| Basic Information | |
|---|---|
| Family ID | F098089 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MADVITVPQVQPVQPALRFLRVIPGVLLLAAVGYAGKLLE |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.15 % |
| % of genes near scaffold ends (potentially truncated) | 99.04 % |
| % of genes from short scaffolds (< 2000 bps) | 89.42 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.808 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.962 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.76% β-sheet: 0.00% Coil/Unstructured: 63.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00590 | TP_methylase | 37.50 |
| PF03460 | NIR_SIR_ferr | 2.88 |
| PF01077 | NIR_SIR | 1.92 |
| PF03601 | Cons_hypoth698 | 0.96 |
| PF13701 | DDE_Tnp_1_4 | 0.96 |
| PF13231 | PMT_2 | 0.96 |
| PF01244 | Peptidase_M19 | 0.96 |
| PF14824 | Sirohm_synth_M | 0.96 |
| PF02910 | Succ_DH_flav_C | 0.96 |
| PF00160 | Pro_isomerase | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG2855 | Uncharacterized membrane protein YadS, UPF0324 family | Function unknown [S] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.50 % |
| Unclassified | root | N/A | 12.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q01A6LYQ | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 514 | Open in IMG/M |
| 3300000559|F14TC_108584481 | Not Available | 567 | Open in IMG/M |
| 3300001137|JGI12637J13337_1001401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1921 | Open in IMG/M |
| 3300004080|Ga0062385_10057926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1710 | Open in IMG/M |
| 3300004092|Ga0062389_102018704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 753 | Open in IMG/M |
| 3300004092|Ga0062389_102411995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 696 | Open in IMG/M |
| 3300005167|Ga0066672_10650571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 680 | Open in IMG/M |
| 3300005180|Ga0066685_11069606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300005332|Ga0066388_105651275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 633 | Open in IMG/M |
| 3300005446|Ga0066686_10092383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1936 | Open in IMG/M |
| 3300005471|Ga0070698_101636991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 596 | Open in IMG/M |
| 3300005559|Ga0066700_10253006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1232 | Open in IMG/M |
| 3300005574|Ga0066694_10032195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2349 | Open in IMG/M |
| 3300005614|Ga0068856_102028051 | Not Available | 585 | Open in IMG/M |
| 3300005719|Ga0068861_101524755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 656 | Open in IMG/M |
| 3300006163|Ga0070715_11032900 | Not Available | 514 | Open in IMG/M |
| 3300006172|Ga0075018_10396175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 701 | Open in IMG/M |
| 3300006175|Ga0070712_100102140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2123 | Open in IMG/M |
| 3300006175|Ga0070712_101071048 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300006176|Ga0070765_101799237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 575 | Open in IMG/M |
| 3300006800|Ga0066660_10143188 | All Organisms → cellular organisms → Bacteria | 1761 | Open in IMG/M |
| 3300006800|Ga0066660_11136766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 616 | Open in IMG/M |
| 3300006854|Ga0075425_100441091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1499 | Open in IMG/M |
| 3300006903|Ga0075426_11052938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 615 | Open in IMG/M |
