| Basic Information | |
|---|---|
| Family ID | F098027 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIK |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 80.77 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.038 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine (16.346 % of family members) |
| Environment Ontology (ENVO) | Unclassified (71.154 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.462 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.56% β-sheet: 0.00% Coil/Unstructured: 67.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF03171 | 2OG-FeII_Oxy | 39.42 |
| PF01266 | DAO | 24.04 |
| PF14226 | DIOX_N | 19.23 |
| PF00892 | EamA | 4.81 |
| PF09928 | DUF2160 | 2.88 |
| PF05853 | BKACE | 1.92 |
| PF13279 | 4HBT_2 | 0.96 |
| PF05199 | GMC_oxred_C | 0.96 |
| PF00491 | Arginase | 0.96 |
| PF00528 | BPD_transp_1 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 1.92 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.96 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.04 % |
| Unclassified | root | N/A | 0.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10158270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 739 | Open in IMG/M |
| 3300000167|SI39nov09_120mDRAFT_c1016832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2040 | Open in IMG/M |
| 3300000170|SI36aug09_135mDRAFT_c1005860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3208 | Open in IMG/M |
| 3300000187|SI53jan11_100mDRAFT_c1001204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 8440 | Open in IMG/M |
| 3300000212|SI47jul10_120mDRAFT_c1021503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1444 | Open in IMG/M |
| 3300000226|SI34jun09_135mDRAFT_1010101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3312 | Open in IMG/M |
| 3300000226|SI34jun09_135mDRAFT_1017253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2242 | Open in IMG/M |
| 3300000254|SI34jun09_100mDRAFT_1016644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1774 | Open in IMG/M |
| 3300000325|SI39nov09_100mDRAFT_1067678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 552 | Open in IMG/M |
| 3300001346|JGI20151J14362_10055330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1679 | Open in IMG/M |
| 3300001346|JGI20151J14362_10107153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 942 | Open in IMG/M |
| 3300001347|JGI20156J14371_10089377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1040 | Open in IMG/M |
| 3300001347|JGI20156J14371_10150340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 652 | Open in IMG/M |
| 3300001349|JGI20160J14292_10052643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1818 | Open in IMG/M |
| 3300001349|JGI20160J14292_10142026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 767 | Open in IMG/M |
| 3300001353|JGI20159J14440_10035226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2084 | Open in IMG/M |
| 3300001353|JGI20159J14440_10108108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 867 | Open in IMG/M |
| 3300001354|JGI20155J14468_10060515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1529 | Open in IMG/M |
| 3300002242|KVWGV2_10902369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 566 | Open in IMG/M |
| 3300003264|JGI26119J46589_1001676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3270 | Open in IMG/M |
| 3300003478|JGI26238J51125_1049582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 865 | Open in IMG/M |
| 3300003500|JGI26242J51144_1008303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2259 | Open in IMG/M |
| 3300003500|JGI26242J51144_1028551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 992 | Open in IMG/M |
| 3300003619|JGI26380J51729_10019412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2107 | Open in IMG/M |
| 3300004276|Ga0066610_10015022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3098 | Open in IMG/M |
| 3300004277|Ga0066611_10194130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 695 | Open in IMG/M |
| 3300004278|Ga0066609_10274912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 525 | Open in IMG/M |
| 3300005838|Ga0008649_10038190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2196 | Open in IMG/M |
| 3300005838|Ga0008649_10236164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 699 | Open in IMG/M |
| 3300006166|Ga0066836_10036072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2792 | Open in IMG/M |
| 3300006166|Ga0066836_10530817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 712 | Open in IMG/M |
| 3300009071|Ga0115566_10292988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 962 | Open in IMG/M |
| 3300009077|Ga0115552_1351600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 584 | Open in IMG/M |
