NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F098067

Metagenome Family F098067

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098067
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 52 residues
Representative Sequence MKWIMNRLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK
Number of Associated Samples 72
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 46.15 %
% of genes near scaffold ends (potentially truncated) 40.38 %
% of genes from short scaffolds (< 2000 bps) 75.00 %
Associated GOLD sequencing projects 55
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group unclassified viruses (39.423 % of family members)
NCBI Taxonomy ID 12429
Taxonomy All Organisms → Viruses → unclassified viruses

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(35.577 % of family members)
Environment Ontology (ENVO) Unclassified
(88.462 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(88.462 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 26.42%    β-sheet: 26.42%    Coil/Unstructured: 47.17%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF00166Cpn10 1.92
PF03237Terminase_6N 1.92
PF10124Mu-like_gpT 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 1.92

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.42 %
UnclassifiedrootN/A35.58 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10032226All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → unclassified Acidithiobacillales → Acidithiobacillales bacterium SM23_462861Open in IMG/M
3300000101|DelMOSum2010_c10058333Not Available1874Open in IMG/M
3300000101|DelMOSum2010_c10089116All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1329Open in IMG/M
3300000101|DelMOSum2010_c10133463All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.947Open in IMG/M
3300001450|JGI24006J15134_10050198Not Available1709Open in IMG/M
3300001450|JGI24006J15134_10050351All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.1706Open in IMG/M
3300001450|JGI24006J15134_10091756Not Available1109Open in IMG/M
3300001472|JGI24004J15324_10035901All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1569Open in IMG/M
3300001589|JGI24005J15628_10049011All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1643Open in IMG/M
3300001589|JGI24005J15628_10071025Not Available1259Open in IMG/M
3300004097|Ga0055584_100062706Not Available3671Open in IMG/M
3300004097|Ga0055584_100263276Not Available1762Open in IMG/M
3300004448|Ga0065861_1032987Not Available1277Open in IMG/M
3300004448|Ga0065861_1079442All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2076Open in IMG/M
3300004448|Ga0065861_1138306Not Available762Open in IMG/M
3300004457|Ga0066224_1107423All Organisms → Viruses → Predicted Viral1273Open in IMG/M
3300004460|Ga0066222_1045312Not Available1843Open in IMG/M
3300004460|Ga0066222_1195904All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1726Open in IMG/M
3300006029|Ga0075466_1083502Not Available888Open in IMG/M
3300006164|Ga0075441_10047195All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1716Open in IMG/M
3300006164|Ga0075441_10085960All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1214Open in IMG/M
3300006164|Ga0075441_10231983Not Available682Open in IMG/M
3300006164|Ga0075441_10316852All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.568Open in IMG/M
3300006190|Ga0075446_10025200Not Available1960Open in IMG/M
3300006190|Ga0075446_10087043Not Available927Open in IMG/M
3300006190|Ga0075446_10098643All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium857Open in IMG/M
3300006191|Ga0075447_10270246All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.548Open in IMG/M
3300006193|Ga0075445_10046826All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1731Open in IMG/M
3300006735|Ga0098038_1000681All Organisms → cellular organisms → Bacteria14803Open in IMG/M