| 3300006904|Ga0075424_102006787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 610 | Open in IMG/M |
| 3300007265|Ga0099794_10442283 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300009012|Ga0066710_100691139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1555 | Open in IMG/M |
| 3300009038|Ga0099829_10641504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 883 | Open in IMG/M |
| 3300009089|Ga0099828_10844831 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300010360|Ga0126372_13240555 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300011120|Ga0150983_14990317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1122 | Open in IMG/M |
| 3300011270|Ga0137391_10241385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1568 | Open in IMG/M |
| 3300011271|Ga0137393_10529568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1011 | Open in IMG/M |
| 3300011271|Ga0137393_10921671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300012201|Ga0137365_11118497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300012202|Ga0137363_10007523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6833 | Open in IMG/M |
| 3300012202|Ga0137363_11065787 | Not Available | 687 | Open in IMG/M |
| 3300012206|Ga0137380_10027716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5218 | Open in IMG/M |
| 3300012206|Ga0137380_10695967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 883 | Open in IMG/M |
| 3300012207|Ga0137381_11730022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300012356|Ga0137371_11195806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300012361|Ga0137360_11850959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300012363|Ga0137390_10769631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 922 | Open in IMG/M |
| 3300012371|Ga0134022_1070380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300012381|Ga0134026_1072603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300012582|Ga0137358_11084318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300012685|Ga0137397_10398458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
| 3300012925|Ga0137419_10538895 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300012929|Ga0137404_10742772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300012929|Ga0137404_10995891 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300014150|Ga0134081_10073094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
| 3300015245|Ga0137409_11368445 | Not Available | 552 | Open in IMG/M |
| 3300016371|Ga0182034_11732438 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300016371|Ga0182034_12080112 | Not Available | 501 | Open in IMG/M |
| 3300017936|Ga0187821_10001468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7183 | Open in IMG/M |
| 3300017943|Ga0187819_10213477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
| 3300017999|Ga0187767_10075402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 891 | Open in IMG/M |
| 3300018086|Ga0187769_10025962 | All Organisms → cellular organisms → Bacteria | 3935 | Open in IMG/M |
| 3300018433|Ga0066667_11114012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300020170|Ga0179594_10214700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300020579|Ga0210407_10004203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11417 | Open in IMG/M |
| 3300020579|Ga0210407_10069516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2642 | Open in IMG/M |