| 3300009193|Ga0115551_1213648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 863 | Open in IMG/M |
| 3300009437|Ga0115556_1051075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1704 | Open in IMG/M |
| 3300009467|Ga0115565_10217690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 878 | Open in IMG/M |
| 3300009593|Ga0115011_10082352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2245 | Open in IMG/M |
| 3300009790|Ga0115012_10626591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 855 | Open in IMG/M |
| 3300009790|Ga0115012_10973708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 699 | Open in IMG/M |
| 3300012936|Ga0163109_10482005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 908 | Open in IMG/M |
| 3300012954|Ga0163111_10530812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1089 | Open in IMG/M |
| 3300012954|Ga0163111_12412395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 534 | Open in IMG/M |
| 3300017730|Ga0181417_1041197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1133 | Open in IMG/M |
| 3300017731|Ga0181416_1033361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1209 | Open in IMG/M |
| 3300017735|Ga0181431_1058488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 869 | Open in IMG/M |
| 3300017735|Ga0181431_1139201 | Not Available | 540 | Open in IMG/M |
| 3300017741|Ga0181421_1172491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 557 | Open in IMG/M |
| 3300017752|Ga0181400_1101185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 846 | Open in IMG/M |
| 3300017755|Ga0181411_1099469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 860 | Open in IMG/M |
| 3300017768|Ga0187220_1080087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 985 | Open in IMG/M |
| 3300017771|Ga0181425_1147989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 745 | Open in IMG/M |
| 3300017781|Ga0181423_1145609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 914 | Open in IMG/M |
| 3300017949|Ga0181584_10181485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1394 | Open in IMG/M |
| 3300017951|Ga0181577_10250503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1165 | Open in IMG/M |
| 3300017957|Ga0181571_10256847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1113 | Open in IMG/M |
| 3300017985|Ga0181576_10482768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 763 | Open in IMG/M |
| 3300018417|Ga0181558_10603272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 564 | Open in IMG/M |
| 3300020182|Ga0206129_10044297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2895 | Open in IMG/M |
| 3300020191|Ga0181604_10053481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2350 | Open in IMG/M |
| 3300020194|Ga0181597_10084061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1818 | Open in IMG/M |
| 3300020318|Ga0211491_1004246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2150 | Open in IMG/M |
| 3300020438|Ga0211576_10334989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 782 | Open in IMG/M |
| 3300020438|Ga0211576_10394643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 708 | Open in IMG/M |
| 3300020454|Ga0211548_10159644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1089 | Open in IMG/M |
| 3300020454|Ga0211548_10452757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium BACL20 MAG-120920-bin64 | 629 | Open in IMG/M |
| 3300020462|Ga0211546_10149975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1152 | Open in IMG/M |
| 3300020475|Ga0211541_10451078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 629 | Open in IMG/M |
| 3300021068|Ga0206684_1024877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2130 | Open in IMG/M |
| 3300021378|Ga0213861_10260496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 910 | Open in IMG/M |
| 3300022907|Ga0255775_1058845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1859 | Open in IMG/M |
| 3300022927|Ga0255769_10121437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1280 | Open in IMG/M |
| 3300023172|Ga0255766_10175425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1196 | Open in IMG/M |
| 3300024226|Ga0228667_1085449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 594 | Open in IMG/M |
| (restricted) 3300024243|Ga0233436_1096089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 973 | Open in IMG/M |
| 3300024247|Ga0228675_1048093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 912 | Open in IMG/M |
| 3300024248|Ga0228676_1031688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1220 | Open in IMG/M |
| 3300024250|Ga0228677_1015442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1354 | Open in IMG/M |
