| Basic Information | |
|---|---|
| Family ID | F098012 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 48 residues |
| Representative Sequence | AGFSEGTIIKRIEDSPVDFDLSPAKLDELFKRRVTDAIIAAMRAAMGGK |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (13.462 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.769 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (75.962 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.66% β-sheet: 0.00% Coil/Unstructured: 62.34% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF04055 | Radical_SAM | 8.65 |
| PF04116 | FA_hydroxylase | 5.77 |
| PF13353 | Fer4_12 | 2.88 |
| PF00218 | IGPS | 0.96 |
| PF01979 | Amidohydro_1 | 0.96 |
| PF01975 | SurE | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 5.77 |
| COG0134 | Indole-3-glycerol phosphate synthase | Amino acid transport and metabolism [E] | 0.96 |
| COG0496 | Broad specificity polyphosphatase and 5'/3'-nucleotidase SurE | Replication, recombination and repair [L] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 13.46% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 6.73% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.85% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.88% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.96% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.96% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055468_101882701 | 3300003993 | Natural And Restored Wetlands | EAGFSEGTIIKRIEESPVEFDLSPTKLNELQKRRVTEPIIAAMTLAMGGDLKP* |
| Ga0062593_1009286482 | 3300004114 | Soil | GFSEGTIIKRIEESPVEFDLSPARIADLQKRRVSEAIIAAMNAAMGVK* |
| Ga0062595_1018084571 | 3300004479 | Soil | FSEGTIIKRIEESPVDFDLSPAKVVELQKRRVTEAVIAAMNAAMGK* |
| Ga0062595_1027052702 | 3300004479 | Soil | EGTIIKRIEESPVDFDLSPPKLAELHKRRVTDAIIAAMTAAMGSESRPN* |
| Ga0062591_1024680451 | 3300004643 | Soil | TNEGVIKLVEAGFSEGTIIKRIEESPVDFDLSPAKLDELFKRRVTDAIIAAMRAAMGK* |
| Ga0062594_1024247191 | 3300005093 | Soil | SEGTIIKRIEDSPVDFDLSPAKLDELFKKRVTDAIIAAMRAAMGK* |
| Ga0065715_104911421 | 3300005293 | Miscanthus Rhizosphere | IIKRIEESPVDFDLSPAKLAELHKRRVTDAIIVAMSAAMGSESRPN* |
| Ga0070676_113182291 | 3300005328 | Miscanthus Rhizosphere | NEGVIRLVEAGFSEGTIIKRIEESPVEFDLSPAKLDELFKKRVTDAIIAAMRAAMGGK* |
| Ga0070690_1003767221 | 3300005330 | Switchgrass Rhizosphere | IKLVEAGFSEGTIIKRIEDSPVDFDLSPAKLDELFKRRVTDAIIAAMRAAMGGK* |
| Ga0066388_1024470771 | 3300005332 | Tropical Forest Soil | LVEAGFSEGTIIKRIEESPVDFDLSPGKIVELQKKRVSEAVIAAMTAAMGK* |