3300006735|Ga0098038_1009474Not Available3840Open in IMG/M
3300006737|Ga0098037_1066402Not Available1281Open in IMG/M
3300006916|Ga0070750_10208662All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.861Open in IMG/M
3300006919|Ga0070746_10162384Not Available1082Open in IMG/M
3300006920|Ga0070748_1134828Not Available924Open in IMG/M
3300006928|Ga0098041_1011323Not Available2969Open in IMG/M
3300006928|Ga0098041_1191248Not Available656Open in IMG/M
3300006947|Ga0075444_10277548All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.652Open in IMG/M
3300006990|Ga0098046_1080527All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes734Open in IMG/M
3300007344|Ga0070745_1245185All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.649Open in IMG/M
3300007539|Ga0099849_1324318Not Available552Open in IMG/M
3300007540|Ga0099847_1095368All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.908Open in IMG/M
3300007640|Ga0070751_1128953All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1025Open in IMG/M
3300008221|Ga0114916_1009947Not Available3789Open in IMG/M
3300009149|Ga0114918_10045157Not Available3006Open in IMG/M
3300009173|Ga0114996_10872622All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.646Open in IMG/M
3300009425|Ga0114997_10199310Not Available1153Open in IMG/M
3300009428|Ga0114915_1005966Not Available4896Open in IMG/M
3300009428|Ga0114915_1014489All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2933Open in IMG/M
3300009437|Ga0115556_1167943Not Available802Open in IMG/M
3300009512|Ga0115003_10105494All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1732Open in IMG/M
3300009512|Ga0115003_10535584Not Available685Open in IMG/M
3300009601|Ga0114914_1019980All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1201Open in IMG/M
3300009622|Ga0105173_1086361All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.565Open in IMG/M
3300009705|Ga0115000_10719816All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.616Open in IMG/M
3300009785|Ga0115001_10080558Not Available2135Open in IMG/M
3300010149|Ga0098049_1014318All Organisms → Viruses → Predicted Viral2654Open in IMG/M
3300017764|Ga0181385_1160635Not Available681Open in IMG/M
3300017772|Ga0181430_1005915All Organisms → cellular organisms → Bacteria4438Open in IMG/M
3300020165|Ga0206125_10009643Not Available7027Open in IMG/M
3300020165|Ga0206125_10270327All Organisms → Viruses643Open in IMG/M
3300021365|Ga0206123_10361724All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.605Open in IMG/M
3300022074|Ga0224906_1065420All Organisms → cellular organisms → Bacteria → Proteobacteria1130Open in IMG/M
3300022187|Ga0196899_1216844All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.501Open in IMG/M
3300024262|Ga0210003_1062067All Organisms → cellular organisms → Bacteria1839Open in IMG/M
3300025048|Ga0207905_1009966All Organisms → Viruses → Predicted Viral1675Open in IMG/M
3300025086|Ga0208157_1050769All Organisms → Viruses1115Open in IMG/M
3300025102|Ga0208666_1007843Not Available3840Open in IMG/M
3300025132|Ga0209232_1013461Not Available3318Open in IMG/M
3300025137|Ga0209336_10004010Not Available6713Open in IMG/M
3300025137|Ga0209336_10032344All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1746Open in IMG/M
3300025138|Ga0209634_1083336Not Available1462Open in IMG/M
3300025138|Ga0209634_1105983Not Available1232Open in IMG/M
3300025138|Ga0209634_1273036All Organisms → Viruses598Open in IMG/M
3300025168|Ga0209337_1037891All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2607Open in IMG/M
3300025168|Ga0209337_1041342All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → unclassified Acidithiobacillales → Acidithiobacillales bacterium SM23_462463Open in IMG/M
3300025168|Ga0209337_1297883All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.586Open in IMG/M
