISPKYIDATNLKALAMLAVVGGLAYVVVGGVPVVAGGLAVAMALTIYHHAV* |
| Ga0070666_100129532 | 3300005335 | Switchgrass Rhizosphere | MTELTPKYVDLTNLKALAMLALVGAGAYIVVGGVPVVAGSLVVALVLTVYHHAL* |
| Ga0068868_1023884191 | 3300005338 | Miscanthus Rhizosphere | MAELTPKYIDATNLKALAMLALVGAGAYVVVGGLPVVAGSLVVALVLTVYHHAL* |
| Ga0070692_112241931 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | ATNLKALAMLAVVGGLAYVVVGGVPVVAGGLAVAMALTIYHHAV* |
| Ga0070675_1013244581 | 3300005354 | Miscanthus Rhizosphere | TNLKALAMLAVVGGLAYVVVGGVPVVAGGLAVAMALTIYHHAV* |
| Ga0070673_1022098141 | 3300005364 | Switchgrass Rhizosphere | MAELTPKYIDATNLKALAMLALVGAGAYVVVGGVPVVVGGLAVAAALAIYHHTL* |
| Ga0070709_113309552 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAELTPKYIDATNLKALAMLALVGAGAYIVVGGVPVVAGSLVVALVLTVYHHAL* |
| Ga0070681_120118581 | 3300005458 | Corn Rhizosphere | MNAHYVDATNLKALAMLAFVGALAYVVVGGVPVVAGGLAVAAALTIYHHAL* |
| Ga0073909_100956762 | 3300005526 | Surface Soil | MAELTPKYIDATNLKALAMLALVGAGAYIVVGGLPVVAGSLVVALVLTVYHHAL* |
| Ga0070679_1014618673 | 3300005530 | Corn Rhizosphere | TNLKALAMLAFVGALAYVVVGGVPVVAGGLAVAAALTIYHHAL* |
| Ga0070684_1003394382 | 3300005535 | Corn Rhizosphere | PKYIDATNLKALAMLALVGAGAYVVVGGLPVVAGSLLVALVLTVYHHAL* |
| Ga0068853_1016836922 | 3300005539 | Corn Rhizosphere | MAELTPKYIDATNLRALAMLALVGAGAYIVVGGLPVVAGSLVIALVLTVYHHAL* |
| Ga0070672_1014302402 | 3300005543 | Miscanthus Rhizosphere | MSEISPKYIDATNLKALAMLALVGAGAYVVVGGVPVVAGGLAVAAALTIYHHAL* |
| Ga0068855_1019032592 | 3300005563 | Corn Rhizosphere | KALAFLALVGAGAYIVVGGVPVVAGGLLVALVLTVYHHAL* |
| Ga0068852_1026896072 | 3300005616 | Corn Rhizosphere | MTEISPKYIDATNLKALAMLALVGAGAYVVVGGVPVVAGGLAVA |
| Ga0068859_1009485702 | 3300005617 | Switchgrass Rhizosphere | MSEISPKYIDATNLKALAMLAVVGGLAYVVVGGVPVVAGGLAVAMALTIYHHAV* |
| Ga0068864_1020544772 | 3300005618 | Switchgrass Rhizosphere | MAELTPKYIDATNLKALAMLALVGAVAYVVVGGLPVVTGSLVVALVLAVYHRAL* |
| Ga0068861_1016066702 | 3300005719 | Switchgrass Rhizosphere | MTEISPKYIDATNLKALAMLALVGAGAYVVVGGVPVVAGGLAVAAALTIYHHAL* |
| Ga0068861_1027115122 | 3300005719 | Switchgrass Rhizosphere | KALAMLAVVGGLAYVVVGGVPVVAGGLTVAAALAIYHHTV* |
| Ga0066903_1021232552 | 3300005764 | Tropical Forest Soil | MAELTPKYIDATNLRALAMLALVGAGAYVVVGGVPVVAGSLVVALVLTVYHHAL* |
| Ga0066903_1051545232 | 3300005764 | Tropical Forest Soil | MAELTPKYIDATNLKALAMLALVGAGAYVVVGGLPVVAGSLVVALVLTVYHHAM* |