| Ga0070677_104274461 | 3300005333 | Miscanthus Rhizosphere | EGTIIKRIEESPVEFDLSPAKLDELFKKRVTDAIIAAMRAAMGGK* |
| Ga0070692_110531051 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | EESPVEFDLSPAKVDELHKRRVTDAIIAAMSTAMGVDPKP* |
| Ga0070669_1008470231 | 3300005353 | Switchgrass Rhizosphere | AGFSEGTIIKRIEESPVDFDFSPGKLDELYKKRVTDAIIAAMRTAMGDK* |
| Ga0070669_1018527071 | 3300005353 | Switchgrass Rhizosphere | EGVIRLVEAGFSEGTIIKRIEESPVDFDLSPAKITDLQKRRVSEAIIAAMNAAMGDK* |
| Ga0070705_1009125001 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | KRIEESPVDFDFSPGKLDELYKKRVTDAIIAAMRTAMGDK* |
| Ga0070700_1011873402 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | TNEGVIKLVEAGFSEGTIIKRIEDSPVEFDLSPAKLDELFKRRVTDAIIAAMRAAMGGK* |
| Ga0070694_1019114972 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VIQLVDAGFSEGTIIKRIEESPVDFDLSPPKLAELHKRRVTDAIIAAMTAAMGSESRPN* |
| Ga0068867_1022676201 | 3300005459 | Miscanthus Rhizosphere | FSEGTIIKRIEESPVEFDLSPARIADLQKRRVSEAIIAAMNAAMGVK* |
| Ga0070699_1016859161 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | EAGFSEGTIIKRIEDSPVEFDLSPAKLDELFKKRVTDAIIAAMRAAVGDK* |
| Ga0070679_1017164492 | 3300005530 | Corn Rhizosphere | RLVEAGFSEGTIIKRIEDSPVEFDLSPAKLDELFKKRVTDAIIAAMRAAMGDK* |
| Ga0068853_1023895461 | 3300005539 | Corn Rhizosphere | EAGFSEGTIIKRIEESPVDFDLSPAKITDLQKRRVSEAIIAAMNAAMGDK* |
| Ga0070672_1019710121 | 3300005543 | Miscanthus Rhizosphere | SEGTIIKRIEESPVEFDLSPAKLDELFKKRVTDAIIAAMRTAMGGK* |
| Ga0070696_1002122172 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | FSEGTIIKRIEDSPVDFDLSPAKVVELQKRRVSEAIIAAMNAAMGK* |
| Ga0070704_1007282231 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | IIKRIEESPVDFDLSPPKLAELHKRRVTDAIIAAMTAAMGSESRPN* |
| Ga0070664_1008307311 | 3300005564 | Corn Rhizosphere | AGFSEGTIIKRIEDSPVDFDLSPAKLDELFKRRVTDAIIAAMRAAMGGK* |
| Ga0068854_1016091552 | 3300005578 | Corn Rhizosphere | GTIIKRIEESPVDFDLSPGKLDELYKKRVTDQIVAAMAAAMGKDR* |
| Ga0070702_1015171131 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | SEGTIIKRIEESPVDFDLSPAKITDLQKRRVSEAIIAAMNAAMGDK* |
| Ga0068852_1006678552 | 3300005616 | Corn Rhizosphere | IIKRIEESPVDFDLSPGKLDDLFKKRVTDQIIAAMRAAMGK* |
| Ga0068859_1000114919 | 3300005617 | Switchgrass Rhizosphere | ESPVDFDLSPGKLDELYKKRVTDQIVAAMAAAMGKDR* |
| Ga0068859_1025596111 | 3300005617 | Switchgrass Rhizosphere | IIKRIEESPVEFDLSPAKLDELFKKRVTDAIIAAMRAAMGGK* |
| Ga0068864_1003182911 | 3300005618 | Switchgrass Rhizosphere | EAGFSEGTIIKRIQESPVDFDLSPGKLDELYKKRVTDPIVAAMAAAMGKDR* |