3300025237|Ga0208031_1010983All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.1239Open in IMG/M
3300025237|Ga0208031_1018884All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.930Open in IMG/M
3300025237|Ga0208031_1030064Not Available716Open in IMG/M
3300025237|Ga0208031_1036432All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.638Open in IMG/M
3300025266|Ga0208032_1005038All Organisms → Viruses4732Open in IMG/M
3300025266|Ga0208032_1036334All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1260Open in IMG/M
3300025276|Ga0208814_1023395Not Available2036Open in IMG/M
3300025652|Ga0208134_1009642All Organisms → Viruses4112Open in IMG/M
3300025652|Ga0208134_1012274All Organisms → Viruses3484Open in IMG/M
3300027522|Ga0209384_1013127All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2847Open in IMG/M
3300027668|Ga0209482_1047630All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1590Open in IMG/M
3300027672|Ga0209383_1102890All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.953Open in IMG/M
3300027672|Ga0209383_1184427All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.621Open in IMG/M
3300027687|Ga0209710_1148959All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.852Open in IMG/M
3300027704|Ga0209816_1062729All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1604Open in IMG/M
3300027714|Ga0209815_1052959All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1465Open in IMG/M
3300027788|Ga0209711_10257230All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.775Open in IMG/M
3300027788|Ga0209711_10436228Not Available528Open in IMG/M
3300031566|Ga0307378_10806888All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.790Open in IMG/M
3300031605|Ga0302132_10002619All Organisms → cellular organisms → Bacteria10292Open in IMG/M
3300031608|Ga0307999_1007609All Organisms → Viruses2836Open in IMG/M
3300031629|Ga0307985_10349550All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.574Open in IMG/M
3300031637|Ga0302138_10272320All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.549Open in IMG/M
3300031675|Ga0302122_10168121All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.853Open in IMG/M
3300031695|Ga0308016_10071973All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1435Open in IMG/M
3300031703|Ga0308002_1097002All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.634Open in IMG/M
3300033742|Ga0314858_058308All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.946Open in IMG/M
3300034418|Ga0348337_128356All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.762Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine35.58%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine15.38%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous11.54%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean10.58%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine5.77%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.85%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine3.85%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater2.88%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.88%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.92%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.92%
Marine OceanicEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic0.96%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.96%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.96%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006190Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNAEnvironmentalOpen in IMG/M
3300006191Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNAEnvironmentalOpen in IMG/M
3300006193Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300008221Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009173Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009601Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38EnvironmentalOpen in IMG/M