| (restricted) 3300024256|Ga0233446_1134630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 695 | Open in IMG/M |
| 3300024301|Ga0233451_10040744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 2784 | Open in IMG/M |
| (restricted) 3300024302|Ga0233449_1005154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 8553 | Open in IMG/M |
| 3300024313|Ga0228624_1065087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 696 | Open in IMG/M |
| 3300024329|Ga0228631_1025196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1841 | Open in IMG/M |
| 3300024329|Ga0228631_1038333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1371 | Open in IMG/M |
| 3300024417|Ga0228650_1037795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1424 | Open in IMG/M |
| 3300024420|Ga0228632_1069400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 825 | Open in IMG/M |
| 3300025685|Ga0209095_1171784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 617 | Open in IMG/M |
| 3300025770|Ga0209362_1161007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 782 | Open in IMG/M |
| 3300025892|Ga0209630_10242093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 852 | Open in IMG/M |
| 3300026077|Ga0208749_1037122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1030 | Open in IMG/M |
| 3300026183|Ga0209932_1029350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1401 | Open in IMG/M |
| 3300026292|Ga0208277_1135177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 847 | Open in IMG/M |
| 3300027406|Ga0208965_1102931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 560 | Open in IMG/M |
| 3300027830|Ga0209359_10271772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 772 | Open in IMG/M |
| 3300028131|Ga0228642_1067831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 938 | Open in IMG/M |
| 3300028277|Ga0257116_1002452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 10095 | Open in IMG/M |
| 3300028287|Ga0257126_1115802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 938 | Open in IMG/M |
| 3300028414|Ga0228627_1047450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1170 | Open in IMG/M |
| 3300031766|Ga0315322_10838002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 564 | Open in IMG/M |
| 3300031851|Ga0315320_10181254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1562 | Open in IMG/M |
| 3300031851|Ga0315320_10732080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 630 | Open in IMG/M |
| 3300031851|Ga0315320_10773304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 606 | Open in IMG/M |
| 3300032011|Ga0315316_10623403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 899 | Open in IMG/M |
| 3300032048|Ga0315329_10169981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1138 | Open in IMG/M |
| 3300032073|Ga0315315_11620127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 556 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 16.35% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 11.54% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 10.58% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 9.62% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 9.62% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.62% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 7.69% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 7.69% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.77% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.88% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.88% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 1.92% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.96% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.96% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.96% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000167 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 120m | Environmental | Open in IMG/M |
| 3300000170 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 135m | Environmental | Open in IMG/M |
| 3300000187 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 53 01/11/11 100m | Environmental | Open in IMG/M |
| 3300000212 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 120m | Environmental | Open in IMG/M |
| 3300000226 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 135m | Environmental | Open in IMG/M |
| 3300000254 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 100m | Environmental | Open in IMG/M |
| 3300000325 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 100m | Environmental | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300003264 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 | Environmental | Open in IMG/M |
| 3300003478 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA | Environmental | Open in IMG/M |