| Ga0068863_1009155821 | 3300005841 | Switchgrass Rhizosphere | TLTNEGVIKLVDAGFSEGTIIKRIEQSPVDFDFSPGKLDELYKRRVSDTIVAAMRAAMGNN* |
| Ga0068863_1022616142 | 3300005841 | Switchgrass Rhizosphere | EESPVDFDLSPAKLDELFKKRVSDAIIAAMRTAMGGK* |
| Ga0068858_1006587022 | 3300005842 | Switchgrass Rhizosphere | EESPVEFDLSPAKLDELFKKRVTDAIIAAMRTAMGGK* |
| Ga0068860_1005725262 | 3300005843 | Switchgrass Rhizosphere | IRLVEAGFSEGTIIKRIEESPVDFDLSPAKVIELQKKRVSDTVIAAMNAAMGK* |
| Ga0068862_1004642922 | 3300005844 | Switchgrass Rhizosphere | RIEESPVDFDLSPGKLDELYKKRVTDQIVAAMAAAMGKDR* |
| Ga0068862_1006897521 | 3300005844 | Switchgrass Rhizosphere | EGTIIKRIEESPVDFDLSPAKLDELFKRRVTDAIIAAMRAAMGK* |
| Ga0082029_10225171 | 3300006169 | Termite Nest | ESPVDFDLSPAKVVELQKRRVSEAVIAAMNAAMGK* |
| Ga0075421_1000739665 | 3300006845 | Populus Rhizosphere | TIIKRIEESPVDFDLSPGKLDELYKKRVTDAIIAAMATAMGKDR* |
| Ga0079216_100524612 | 3300006918 | Agricultural Soil | GVIQLVEAGFSEGTIIKRIESSPVEFDLSPAKLAELQKRRVSDAIIAAMSAAMGIESRPK |
| Ga0075419_101529662 | 3300006969 | Populus Rhizosphere | IKRIEESPVDFDLSPGKLDELYKKRVTDAIIAAMATAMGKDR* |
| Ga0075419_113387801 | 3300006969 | Populus Rhizosphere | EGTIIKRIEESPVDFDLSPGKLDELYKKRVTDAIIAAMSAAMGKDR* |
| Ga0075435_1010018442 | 3300007076 | Populus Rhizosphere | IKRIEESPVDFDLSPAKIEELHKRRVTDAIITAMTAAMGR* |
| Ga0114129_121964391 | 3300009147 | Populus Rhizosphere | IEDSPVDFDLSPGKLDELFKRRVTDAIIAAMRAAMGK* |
| Ga0111538_120366331 | 3300009156 | Populus Rhizosphere | IKLVEAGFSEGTIIKRIESSPVEFDLSPSKLAELQKRRVTEPIIAAMTAAMSEGDPRPSN |
| Ga0075423_108347492 | 3300009162 | Populus Rhizosphere | TIIKRIEESPVDFDLSPAKVVELQKRRVSEAIIAAMNAAMGK* |
| Ga0075423_126909922 | 3300009162 | Populus Rhizosphere | FSEGTIIKRIEESPVEFDLSPAKLDELFKKRVTDAIIAAMRAAMGK* |
| Ga0105241_122958241 | 3300009174 | Corn Rhizosphere | FSEGTIIKRIEDSPVDFDLSPVKLDELFKRRVSDAIIAAMKAAMGGK* |
| Ga0105248_101592972 | 3300009177 | Switchgrass Rhizosphere | FSEGTIIKRIEGSPADFDLSPAKLDELHKRRVTEAIITAMTQAMTDKG* |
| Ga0105248_114621542 | 3300009177 | Switchgrass Rhizosphere | VIKLVEAGFSEGTIIKRIEESPVDFDLSPAKLDELYKKRVTDAIIAAMSLAMGKDR* |
| Ga0105248_115952431 | 3300009177 | Switchgrass Rhizosphere | TNEGVIRLVEAGFSEGTIIKRIEGSPVDFDLSPAKVVELQKRRVTEPIIAAMNAAMGK* |
| Ga0105249_114271942 | 3300009553 | Switchgrass Rhizosphere | RIEQSPVDFDFSPGKLDELYKRRVSDAIVAAMRAAMGK* |
| Ga0105249_128397081 | 3300009553 | Switchgrass Rhizosphere | VIKLVDAGFSEGTIIKRIEDSPVDFDLSPAKLDELFKRRVTDAIIAAMRAAMGGK* |