| Ga0066903_1064488052 | 3300005764 | Tropical Forest Soil | MAELTPKYIDATNLKALAMLALVGAGAYVVVGGLPVVSGSLVVALVLIVYHHAV* |
| Ga0068870_102035072 | 3300005840 | Miscanthus Rhizosphere | PKYIDATNLKALAMLAVVGGLAYVVVGGVPVVAGGLAVAMALTIYHHAV* |
| Ga0068858_1007602432 | 3300005842 | Switchgrass Rhizosphere | MSEISPKYIDATNLKALAMLALVGAGAYVVVGGVPVVAGGLAVAAALAIYHHTV* |
| Ga0068858_1014619301 | 3300005842 | Switchgrass Rhizosphere | AEDREDIMAELTPKYIDATNLKALAMLALVGAGAYVVVGGLPVVAGSLVVALVLTVYHHAV* |
| Ga0068860_1018013191 | 3300005843 | Switchgrass Rhizosphere | MSEISPKYIDATNLKALAMLALVGAGAYVVVGGVPVVAGGLAVAAVLAIYHHGL* |
| Ga0068862_1011236872 | 3300005844 | Switchgrass Rhizosphere | MSEISPKYIDATNLKALAMLAVVGGLAYVVVGGVPVVAGGLAVAAALTIYHHAV* |
| Ga0068862_1024977562 | 3300005844 | Switchgrass Rhizosphere | NLKALAMLALVGAGAYVVVGGVPVVAGGLAVAAVLAIYHHGL* |
| Ga0070715_106659441 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MAELTPKYIDATNLKALAMLAVVGALAYIVVGGIPVVAGGLAVAAALTIYHHAL* |
| Ga0070715_106711402 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEVTPKYIDATNLKALAMLALVGAGAYIVVGGVPVVAGSLVVALVLTVYHHAL* |
| Ga0075021_110739021 | 3300006354 | Watersheds | LRALAMLACVGALAYVVVGGIPVVAGGLAIAAALTIYHHAL* |
| Ga0074049_111070222 | 3300006580 | Soil | KEDGMAELTPKYIDVTNLKALAMLALVGAGAYVVVGGLPVVAGSLVVALVLTVYHHAL* |
| Ga0074063_138250042 | 3300006953 | Soil | MAELTPKYLDATNLKALAMLALVGAGAYVVVGGLPLVAGSLMVALVLTVYHHAL* |
| Ga0105248_116826871 | 3300009177 | Switchgrass Rhizosphere | KEDGMAELTPKYIDATNLKALAMLALVGAGAYVVVGGVPVVVGGLAVAAALAIYHHAL* |
| Ga0105248_117791541 | 3300009177 | Switchgrass Rhizosphere | DISPKYIDATNLKALAMLALVGAGAYVVVGGVPVVAGGLEVEAALTIYHHAL* |
| Ga0105248_125185993 | 3300009177 | Switchgrass Rhizosphere | MAEMTPKYVDATNLKALAMLALVGALAYVVVGGIPVVAGGLAVAAALTIYHHAL* |
| Ga0105237_119033451 | 3300009545 | Corn Rhizosphere | MTELTPKYVDLTNLKALAMLALVGAGAYIVVGGVPVVAVSLVVALALTVYHHAL* |
| Ga0150985_1008148843 | 3300012212 | Avena Fatua Rhizosphere | VERQTIKEDVMAELTPKYIDATNLRALAFLALVGAGAYVVVGGVPVVAGSLVVALVLTVYHHAL* |
| Ga0150985_1112174731 | 3300012212 | Avena Fatua Rhizosphere | MASITPKYIDATNLRALAFLALVGAGAYVVVGGVPVVAGSLVVALVLTVYHHAV |
| Ga0150985_1128747442 | 3300012212 | Avena Fatua Rhizosphere | MPQVSSHYIDATNLKALAFLALVGAGAYVVVGGVPVVAGSLVVALVLTVYHHAL* |
| Ga0150985_1178615541 | 3300012212 | Avena Fatua Rhizosphere | MADMNPKYIDATNLRALAMLALVGGMAYVVVGGVPVVAGGLTVATALALYHRAL* |
| Ga0150984_1002066241 | 3300012469 | Avena Fatua Rhizosphere | DMNPKYIDATNLRALAMLALVGGMAYVVVGGVPVVAGGLTVAAALALYHRAL* |