| 3300020579|Ga0210407_11263092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300020581|Ga0210399_10564537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 943 | Open in IMG/M |
| 3300020583|Ga0210401_10902079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300021168|Ga0210406_10672662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300021401|Ga0210393_10822586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 755 | Open in IMG/M |
| 3300021405|Ga0210387_10606120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 973 | Open in IMG/M |
| 3300021406|Ga0210386_11737040 | Not Available | 515 | Open in IMG/M |
| 3300021407|Ga0210383_11040247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 693 | Open in IMG/M |
| 3300021478|Ga0210402_10843327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
| 3300021478|Ga0210402_11858870 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300021559|Ga0210409_11681667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300022532|Ga0242655_10217819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300022532|Ga0242655_10301377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300024271|Ga0224564_1085163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 636 | Open in IMG/M |
| 3300024271|Ga0224564_1087636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300024330|Ga0137417_1273196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300024330|Ga0137417_1502140 | All Organisms → cellular organisms → Bacteria | 6695 | Open in IMG/M |
| 3300025916|Ga0207663_11190066 | Not Available | 613 | Open in IMG/M |
| 3300025928|Ga0207700_11342185 | Not Available | 637 | Open in IMG/M |
| 3300025941|Ga0207711_11986835 | Not Available | 524 | Open in IMG/M |
| 3300026314|Ga0209268_1114087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300026529|Ga0209806_1244040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300027174|Ga0207948_1010630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1063 | Open in IMG/M |
| 3300027701|Ga0209447_10176858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300027812|Ga0209656_10328153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 701 | Open in IMG/M |
| 3300027846|Ga0209180_10634701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300027884|Ga0209275_10236100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 999 | Open in IMG/M |
| 3300028072|Ga0247675_1056419 | Not Available | 587 | Open in IMG/M |
| 3300028536|Ga0137415_10543945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300029636|Ga0222749_10258832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 888 | Open in IMG/M |
| 3300030878|Ga0265770_1001098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3726 | Open in IMG/M |
| 3300031057|Ga0170834_110133108 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300031128|Ga0170823_10197553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300031231|Ga0170824_105754054 | Not Available | 539 | Open in IMG/M |
| 3300031446|Ga0170820_16636269 | Not Available | 809 | Open in IMG/M |
| 3300031469|Ga0170819_14814063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
| 3300031744|Ga0306918_10484986 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300031753|Ga0307477_10635836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300031910|Ga0306923_10572235 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300031962|Ga0307479_11690345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300032180|Ga0307471_101323286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 882 | Open in IMG/M |