| Ga0126313_116733301 | 3300009840 | Serpentine Soil | RIEESPVEFDLSPAKIVDLQKRRVSEAIIAAMNAAMGGK* |
| Ga0126305_106460031 | 3300010036 | Serpentine Soil | KRIEESPVDFDLSPARVDELQKRRVTDPIIAAMRTAMGDK* |
| Ga0126314_103084362 | 3300010042 | Serpentine Soil | LVEAGFSEGTIIKRIEGSPVNFDLSPAKIEELHKKRVTDSIIAAMTAAMGDKD* |
| Ga0105239_124587611 | 3300010375 | Corn Rhizosphere | IIKRIEDSPVDFDLSPAKLDELFKRRVTDAIIAAMRAAMGGK* |
| Ga0134124_117372761 | 3300010397 | Terrestrial Soil | QESPVDFDLSPGKLDELFKKRVTDAIIAAMREAMGDK* |
| Ga0134124_120297162 | 3300010397 | Terrestrial Soil | KLVEAGFSEGTIIKRSEDSPVDFDLSPAKLDELFKRRVTDAIIAAMRTAMGGK* |
| Ga0134124_127345191 | 3300010397 | Terrestrial Soil | EGVIKLVEAGFSEGTIIKRIEDSPVDFDLSPAKLDELFKRRVTDAIIAAMRAAMGGK* |
| Ga0134127_114823281 | 3300010399 | Terrestrial Soil | IRLVEAGFSEGTIIKRIEESPVDFDLSPAKITDLQKRRVSEAIIAAMNAAMGDK* |
| Ga0134122_110088031 | 3300010400 | Terrestrial Soil | GFSEGTIIKRIEESPVEFDLSPVKLDELFKKRVTDAIIAAMRTAMGGK* |
| Ga0134123_104975192 | 3300010403 | Terrestrial Soil | FSEGTIIKRIEDSPVDFDLSPGKLDELFKKRVTDAIIAAMRAAMGGK* |
| Ga0105246_105450261 | 3300011119 | Miscanthus Rhizosphere | EDSPVEFDLSPAKLDELFKKRVTDAIIAAMRAAMGDK* |
| Ga0105246_119101031 | 3300011119 | Miscanthus Rhizosphere | EGVIRLVEAGFSEGTIIKRIEESPVEFDLSPAKLDELFKKRVTDAIIAAMRAAMGGK* |
| Ga0164303_106736602 | 3300012957 | Soil | VEAGFSEGTIIKRIEESPVEFDLAPVKLDELFKKRVTDAIIAAMRAAMGDK* |
| Ga0157373_101947113 | 3300013100 | Corn Rhizosphere | KRIEESPVDFDLSPGKLDELYKKRVTDQIVAAMAAAMGKDR* |
| Ga0157371_103762401 | 3300013102 | Corn Rhizosphere | IIKRIEDSPVDFDLSPAKLDELFKRRVTDAIIAAMRAAMGK* |
| Ga0157371_107624471 | 3300013102 | Corn Rhizosphere | DAGFSEGTIIKRIEQSPVDFDFSPGKLDELYKRRVSDTIVAAMRAAMGNN* |
| Ga0157374_110916121 | 3300013296 | Miscanthus Rhizosphere | GTIIKRIEDSPVEFDLSPVKLDELFKRRVTDAIIAAMRAAMGGK* |
| Ga0157378_110040522 | 3300013297 | Miscanthus Rhizosphere | GFSEGTIIKRIEDSPVDFDLSPAKVVELQKRRVSEAIIAAMNAAIGK* |
| Ga0163162_115234952 | 3300013306 | Switchgrass Rhizosphere | AGFSEGTIIKRIEQSPVDFDFSPGKLDELYKRRVSDAIVAAMRAAMGGK* |
| Ga0157372_116551361 | 3300013307 | Corn Rhizosphere | AGFSEGTIIKRIEQSPVDFDLSPGKIAELYKRRVTDAIIAAMTAAMGSESRPN* |
| Ga0157372_127130761 | 3300013307 | Corn Rhizosphere | AGFSEGTIIKRIEGSPVDFDLSPAKIEELHKRRVTDPIIAAMTAAMGDK* |
| Ga0157375_137921021 | 3300013308 | Miscanthus Rhizosphere | EASPVDFDLSPAKIAELQKRRVTDAIIAAMSAAMGLDPKP* |
| Ga0120188_10242771 | 3300013760 | Terrestrial | VIRLVEAGFSEGTIIKRIEESPVDFDLSPGKLDELYKKRVTDAIVAAMRAAMGDQ* |