| 3300003500 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_100m_DNA | Environmental | Open in IMG/M |
| 3300003619 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA | Environmental | Open in IMG/M |
| 3300004276 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_165m | Environmental | Open in IMG/M |
| 3300004277 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_200m | Environmental | Open in IMG/M |
| 3300004278 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_150m | Environmental | Open in IMG/M |
| 3300005838 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNA | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020318 | Marine microbial communities from Tara Oceans - TARA_B000000475 (ERX556107-ERR598973) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
| 3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
| 3300021068 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300022907 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
| 3300024226 | Seawater microbial communities from Monterey Bay, California, United States - 81D | Environmental | Open in IMG/M |
| 3300024243 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_150_MG | Environmental | Open in IMG/M |
| 3300024247 | Seawater microbial communities from Monterey Bay, California, United States - 36D_r | Environmental | Open in IMG/M |
| 3300024248 | Seawater microbial communities from Monterey Bay, California, United States - 48D_r | Environmental | Open in IMG/M |
| 3300024250 | Seawater microbial communities from Monterey Bay, California, United States - 58D_r | Environmental | Open in IMG/M |
| 3300024256 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_120_MG | Environmental | Open in IMG/M |
| 3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
| 3300024302 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_200_MG | Environmental | Open in IMG/M |
| 3300024313 | Seawater microbial communities from Monterey Bay, California, United States - 29D | Environmental | Open in IMG/M |
| 3300024329 | Seawater microbial communities from Monterey Bay, California, United States - 39D | Environmental | Open in IMG/M |
| 3300024417 | Seawater microbial communities from Monterey Bay, California, United States - 62D | Environmental | Open in IMG/M |
| 3300024420 | Seawater microbial communities from Monterey Bay, California, United States - 40D | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025770 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026077 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026292 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 (SPAdes) | Environmental | Open in IMG/M |
| 3300027406 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_07_M0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300028131 | Seawater microbial communities from Monterey Bay, California, United States - 53D | Environmental | Open in IMG/M |
| 3300028277 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_120m | Environmental | Open in IMG/M |
| 3300028287 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m | Environmental | Open in IMG/M |
| 3300028414 | Seawater microbial communities from Monterey Bay, California, United States - 33D | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032048 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 32315 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_101582702 | 3300000117 | Marine | SITKVSKFHASSFKLSNLKKDDRSRFRIGYNDELCIALQY* |
| SI39nov09_120mDRAFT_10168324 | 3300000167 | Marine | SKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYI* |
| SI36aug09_135mDRAFT_10058601 | 3300000170 | Marine | ITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYI* |
| SI53jan11_100mDRAFT_10012041 | 3300000187 | Marine | PVGSITKVSKFHASSFKLSNLKKDDRSRFRIGYNDELCIALIK* |
| SI47jul10_120mDRAFT_10215033 | 3300000212 | Marine | CPVGSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIK* |
| SI34jun09_135mDRAFT_10101014 | 3300000226 | Marine | TSSFKLSNLKKDDRSRFRIGYNDELCIALIKQYY* |
| SI34jun09_135mDRAFT_10172535 | 3300000226 | Marine | KFHASSFKLSNLKKDDRSRFRIGFNDELCIALYI* |
| SI34jun09_100mDRAFT_10166443 | 3300000254 | Marine | CPVGSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYI* |
| SI39nov09_100mDRAFT_10676781 | 3300000325 | Marine | RLVSPVSSITKVSKFHTSSFKLSNLKKDDRSRFRIGYNDELCIALIKQYY* |
| JGI20151J14362_100553303 | 3300001346 | Pelagic Marine | VWLVCPVSSITKVSKFHDSSFKLSNLKKDDRSHFRIGFNDELCIALIK* |
| JGI20151J14362_101071532 | 3300001346 | Pelagic Marine | SKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYN* |
| JGI20156J14371_100893771 | 3300001347 | Pelagic Marine | KFHASSFKLSNLKKDDRSRFRIGFNDELCIALIN* |
| JGI20156J14371_101503401 | 3300001347 | Pelagic Marine | KFHASSFKLSNLKKDDRSRFRIGFNDELCIALYN* |