| 3300033134|Ga0335073_10082623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4192 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.77% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.92% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.96% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012371 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012381 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_05336570 | 2170459005 | Grass Soil | MASSVAIAQVKPVNPALQFLRIVPGVLLLAAVGYAGKLMEANVGK |
| F14TC_1085844813 | 3300000559 | Soil | MASSVAVAQAKPASPALQFLKLVPGVLLLAGVGYAGKLLEANVGKY |
| JGI12637J13337_10014014 | 3300001137 | Forest Soil | MSEAAVALPRVRSSNPAWNFLRLIPGVLLLAAIGYAGKLLEQNVGKYA |
| Ga0062385_100579264 | 3300004080 | Bog Forest Soil | MADAVVIPQVQPVQPALRFLRLIPGVLLLAAIGYAGKLLEQN |
| Ga0062389_1020187041 | 3300004092 | Bog Forest Soil | MADAVVIPQAQPEVQPAQPALRFLRVIPGVLLLAAIGYAGKLLEQNV |
| Ga0062389_1024119951 | 3300004092 | Bog Forest Soil | MADAVVIPQVQPIQPALRFLRLIPGVLLLAAIGYAGKLLEQNV |
| Ga0066672_106505711 | 3300005167 | Soil | MADVIAVTQVRPVQPVFRYLRAIPGVLLLFAIGYAGKLLEQNVGAYAKAH |
| Ga0066685_110696062 | 3300005180 | Soil | MSDVITVPQVRPVQPVLRFLRVVPGVILLAGIGYAGKLLEQNVGAYAKAHHWTFPNI |
| Ga0066388_1056512751 | 3300005332 | Tropical Forest Soil | MASSVAVAQVRPANPALQFLRLMPGVLLLAGVGYAGKLLEAN |
| Ga0066686_100923833 | 3300005446 | Soil | MSDVITVPQVRPVQPVLRFLRVVPGVILLAAIGYAGKLLEQNVGAYAK |
| Ga0070698_1016369913 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MASSVAVARVRPVNPALQFLKLVPGVLLLAGVGYAGKLLEANV |
| Ga0066700_102530063 | 3300005559 | Soil | MAGTVALPQVRPVNPGLQFLKVIPGVLLLAAVGYAGKL |
| Ga0066694_100321951 | 3300005574 | Soil | MADVITVPQVQPVQAALRFLRVIPGVLLLAAVGYAGKLL |
| Ga0068856_1020280511 | 3300005614 | Corn Rhizosphere | MAGSVALPQSQARSHQPALQCLRVIPGVLLLAAVGYAG |
| Ga0068861_1015247551 | 3300005719 | Switchgrass Rhizosphere | MAGSVALPQSQAQSHQPALQCLRVIPGVLLLAAVGYAGKLLEKNVGA |
| Ga0070715_110329002 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGSVALPQSQVQSHQPALQFLRVTPGVLLLAGVGYAGK |
| Ga0075018_103961751 | 3300006172 | Watersheds | MADVVTVPQVQPVQPALRFLRVVPGILLLAAVGYAGK |
| Ga0070712_1001021405 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MASSMALPRVRSVNLAIQFLKVIPGVLLLAAVGYAGKLL |
| Ga0070712_1010710483 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MASSIAVPQVRQVNPALQFLKVIPGVLLLAAIGYAGKLLEANVGKYAKVHHWTFPN |
| Ga0070765_1017992371 | 3300006176 | Soil | MASSIALPQARTEQPALGLLRLIPGVLLLAAVGYAG |
| Ga0066660_101431883 | 3300006800 | Soil | MADVITVTQVQLVQPVFRYLRAIPGVLLLFAIGYAGKLLEQNVGAYAKAHYW |
| Ga0066660_111367663 | 3300006800 | Soil | MADVIAVTQVRPVQPVFRYLRAIPGVLLLFAIGYAGKLLEQNVGAYAKAHYW |
| Ga0075425_1004410911 | 3300006854 | Populus Rhizosphere | MAGSVALPQFQAQSRQPALQYLRVIPGVLLLAAVGYAGKLLE |
| Ga0075426_110529381 | 3300006903 | Populus Rhizosphere | MASSVTVAQVSPANPALQLLKLVPGVLLLAGVGYA |
| Ga0075424_1020067873 | 3300006904 | Populus Rhizosphere | MAGSVALPQFQAQSRQPALQYLRVIPGVLLLAAVGYA |
| Ga0099794_104422831 | 3300007265 | Vadose Zone Soil | MADAIALPQAKPAQPTLQFLRVIPGVLLLAAVGYA |
| Ga0066710_1006911393 | 3300009012 | Grasslands Soil | MADVLTVPEVQPGQPAFRYLRVIPGVLLLFAIGYAGKLLEQ |
| Ga0099829_106415041 | 3300009038 | Vadose Zone Soil | MSDIITVPQVRPVQPVLRFLRVVPGVILLAAIGYAGKLLEQNVGAYAKAHHWTFPN |
| Ga0099828_108448311 | 3300009089 | Vadose Zone Soil | MADAIALPQAKPAQPTLQFLRVIPGVLLLAAVGYAGKL |
| Ga0126372_132405551 | 3300010360 | Tropical Forest Soil | MSQAAVALPQVRSSNRAWNFLRLVPGIALLAAIGYAGKLLEQNV |
| Ga0150983_149903173 | 3300011120 | Forest Soil | MADVITVPQVQPVQPALKFLRVIPGVLLLAAIGYAGKLLE |