| Ga0137413_118385962 | 3300012924 | Vadose Zone Soil | MAEMTPTYIDATNLKALAMLALVGAGAYVVVGGLPVVAGSLVVALVLTVYHHGL* |
| Ga0137407_119560681 | 3300012930 | Vadose Zone Soil | YIDATNLKALAMLALVGAGAYVVVGGLPVVAGSLVVALVLTVYHHGL* |
| Ga0163162_125673061 | 3300013306 | Switchgrass Rhizosphere | SEISPKYIDATNLKALAMLAVVGGLAYVVVGGVPVVAGGLTVAAALAIYHHTV* |
| Ga0157376_100172061 | 3300014969 | Miscanthus Rhizosphere | MTPKYIDATNLKALAMLALVGAGAYIVVGGLPVVAGSLVVALVLTVYHHAL* |
| Ga0167647_11447421 | 3300015199 | Glacier Forefield Soil | MATVTPKYLDATNLKALAFLAFVGAMAYLVVGGIPVVAGGLIVALVLTVYHHAL* |
| Ga0137412_102374961 | 3300015242 | Vadose Zone Soil | MAEMTPTYIDATNLKALAMLALVGAGAYVVVGGLPVVAGSLVVALVLTVY |
| Ga0137403_113813341 | 3300015264 | Vadose Zone Soil | NRKEDGMAEMTPTYIDATNLKALAMLALVGAGAYVVVGGLPVVAGSLVVALVLTVYHHGL |
| Ga0182041_102861183 | 3300016294 | Soil | ATNLRALAMLALVGAGAYVVVGGVPVVAGSLVVALVLTVYHHAL |
| Ga0193753_100827113 | 3300020034 | Soil | MAEITPKYIDTTNLKALAMLAFVGAMAYVVVGGLPVVAGSLFVALVLTVYHHAL |
| Ga0210408_107292182 | 3300021178 | Soil | MAELTPKYIDATNLKALAMLALVGAGAYIVVGGVPVVAGSLVVALVLTVYHHAL |
| Ga0179589_106312541 | 3300024288 | Vadose Zone Soil | MTPTYIDATNLKALAMLALVCAGAYVVVGGLPVVAGSLVVALVLTVYHHGL |
| Ga0207710_100126955 | 3300025900 | Switchgrass Rhizosphere | MSEISPKYIDATNLKALAMLAFVGAGAYVVVGGLPVVAGSLVVALVLTVYHHAL |
| Ga0207643_102242522 | 3300025908 | Miscanthus Rhizosphere | MSEISPKYIDATNLKALAMLAVVGGLAYVVVGGVPVVAGGLAVAMALTIYHHAV |
| Ga0207662_104647882 | 3300025918 | Switchgrass Rhizosphere | MTEISPRYIDATNLKALAMLALVGAGAYVVVGGVPVVAGGLAVAAVLTIYHHAL |
| Ga0207650_101856693 | 3300025925 | Switchgrass Rhizosphere | MTDISPKYIDATNLKALAMLALVGAGAYVVVGGVPVVAGGLAVAAVLAIYHHGL |
| Ga0207650_104735752 | 3300025925 | Switchgrass Rhizosphere | MAELTPKYIDATNLKALAMLALVGAGAYVVVGGLPVVTGSLVVALVLAVYHRAL |
| Ga0207650_106413642 | 3300025925 | Switchgrass Rhizosphere | MSEISPKYIDATNLKALAMLAVVGGLAYVVVGGVPVVAGGLAVAAALTIYHHAV |
| Ga0207691_106868162 | 3300025940 | Miscanthus Rhizosphere | MTEISPKYIDATNLKALAMLALVGAGAYVVVGGVPVVAGGLAVAAALTIYHHAL |
| Ga0207711_109995753 | 3300025941 | Switchgrass Rhizosphere | MAEMTPKYVDATNLKALAMLALVGALAYVVVGGIPVVAGGLAVAAALTIYHHAL |
| Ga0207661_105436362 | 3300025944 | Corn Rhizosphere | MAEITPRYIDATNLKALAMLALVGAGAYIVVGGVPVVAGSLVVALVLTVYHHAM |
| Ga0207661_109167272 | 3300025944 | Corn Rhizosphere | MSEISPKYIDATNLKALAMLALVGAGAYVVVGGLPVVAGSLVVALVLTVYHHAV |