| JGI20160J14292_100526431 | 3300001349 | Pelagic Marine | LVCPVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIK* |
| JGI20160J14292_101420261 | 3300001349 | Pelagic Marine | FHASSFKLSNLKKDDRSRFRIGFNDELCIALILXYY* |
| JGI20159J14440_100352264 | 3300001353 | Pelagic Marine | KFHDSSFKLSNLKKDDRSHFRIGFNDELCIALIK* |
| JGI20159J14440_101081082 | 3300001353 | Pelagic Marine | KFHASSFKLSNLKKDDRSRFRIGFNDELCIALILXYY* |
| JGI20155J14468_100605153 | 3300001354 | Pelagic Marine | KFHASSFKLSNLKKDDRSRFRIGFNDELCIALIK* |
| KVWGV2_109023692 | 3300002242 | Marine Sediment | FVIWLMSPISSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIN* |
| JGI26119J46589_10016764 | 3300003264 | Marine | VSSITKVSKFHDSSFKLSNLKKDDRSRFRIGSNDELCTLLYI* |
| JGI26238J51125_10495822 | 3300003478 | Marine | FVIRLVSPVSSITKVSKFHTSSFKLSNLKKDDRSRFRIGYNDELCIALIKQYY* |
| JGI26242J51144_10083034 | 3300003500 | Marine | SITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYI* |
| JGI26242J51144_10285512 | 3300003500 | Marine | CPVGSITKVSKFHASSFKLSNLKKDDRSRFRIGYNDELCIALIK* |
| JGI26380J51729_100194121 | 3300003619 | Marine | VIWLMSPISGITKVSKFHDSSFKLSNLKKDDRSRFRIGFNDELCIALIR* |
| Ga0066610_100150221 | 3300004276 | Marine | VIWLVCPVGSITKVSKFHASSFKLSNLKKDDRSRFRIGYNDELCIALIK* |
| Ga0066611_101941301 | 3300004277 | Marine | SITKVSKFHDSSFKLSNLKKDDRSRFRIGFNDELCIALIK* |
| Ga0066609_102749122 | 3300004278 | Marine | VIWLVCPVGSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIK* |
| Ga0008649_100381905 | 3300005838 | Marine | VGSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYI* |
| Ga0008649_102361642 | 3300005838 | Marine | VGSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIK* |
| Ga0066836_100360721 | 3300006166 | Marine | SITKVSKFHASSFKLSNLKKDDRSRFRIGYNDELCIALIS* |
| Ga0066836_105308172 | 3300006166 | Marine | SITKVSKFHASSFKLSNLKKDDRSRFRIGYNDELCIALIK* |
| Ga0115566_102929882 | 3300009071 | Pelagic Marine | PVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIN* |
| Ga0115552_13516001 | 3300009077 | Pelagic Marine | VSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYN* |
| Ga0115551_12136481 | 3300009193 | Pelagic Marine | LVCPVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYN* |
| Ga0115556_10510751 | 3300009437 | Pelagic Marine | VSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIN* |
| Ga0115565_102176902 | 3300009467 | Pelagic Marine | SSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIN* |
| Ga0115011_100823524 | 3300009593 | Marine | LVSPISGITKVSKFHASSFKLSNLKKDDRSHFRIGYNDELCIALMK* |
| Ga0115012_106265911 | 3300009790 | Marine | SITKVSKFHDSSFKLSNLKKDDRSRFRIGYNDELCIALIK* |
| Ga0115012_109737081 | 3300009790 | Marine | IGLVSPISCITKVSKFHASSFKFSNLKKDDRSRFRIGYNDELCIALQ* |
| Ga0163109_104820052 | 3300012936 | Surface Seawater | SSITKVSKFHASSFKLSNLKKDDRSRFRIGYNDELCIALIN* |
| Ga0163111_105308122 | 3300012954 | Surface Seawater | VSSITKVSKFHASSFKLSNLKKDDRSRFRIGYNDELCIALMS* |
| Ga0163111_124123952 | 3300012954 | Surface Seawater | SGITKVSKFHASSFKLSNLKKDDRSHFRIGYNDELCIALMLQYYKS* |
| Ga0181417_10411972 | 3300017730 | Seawater | CPVSSITKVSKFHVSSFKLSNLKKDDRSRFRIGFNDELCIALIK |
| Ga0181416_10333611 | 3300017731 | Seawater | PVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIK |
| Ga0181431_10584881 | 3300017735 | Seawater | VIWLVCPVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIK |
| Ga0181431_11392011 | 3300017735 | Seawater | RKEVCPVSSITKVSKFHASSFKLSNLKKDDRSRFRVGFNDELCIAL |
| Ga0181421_11724912 | 3300017741 | Seawater | GSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYT |
| Ga0181400_11011852 | 3300017752 | Seawater | SSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIN |
| Ga0181411_10994691 | 3300017755 | Seawater | VSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYT |
| Ga0187220_10800871 | 3300017768 | Seawater | LVCPVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYN |
| Ga0181425_11479892 | 3300017771 | Seawater | SSITKVSKFHASSFKLSNLKKDDRSRFRIGYNDELCIALMDQYY |
| Ga0181423_11456093 | 3300017781 | Seawater | SITKVSKFHASSFKLSNLKKDDRSHFRIGYNDELCIALMDQYY |
| Ga0181584_101814853 | 3300017949 | Salt Marsh | VSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIK |
| Ga0181577_102505032 | 3300017951 | Salt Marsh | VSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYN |
| Ga0181571_102568471 | 3300017957 | Salt Marsh | KVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIK |
| Ga0181576_104827681 | 3300017985 | Salt Marsh | TKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIK |
| Ga0181558_106032721 | 3300018417 | Salt Marsh | PVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIN |
| Ga0206129_100442971 | 3300020182 | Seawater | KVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYN |
| Ga0181604_100534813 | 3300020191 | Salt Marsh | PVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYN |
| Ga0181597_100840613 | 3300020194 | Salt Marsh | CPVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIK |
| Ga0211491_10042463 | 3300020318 | Marine | SSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALLE |
| Ga0211576_103349892 | 3300020438 | Marine | LVCPVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYT |
| Ga0211576_103946432 | 3300020438 | Marine | LVCPVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIK |
| Ga0211548_101596442 | 3300020454 | Marine | SSITKVSKFHASSFKLSNLKKDDRSRFRIGYNDELCIALIK |
| Ga0211548_104527572 | 3300020454 | Marine | SSITKVSKFHASSFKLSNLKKDDRSHFRIGYNDELCIALIE |
| Ga0211546_101499752 | 3300020462 | Marine | SSITKVSKFHASSFKLSNLKKDDRSRFRIGYNDELCIALMS |
| Ga0211541_104510781 | 3300020475 | Marine | SSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIK |
| Ga0206684_10248773 | 3300021068 | Seawater | CPVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIR |
| Ga0213861_102604961 | 3300021378 | Seawater | PVSSITKISKFHASSFKLSNLKKDDRSRFRIGFNDELCIALMV |
| Ga0255775_10588453 | 3300022907 | Salt Marsh | PVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALCD |
| Ga0255769_101214371 | 3300022927 | Salt Marsh | PVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYD |
| Ga0255766_101754251 | 3300023172 | Salt Marsh | SSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALCD |
| Ga0228667_10854491 | 3300024226 | Seawater | ITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIK |
| (restricted) Ga0233436_10960891 | 3300024243 | Seawater | CPVSSITKISKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYI |
| Ga0228675_10480931 | 3300024247 | Seawater | CPVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYT |
| Ga0228676_10316881 | 3300024248 | Seawater | SSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYN |
| Ga0228677_10154421 | 3300024250 | Seawater | CPVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYD |
| (restricted) Ga0233446_11346301 | 3300024256 | Seawater | CPVGSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIL |
| Ga0233451_100407441 | 3300024301 | Salt Marsh | PVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIAL |
| (restricted) Ga0233449_10051541 | 3300024302 | Seawater | LVCPVGSITKVSKFHASSFKLSNLKKDDRSRFRIGYNDELCIALIK |
| Ga0228624_10650872 | 3300024313 | Seawater | SITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIK |
| Ga0228631_10251961 | 3300024329 | Seawater | PVSSITKVSKFHASSFKLSNLKKDDRSRFRIGYNDELCIALQY |
| Ga0228631_10383331 | 3300024329 | Seawater | LVCPVSSITKVPKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYN |
| Ga0228650_10377951 | 3300024417 | Seawater | CPVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYN |
| Ga0228632_10694002 | 3300024420 | Seawater | LVCPVSSITKVSKFHASSFKLSNLKKDDRSSFRIGFNDELCIALYN |
| Ga0209095_11717841 | 3300025685 | Pelagic Marine | CPVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIN |
| Ga0209362_11610072 | 3300025770 | Marine | PVSSITKVSKFHDSSFKLSNLKKDDRSHFRIGFNDELCIALIR |
| Ga0209630_102420932 | 3300025892 | Pelagic Marine | PVSSITKVSKFHASSFKLSNLKKDDRSHFRIGFNDELCIALIK |
| Ga0208749_10371221 | 3300026077 | Marine | PVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALMKLYY |
| Ga0209932_10293502 | 3300026183 | Pond Water | VSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIAL |
| Ga0208277_11351772 | 3300026292 | Marine | WFMCPVSSITKVSKFHASSFKLSNLKKDDRSRFRIGYNDELCIALIS |
| Ga0208965_11029311 | 3300027406 | Marine | ITKVSKFHDSSFKLSNLKKDDRSRFRIGFNDELCIALIR |
| Ga0209359_102717721 | 3300027830 | Marine | MIGLVSPVSSITKVSKFHASSFKLSNLKKDDRSRFRIGYNDELCIALIK |
| Ga0228642_10678312 | 3300028131 | Seawater | CPVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYI |
| Ga0257116_10024521 | 3300028277 | Marine | GSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIK |
| Ga0257126_11158022 | 3300028287 | Marine | PVGSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIL |
| Ga0228627_10474501 | 3300028414 | Seawater | PVSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALYT |
| Ga0315322_108380021 | 3300031766 | Seawater | ITKVSKFHDSSFKLSNLKKDDRSRFRIGFNDELCIALIK |
| Ga0315320_101812543 | 3300031851 | Seawater | VSSITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIN |
| Ga0315320_107320801 | 3300031851 | Seawater | LVCPVSSITKVSKFHDSSFKLSNLKKDDRSRFRIGFNDELCIALIK |
| Ga0315320_107733041 | 3300031851 | Seawater | VIWLVCPVGSITKVSKFHASSFKLSNLKKDDRSRFRIGYNDELCIALIK |
| Ga0315316_106234031 | 3300032011 | Seawater | SITKVSKFHDSSFKLSNLKKDDRSRFRIGFNDELCIALIR |
| Ga0315329_101699812 | 3300032048 | Seawater | VCPVSSITKVSKFHDSSFKLSNLKKDDRSRFRIGFNDELCIALIR |
| Ga0315315_116201271 | 3300032073 | Seawater | SITKVSKFHASSFKLSNLKKDDRSRFRIGFNDELCIALIN |
| ⦗Top⦘ |