| Ga0137391_102413854 | 3300011270 | Vadose Zone Soil | MSDVITVPQVRPVQPVLRFLRVVPGVILLAAIGYAGKLLEQ |
| Ga0137393_105295681 | 3300011271 | Vadose Zone Soil | MGDVVAVPQVRPVQPALRFLRVIPGVLLLAAVGYAGKLL |
| Ga0137393_109216713 | 3300011271 | Vadose Zone Soil | MADVITVPRVQPVQPALRFLRVIPGVLLLAAVGYAGKLLE |
| Ga0137365_111184973 | 3300012201 | Vadose Zone Soil | MADAITVPQVQPVQPALRFLRVIPGIVLLAGVGYAGKLLEQNVG |
| Ga0137363_100075231 | 3300012202 | Vadose Zone Soil | MADAIALPQSRPAQPAIQFFRVIPGVLLLAGVGYAGKL |
| Ga0137363_110657871 | 3300012202 | Vadose Zone Soil | MASSIAISQVRPVNPALRFLKIVPGVLLLAAVGYAGKLLEAN |
| Ga0137380_100277161 | 3300012206 | Vadose Zone Soil | MAGTVALPQVRPVNPALQFLKVIPGVLLLAAVGYAGKLLE |
| Ga0137380_106959673 | 3300012206 | Vadose Zone Soil | MSDVITVPQVRPVQPVLRFLRVVPGVILLAGIGYAGKLL |
| Ga0137381_117300221 | 3300012207 | Vadose Zone Soil | MADAITVPQVQPVQPAWRFLRVIPGIFLLAAVGYAGKL |
| Ga0137371_111958061 | 3300012356 | Vadose Zone Soil | MADVITVPQVRPVQPALRFLRVIPGVLLLAAVGYAGKLLEQN |
| Ga0137360_118509591 | 3300012361 | Vadose Zone Soil | MADVITVPQVQPVQPALRFLRVFPGVLLLAGVGYAGKLLE |
| Ga0137390_107696311 | 3300012363 | Vadose Zone Soil | MSDVISVPQVQPVQPVLRFLRVVPGVILLAAIGYAGKLLEQNVGAYAKAHHWT |
| Ga0134022_10703801 | 3300012371 | Grasslands Soil | MADVITVPQVRPVQPALRFLRVIPGVLLLAAVGYAGKL |
| Ga0134026_10726031 | 3300012381 | Grasslands Soil | MADVLTVPQVQPVQPAFRYLRVIPGVLLLFAIGYAGKLLEQNVGGYAK |
| Ga0137358_110843181 | 3300012582 | Vadose Zone Soil | MADAITVPQVQPVQPALRFLRVVPGILLLAAVGYAGKLLEQNV |
| Ga0137397_103984581 | 3300012685 | Vadose Zone Soil | MADAITVAQVQPVQPALRFLRVIPGVLLLAAVGYAGKLLEQN |
| Ga0137419_105388951 | 3300012925 | Vadose Zone Soil | MASSIAFAQVRPVNPALQFLKIVPGVLLLAAVGYAGKLLEANVGK |
| Ga0137404_107427723 | 3300012929 | Vadose Zone Soil | MADVITVPQVRLVQPALRFLRVIPGVLLLAAVGYAGK |
| Ga0137404_109958912 | 3300012929 | Vadose Zone Soil | MASSIALPRTRTEQPALQFLRVIPGVLLLGAVGYA |
| Ga0134081_100730943 | 3300014150 | Grasslands Soil | MADVITIPHVRPVQPALRLLRVIPGVLLLAAVGYAG |
| Ga0137409_113684451 | 3300015245 | Vadose Zone Soil | MAGTVALPQVRPVNPALQFAKVIPGVLLLAAVGYAG |
| Ga0182034_117324381 | 3300016371 | Soil | MADVIVIPQAQPVETRLPFLRVIPGVLLLAAVGYGGKFLEQN |
| Ga0182034_120801123 | 3300016371 | Soil | MASSMAISQLRSGNPALQFLKVAPGVLLLAAIGYAGKLLE |
| Ga0187821_100014681 | 3300017936 | Freshwater Sediment | MASSVAIAQVRPVNPALNFVKLIPGVLLLAGIGYAGKLLEANVGKY |
| Ga0187819_102134771 | 3300017943 | Freshwater Sediment | MADVITVPQVQTAQPGLRFLRVIPGVLLLGAIGYAGKL |
| Ga0187767_100754023 | 3300017999 | Tropical Peatland | MADVITVPQVQPVQPALRFLRIIPGVLLLGAIGYAGKLLEQNVGAYAKAHHW |
| Ga0187769_100259626 | 3300018086 | Tropical Peatland | MADAVAVPQVQPLQPVLRVLRILPGVLLLAAIGYGGKLLEQDVGAF |
| Ga0066667_111140121 | 3300018433 | Grasslands Soil | MADVITVPQVQPVQPALRFLRVIPGVLLLAAVGYAGKLLEQN |
| Ga0179594_102147003 | 3300020170 | Vadose Zone Soil | MADVITVPQVQPVQPALRFLRVIPGVLLLAAVGYAGKLLEQ |
| Ga0210407_100042031 | 3300020579 | Soil | MADAVAVSQVQPLQPALRFLRVIPGVLLLAAIGYAGKLLEQNLGAYAKAHHWVFP |
| Ga0210407_100695165 | 3300020579 | Soil | MADVVVVPQVKPVQPALRFLRIIPGVLLLAAIGYAGKLVEQNVGAYAKAHHWVFPN |
| Ga0210407_112630923 | 3300020579 | Soil | MADVITVPQVQPVQPALRFFRVIPGVLLLAAVGYTGKLLEQNVGAYA |
| Ga0210399_105645372 | 3300020581 | Soil | MADAVAVPQVQPLQPALRFVRVIPGVLLLAAIGYAGKLLEQ |
| Ga0210401_109020791 | 3300020583 | Soil | MADAVVVPQVQPLQPALRFLRVIPGVLLLAAIGYAGK |
| Ga0210406_106726621 | 3300021168 | Soil | MADVITVPQVRPAQPTLQFLRVIPGILLLAAVGYA |
| Ga0210393_108225861 | 3300021401 | Soil | MADVVVVPQVKPVQPALRFLRIIPGVLLLAAIGYAGKLLEQNVGAYAKAHHWVFPN |