| Ga0207679_111355952 | 3300025945 | Corn Rhizosphere | MSEVSPKYIDATNLKALAMLALVGAGAYGVVGGVPVVAGGLAVAAVLAIYHHGL |
| Ga0207658_111362192 | 3300025986 | Switchgrass Rhizosphere | MSEISPKYIDATNLKALAMLAVVGGLAYVVVGGVPVVAGGLTVAAALAIYHHTV |
| Ga0207677_104120112 | 3300026023 | Miscanthus Rhizosphere | MSEISPKYIDATNLKALAMLALVGAGAYVVVGGVPVVAGGLAVAAVLAIYHHGL |
| Ga0207703_118349752 | 3300026035 | Switchgrass Rhizosphere | MSEISPKYIDATNLKALAMLALVGAGAYVVVGGVPVVAGGLAVAAALAIYHHTV |
| Ga0207639_122357902 | 3300026041 | Corn Rhizosphere | EDGMAELTPKYIDATNLRALAMLALVGAGAYIVVGGLPVVAGSLVIALVLTVYHHAL |
| Ga0207676_116407722 | 3300026095 | Switchgrass Rhizosphere | MAEISPKYIDATNLKALAMLALVGAGAYVVVGGLPVVAGSLVVALVLTVYHHAL |
| Ga0207698_114254642 | 3300026142 | Corn Rhizosphere | MAELTPKYIDATNLRALAMLALVGAGAYIVVGGLPVVAGSLVIALVLTVYHHAL |
| Ga0209811_100750562 | 3300027821 | Surface Soil | MAELTPKYIDATNLKALAMLALVGAGAYIVVGGLPVVAGSLVVALVLTVYHHAL |
| Ga0209465_103671782 | 3300027874 | Tropical Forest Soil | MAELTPKYIDTTNLKALAMLALVGAGAYVVVGGLPVVAGSLVVALVLTVYHHAM |
| Ga0209068_106465661 | 3300027894 | Watersheds | KYIDATNLRALAMLACVGALAYVVVGGIPVVAGGLAIAAALTIYHHAL |
| Ga0268265_116217391 | 3300028380 | Switchgrass Rhizosphere | MSEISPKYIDATNLKALAMLALVGAGAYVVVGGVPVVAGGLAVAAALTIYHHAV |
| Ga0307280_100657132 | 3300028768 | Soil | MAELTPKYIDATNLKALAMLALVGAGAYLVVGGLPVAAGSLVVALVLTVYHQGL |
| Ga0307498_103079302 | 3300031170 | Soil | MAELTPKYIDTTNLKALAMLALVGAGAYVVVGGLPVVAGSLVVALVLTVYHHAL |
| Ga0170824_1141549862 | 3300031231 | Forest Soil | MAELTPKYIDATNLKALAMLALVGAGAYVVVGGLPLVAGGLVIALALTVYHHAL |
| Ga0307506_100220772 | 3300031366 | Soil | MAELTPKYIDATNLRALAFLALVGAGAYVVVGGVPVVAGGLAVAAALTIYHHAL |
| Ga0318534_101582692 | 3300031544 | Soil | MAELTPKYIDATNLRALAMLALVGAGAYVVVGGVPVVAGSLVVALVLTVYHHAL |
| Ga0318528_105173832 | 3300031561 | Soil | MAELTPKYIDATNLRALAMLALVGAGAYVVVGGVPVVAGSLVVALVLTVYH |
| Ga0310915_107188852 | 3300031573 | Soil | LRALAMLALVGAGAYVVVGGVPVVAGSLVVALVLTVYHHAL |
| Ga0318560_101058281 | 3300031682 | Soil | MAELTPKYIDATNLRALAMLALVGAGAYVDVGGVPVVAGSLVVALVLTVYHHAL |
| Ga0318557_102604431 | 3300031795 | Soil | ALAMLALVGAGAYVVVGGVPVVAGSLVVALVLTVYHHAL |
| Ga0318520_102813522 | 3300031897 | Soil | MAELTPKYIDATNLRAFAMLALVGAGAYVVVGGVPVVAGSLVVALVLTVYHHAL |
| Ga0306922_104657111 | 3300032001 | Soil | MAELTPKYIDATNLRALAMLALVGAGAYVVVGGVPVVAGSLVVALVLTVYHYAL |
| ⦗Top⦘ |