3300009622Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025048Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025237Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 (SPAdes)EnvironmentalOpen in IMG/M
3300025266Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300027522Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027672Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027704Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027788Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031605Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1EnvironmentalOpen in IMG/M
3300031608Marine microbial communities from water near the shore, Antarctic Ocean - #1EnvironmentalOpen in IMG/M
3300031629Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80EnvironmentalOpen in IMG/M
3300031637Marine microbial communities from Western Arctic Ocean, Canada - CBN3_32.1EnvironmentalOpen in IMG/M
3300031675Marine microbial communities from Western Arctic Ocean, Canada - CB21_SCMEnvironmentalOpen in IMG/M
3300031695Marine microbial communities from water near the shore, Antarctic Ocean - #233EnvironmentalOpen in IMG/M
3300031703Marine microbial communities from water near the shore, Antarctic Ocean - #34EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1003222663300000101MarineMKWIMNRLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAVLGLILSEEAKK*
DelMOSum2010_1005833343300000101MarineMNWIKKRLSEPSSWGSIGVGVIAIGTISGIGELVFVGLGCAILGLILSEEAKK*
DelMOSum2010_1008911613300000101MarineMKWIMNRLSEPSSYAAAGVGVIAVGTISGIGELVFVGLGCAILGLILSEEAKK*
DelMOSum2010_1013346313300000101MarineMKWIMNRLSEPSSYAAAGVGVIAVGTISGIGELVFVGLGCAILGLILSEE
JGI24006J15134_1005019843300001450MarineSSWGAIGLVLIGCGIIFSITEIIMIGVGCGILGLILSEEAKK*
JGI24006J15134_1005035113300001450MarineYNMKWIMNRLSEPSSYAAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK*
JGI24006J15134_1009175613300001450MarineMKWIMNRLSEPSSWGAIGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK*
JGI24004J15324_1003590113300001472MarineNRLSEPSSYAAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK*
JGI24005J15628_1004901123300001589MarineEEYNMKWIMNRLSEPSSYAAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK*
JGI24005J15628_1007102513300001589MarineMIKWITGRLSEPSSYAAIGVGVIAVGTISGIGELVFVGLGCAILGLILSEXAKK*
Ga0055584_10006270663300004097Pelagic MarineMKWIMNRLSEPSSYAAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK*
Ga0055584_10026327623300004097Pelagic MarineMIKWITGRLSEPSSYAAIGVGVIAVGTISGIGELVFVGLGCAILGLILSEEAKK*
Ga0065861_103298733300004448MarineMKWIMNRLSEPSSWGAIGVGVIAVGTISGIGELVFVGLGCAILGLILSEEAKK*
Ga0065861_107944233300004448MarineMKWIMNRLSEPSSWGAIGVGVIAIGTISGIGELVFVGLGCAILGLILSEEAKK*
Ga0065861_113830623300004448MarineMKWIMNRLSEPSSWGAIGLVLIGCGIIFSITEIIMIGVGCGILGLILSEEAKK*
Ga0066224_110742323300004457MarineNMKWIMNRLSEPSSWGAIGVGVIAIGTISGIGELVFVGLGCAILGLILSEEAKK*
Ga0066222_104531213300004460MarineNRLSEPSSWGAIGVGVIAVGTISGIGELVFVGLGCAILGLILSEEAKK*
Ga0066222_119590433300004460MarineNRLSEPSSYAAAGVGVIAVGIIFSITEIIMIGVGCGILGLILSEEAKK*
Ga0075466_108350233300006029AqueousMKWIMNRLSEPSSYAAAGVGVIAVGTISGIGELVFVGLGCAILGLILSEDAKK*
Ga0075441_1004719513300006164MarineNRLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK*
Ga0075441_1008596013300006164MarineEYNMKWIMNRLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK*
Ga0075441_1023198323300006164MarineMKWILNRLSEPSSWGAIGVGVIAVGTIIGIGELVFVGLGCAILGLILSEEAKK*
Ga0075441_1031685223300006164MarineMNWIKKRLSEPSSWGSIGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK*
Ga0075446_1002520013300006190MarineMNWIKKRLSEPSSWGAIGVGVIAVGTITGIGELVFVGLGCAILGLILSEEAKK*
Ga0075446_1008704323300006190MarineMNWIINRLSEPSSWGAIGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK*