| Ga0210387_106061201 | 3300021405 | Soil | MADAVVVPQVQPLQPALRFVRVIPGVLLLAAIGYAGKLLEQNLGAYAKAHH |
| Ga0210386_117370403 | 3300021406 | Soil | MADVVVVPQVKPVQPALRFLRIIPGVLLLAAIGYAGK |
| Ga0210383_110402473 | 3300021407 | Soil | MADAVVIPQVQPMQPALRFLRLIPGVLLLAAIGYAGKLLEQNVGRYAKAHHWVFPN |
| Ga0210402_108433273 | 3300021478 | Soil | MADVITVPQVQPVQPALRLLRVIPGVLLLAAIGYA |
| Ga0210402_118588703 | 3300021478 | Soil | MADAVAVPQVQPWQPALRFLRVIPGVLLLAAIGYAGKLLEQNLGAYAKAHHWVFPNI |
| Ga0210409_116816671 | 3300021559 | Soil | MADVVTVPQVQPVQPALRFLRVIPGVLLLAAVGYAGKLL |
| Ga0242655_102178191 | 3300022532 | Soil | MADVITVPHVQPAQPALRFLRVIPGVLLLAAIGYAGKL |
| Ga0242655_103013771 | 3300022532 | Soil | MAEVITVPQVQPVQPALRFLRVIPGVLLLAAVGYAGKL |
| Ga0224564_10851631 | 3300024271 | Soil | MADAVVIPQVQPVQPALRFLRLIPGVLLLAAIGYAGKLLEQNVGRYAKAHHWVFP |
| Ga0224564_10876363 | 3300024271 | Soil | MADAVVIPQVQPVQPALRFLRLIPGVLLLAAIGYAGKLLEQNVGRYAKAQHWV |
| Ga0137417_12731961 | 3300024330 | Vadose Zone Soil | MAEAITVPQVRPVQPALRFLRVIPGVLLLAAVGYA |
| Ga0137417_150214010 | 3300024330 | Vadose Zone Soil | MAEAITVPQVRPVQPALRFLRVIPGVLLLAAVGYAGQTA |
| Ga0207663_111900661 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MASSVAVAQVRPVNPALQFLKLVPGVLLLAGVGYAGKLLE |
| Ga0207700_113421853 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGSVALPQSQVQSHQPALQFLHVIPGVLLLAGVGYAGKLLEKNLGA |
| Ga0207711_119868351 | 3300025941 | Switchgrass Rhizosphere | MASSVAVAQVRPVNPVLQFLKLVPGVLLLAGVGYAGK |
| Ga0209268_11140871 | 3300026314 | Soil | MADVITVPQVQPVQPALRFLRVIPGVLLLAAVGYAGKLLE |
| Ga0209806_12440402 | 3300026529 | Soil | MADVITVTQVQLVQPVFRYLRAIPGVLLLFAIGYAGK |
| Ga0207948_10106301 | 3300027174 | Forest Soil | MADAVVIPHVQPVQPALRFLRLIPGVLLLAAIGYAGKLLEQNVGKYAKAHHWVF |
| Ga0209447_101768581 | 3300027701 | Bog Forest Soil | MADAVVIPQVQPVQPALRFLRLIPGVLLLAAIGYAGKLLEQNVGKYAKAHHWVFP |
| Ga0209656_103281533 | 3300027812 | Bog Forest Soil | MADAVVIPQVQPVQPALRFLRLIPGVLLLAAIGYAGKLLEQNVGKYAKAH |
| Ga0209180_106347011 | 3300027846 | Vadose Zone Soil | MADVITVPQVQPVQPALRFLRVIPGVLLLAAVGYAG |
| Ga0209275_102361001 | 3300027884 | Soil | MADAVVIPQVQPVQPALRFLRLIPGVLLLAAIGYAGKLLEQNVGRYAKA |
| Ga0247675_10564193 | 3300028072 | Soil | MASSVTVAQVRPANPGLRFLKLVPGLLLLAGVGYAGKL |
| Ga0137415_105439453 | 3300028536 | Vadose Zone Soil | MADVITVPQVQPVQPALRFLRVIPGVLLLAAVGYAGKL |
| Ga0222749_102588323 | 3300029636 | Soil | MADVITVPQVQPVQPALKILRVIPGVLLLAAIGYAGKLLEQNVGAFA |
| Ga0265770_10010981 | 3300030878 | Soil | MADAVVIPQVEPVQPALRFLRLIPGVLLLAAIGYAGKLLEQNVGKYA |
| Ga0170834_1101331081 | 3300031057 | Forest Soil | MADAIALPQARPAQPALQFLRVIPGVLLLAAVGYA |
| Ga0170823_101975531 | 3300031128 | Forest Soil | MADVITVPQVQPVQPALRFLRVIPGILLLAVVGYAGKL |
| Ga0170824_1057540543 | 3300031231 | Forest Soil | MASSIAVAQVRPVNPALQFLKIVPGVLLLAVVGYAGKL |
| Ga0170820_166362693 | 3300031446 | Forest Soil | MASSIAISQVRPVNPGLQFLKIVPGVLLLAAVGYAGKLLEANVGKY |
| Ga0170819_148140633 | 3300031469 | Forest Soil | MADAIVIPQVQPVQPALRFLRIVPGVLLLAAIGYA |
| Ga0306918_104849861 | 3300031744 | Soil | MADVIVIPQAQPVETRLPFLRVIPGVLLLAAVGYGGKFLEQNVNA |
| Ga0307477_106358361 | 3300031753 | Hardwood Forest Soil | MADVIVVPQAQPVQPVLRFLRVIPGVLLLAAIGYAGKLLEQNGG |
| Ga0306923_105722354 | 3300031910 | Soil | MASSVAMVGVRPVNPALQFFRVVPGILLLVAVGYAGKLLESSV |
| Ga0307479_116903451 | 3300031962 | Hardwood Forest Soil | MADVITVPQVQPVQPALRFLRVIPGVLLLAAVGYA |
| Ga0307471_1013232861 | 3300032180 | Hardwood Forest Soil | MADVITVPQVQPVQPALRLLRVIPGVLLLAAIGYAGKLLEQNVGAFAKAHH |
| Ga0335073_100826236 | 3300033134 | Soil | MADAVVIPQIQPVQPALRFLRIIPGVLLLAAIGYAG |
| ⦗Top⦘ |