Ga0075446_1009864313300006190MarineLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK*
Ga0075447_1027024623300006191MarineTKRKEYNMKWIMNRLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK
Ga0075445_1004682613300006193MarineKWIMNRLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK*
Ga0098038_1000681193300006735MarineMKWIMNRLSEPSSWGAVGIGIIALSLILGLGGEGLFIGLGCSVLGLILSEKAKK*
Ga0098038_100947433300006735MarineMKRLSEPSSWGAIGLGIVALGSIFGLGGEALFIGLGCAVLGLILSEEAKK*
Ga0098037_106640233300006737MarineMKWIMKRLSEPSSWGAIGLGIVALGSIFGLGGEALFIGLGCAVLGLILSEEAKK*
Ga0070750_1020866233300006916AqueousMNRLSEPSSYAAAGVGVIAVGTISGIGELVFVGLGCAILGLILSEEAKK*
Ga0070746_1016238413300006919AqueousMKWIMNRLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAVLGLILSE
Ga0070748_113482813300006920AqueousEPSSWGSIGVGVIAIGTISGIGELVFVGLGCAILGLILSEEAKK*
Ga0098041_101132313300006928MarineMKWIMNRLSEPSSWGAVGIGIIALSLILGLGGEGLFIGLGCSVLG
Ga0098041_119124813300006928MarineMDWIKGRLKEPSSWGAIGIGIIALSLILGLGGEGLFIGLGCSVLGL
Ga0075444_1027754823300006947MarineIMNRLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK*
Ga0098046_108052723300006990MarineMKWIMKRLSEPSSWGTIGLGIVALGSIFGLGGEALFIGLGCAVLGLILSEEAKK*
Ga0070745_124518533300007344AqueousMKWIMNRLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK*
Ga0099849_132431833300007539AqueousMKWIMNRLSEPSSYAAIGVGVIAVGTIVGIGELVFVGLGCAILGLIL
Ga0099847_109536833300007540AqueousMKWIMNRLSEPSSWGAIGVGVIAVGKIVGIGELVFVGLGCAVLGLILSEEAKK*
Ga0070751_112895333300007640AqueousMKWIMNRLSEPSSYAAIGVGVIAVGTIVGIGELVFVGLGCAVLGLILSEEAKK*
Ga0114916_100994783300008221Deep OceanMNWIKKRLSEPSSWGAIGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK*
Ga0114918_1004515733300009149Deep SubsurfaceMIKWISGRLSEPSSYAAIGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK*
Ga0114996_1087262223300009173MarineMTWILKRLSEPSSWGAIGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK*
Ga0114997_1019931033300009425MarineMNWIKKRLSEPSSWGALGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK*
Ga0114915_100596613300009428Deep OceanNKKMNWIKKRLSEPSSWGAIGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK*
Ga0114915_101448913300009428Deep OceanKRKEYNMKWIMNRLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK*
Ga0115556_116794343300009437Pelagic MarineMKWIMNRLSEPSSYAAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSE
Ga0115003_1010549413300009512MarineNMKWIMNRLSEPSSWGAIGVGVIAVGTISGIGELVFVGLGCAILGLILSEEAKK*
Ga0115003_1053558413300009512MarineNMKWIMNRLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK*
Ga0114914_101998023300009601Deep OceanMKWIINRLSEPSSWGAIGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK*
Ga0105173_108636143300009622Marine OceanicILNRLSEPSSWGAIGVGVIAVGTIIGIGELVFVGLGCAILGLILSEEAKK*
Ga0115000_1071981613300009705MarineMNRLSEPSSWGAIGLVLIGCGIIFSITEIIMIGVGCGILGLILSEEAKK*
Ga0115001_1008055833300009785MarineMTWIMKRLSEPSSWGALGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK*
Ga0098049_101431813300010149MarineMKWIMNRLSEPSSWGAVGIGIIALTLILGLGGEGLFIGLGCSVLGLILSEKAKK*
Ga0181385_116063513300017764SeawaterKWIMNRISEPSSWGAIGIGIIALSLILGLGGEGLFIGLGCSVLGLILSEKAKK
Ga0181430_100591543300017772SeawaterMKRLSEPSSWGAIGLGIIALGSIFGLGGEALFIGLGCAVLGLILSEEAKK
Ga0206125_10009643123300020165SeawaterMIKWITGRLSEPSSYAAIGVGVIAVGTISGIGELVFVGLGCAILGLILSEEAKK
Ga0206125_1027032723300020165SeawaterMNWIKKRLSEPSSWGSIGVGVIAIGTISGIGELVFVGLGCAILGLILSEEAKK
Ga0206123_1036172423300021365SeawaterMKWIMNRLSEPSSYAAAGVGVIAVGTISGIGELVFVGLGCAILGLILSEEAKK
Ga0224906_106542033300022074SeawaterMKWIMKRLSEPSSWGAIGLGIIALGSIFGLGGEALFIGLGCAVLGLILSEEAKK
Ga0196899_121684413300022187AqueousMKWIMNRLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAVLGLILSEEAKK
Ga0210003_106206743300024262Deep SubsurfaceMIKWISGRLSEPSSYAAIGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK
Ga0207905_100996653300025048MarineMKWIMNRLSEPSSYAAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK
Ga0208157_105076923300025086MarineMKWIMKRLSEPSSWGAIGLGIVALGSIFGLGGEALFIGLGCAVLGLILSEEAKK
Ga0208666_100784333300025102MarineMKRLSEPSSWGAIGLGIVALGSIFGLGGEALFIGLGCAVLGLILSEEAKK
Ga0209232_101346143300025132MarineMKWIMNRISEPSSWGAIGIGIIALSLILGLGGEGLFIGLGCSVLGLILSEKAKK
Ga0209336_1000401083300025137MarineMNRLSEPSSWGAIGVGVIAVGTIAGIGELVFVGLGCAVLGLILSEEAKK
Ga0209336_1003234413300025137MarineMNRLSEPSSYAAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK
Ga0209634_108333653300025138MarineMKWIMNRLSEPSSWGAIGVGVIAVGTIAGIGELVFVGLGCAVLGLILSEEAKK
Ga0209634_110598313300025138MarineMKWIMNRLSEPSSWGAIGVGVIAVGTITGIGELVFVGLGCAILGLILSEEAKK
Ga0209634_127303633300025138MarineMNWIKKRLSEPSSWGALGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK
Ga0209337_103789153300025168MarineMNWILKRLSEPSSWGAIGVGVIAVGTITGIGELVFVGLGCAILGLILSEEAKK
Ga0209337_104134233300025168MarineSEPSSYAAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK
Ga0209337_129788333300025168MarineMNWIKKRLSEPSSWGSIGVGVIAVGTISGIGELVFVGLGCAILGLILSEEAKK
Ga0208031_101098323300025237Deep OceanMKWIMNRLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK
Ga0208031_101888413300025237Deep OceanMNWIKKRLSEPSSWGAIGVGVIAVGTITGIGELVFVGLGCAILGLILSEEAKK
Ga0208031_103006423300025237Deep OceanMKWILNRLSEPSSWGAIGVGVIAVGTIIGIGELVFVGLGCAILGLILSEEAKK
Ga0208031_103643223300025237Deep OceanMNWIKKRLSEPSSWGSIGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK
Ga0208032_100503823300025266Deep OceanMNWIINRLSEPSSWGAIGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK
Ga0208032_103633433300025266Deep OceanMNWIKKRLSEPSSWGAIGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK
Ga0208814_102339553300025276Deep OceanNKKMNWIKKRLSEPSSWGAIGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK
Ga0208134_100964283300025652AqueousMNWIKKRLSEPSSWGSIGVGVIAIGTISGIGELVFVGLGCAILGLILSE
Ga0208134_101227413300025652AqueousNWIKKRLSEPSSWGSIGVGVIAIGTISGIGELVFVGLGCAILGLILSEEAKK
Ga0209384_101312713300027522MarineRKEYNMKWIMNRLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK
Ga0209482_104763033300027668MarineMNRLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK
Ga0209383_110289023300027672MarineKWIMNRLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK
Ga0209383_118442713300027672MarineKKRLSEPSSWGAIGVGVIAVGTITGIGELVFVGLGCAILGLILSEEAKK
Ga0209710_114895913300027687MarineMKWIMNRLSEPSSWGAIGVGVIAIGTISGIGELVFVGLGCAILGLILSEEAKK
Ga0209816_106272913300027704MarineKWIINRLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK
Ga0209815_105295933300027714MarineNRLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK
Ga0209711_1025723023300027788MarineMKWIMNRLSEPSSWGAIGVGVIAVGTISGIGELVFVGLGCAILGLILSEEAKK
Ga0209711_1043622823300027788MarineMIKWITGRLSEPSSYAAIGVGVIAIGTISGIGELVFVGLGCAILGLILSEEAKK
Ga0307378_1080688823300031566SoilMTWILNRLSEPSSWGAIGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK
Ga0302132_1000261993300031605MarineMTWILKRLSEPSSWGAIGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK
Ga0307999_100760913300031608MarineMNWIINRLSEPSSWGAIGVGVIAVGTITGIGELVFVGLGCAILGLILSEEAKK
Ga0307985_1034955013300031629MarineMKWIINRLSEPSSWGAIGVGVIAVGTIVGIGELVFVGLGCAILGLILSEEAKK
Ga0302138_1027232023300031637MarineMTWIMKRLSEPSSWGALGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK
Ga0302122_1016812143300031675MarineMKWIMNRLSEPSSWGAIGVGVIAVGTISGIGELVFVGLGCAILG
Ga0308016_1007197333300031695MarineMNWIINRLSEPSSWGAIGVGVIAVGTITGIGELVFVGLGCAILGLILS
Ga0308002_109700213300031703MarineNRLSEPSSWGAIGVGVIAIGTITGIGELVFVGLGCAILGLILSEEAKK
Ga0314858_058308_8_1573300033742Sea-Ice BrineMSRLSEPSSWGAIGVGVIAIGTISGIGELVFVGLGCAILGLILSEEAKK
Ga0348337_128356_213_3743300034418AqueousMKWIMNRLSEPSSYAAIGVGVIAVGTIVGIGELVFVGLGCAVLGLILSEEAKK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.