| Ga0163163_112974481 | 3300014325 | Switchgrass Rhizosphere | GFSEGTIIKCIEDSPVEFDLSPAKLDELFKRRVSDAIITAMKAAMGSK* |
| Ga0163163_123892581 | 3300014325 | Switchgrass Rhizosphere | AAVIRLVDAGFSEGTIIKRIEGSPADFDLSPTKLDELHKRRVTDAIITAMTQAMTDKG* |
| Ga0157380_126981411 | 3300014326 | Switchgrass Rhizosphere | IIKRIEESPVEFDLSPGKLDELYKKRVTDQIIAAMAAAMGKDR* |
| Ga0157377_102322043 | 3300014745 | Miscanthus Rhizosphere | ESPVDFDLSPGKLDELYKKRVTDQIIAAMSAAMGKDR* |
| Ga0132255_1027920221 | 3300015374 | Arabidopsis Rhizosphere | GFSEGTIIKRIEDSPVDFDLSPGKLDELFKRRVSDAIVAAMRAAMGDK* |
| Ga0163161_110592411 | 3300017792 | Switchgrass Rhizosphere | SPVDFDLSPGKLDELFKRRVSDAIIAAMRAAMGGK |
| Ga0247668_10906801 | 3300024331 | Soil | EESPVDFDLSPAKLDELFKKRVTDAIIAAMRTAMGK |
| Ga0210113_10846221 | 3300025796 | Natural And Restored Wetlands | EAGFSEGTIIKRIEESPVEFDLSPTKLNELQKRRVTEPIIAAMTLAMGGDLKP |
| Ga0207647_106789562 | 3300025904 | Corn Rhizosphere | KTPTLNNDGVIRLVEAGFSEGTIIKRIEESPVDFDFSPGKLDELYKKRVTDAIIAAMRTAMGDK |
| Ga0207681_104800883 | 3300025923 | Switchgrass Rhizosphere | GVIRLVEAGFSEGTIIKRIEESPVDFDFSPGKLDELYKKRVTDAIIAAMRTAMGDK |
| Ga0207650_101882841 | 3300025925 | Switchgrass Rhizosphere | AGFSEGTIIKRIEESPVDFDFSPGKLDELYKKRVTDAIIAAMRTAMGDK |
| Ga0207701_103934022 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | KLVDAGFSEGTIIKRIEDSPVDFDLSPAKLDELFKRRVSDAIITAMKAAMGGK |
| Ga0207706_116828941 | 3300025933 | Corn Rhizosphere | DGVIRLVEAGFSEGTIIKRIEESPVDFDLSPGKLDELYKKRVTDQIIAAMAAAMGKDR |
| Ga0207709_117670291 | 3300025935 | Miscanthus Rhizosphere | VIKLVEAGFSEGTIIKRIEDSPVDFDLSPAKLDELFKRRVTDAIIAAMRAAMGGK |
| Ga0207711_110678022 | 3300025941 | Switchgrass Rhizosphere | FSEGTIIKRIEESPVDFDLSPAKLDELYKKRVTDAIIAAMSLAMGKDR |
| Ga0207711_112798971 | 3300025941 | Switchgrass Rhizosphere | SEGTIIKRIEGSPADFDLSPAKLDELHKRRVTEAIITAMTQAMTDKG |
| Ga0207689_102089673 | 3300025942 | Miscanthus Rhizosphere | SEGTIIKRIEESPVDFDLSPGKLDELYKKRVTDQIIAAMAAAMGKDR |
| Ga0207640_111951161 | 3300025981 | Corn Rhizosphere | VIRLVEAGFSEGTIIKRIEESPVDFDLSPGKLDELYKKRVTDQIVAAMAAAMGKDR |
| Ga0207703_103100391 | 3300026035 | Switchgrass Rhizosphere | IIKRIEESPVDFDLSPGKLDELFKKRVTDQIIAAMRAAMGK |
| Ga0207703_121944441 | 3300026035 | Switchgrass Rhizosphere | KLVEAGFSEGTIIKRIEDSPVDFDLSPAKLDELFKRRVTDAIIAAMRAAMGGK |
| Ga0207641_100626561 | 3300026088 | Switchgrass Rhizosphere | GTIIKRIEQSPVDFDFSPGKLDELYKRRVSDTIVAAMRAAMGNN |
| Ga0207676_125405321 | 3300026095 | Switchgrass Rhizosphere | VEAGFSEGTIIKRIEGSPVDFDLSPAKVVELQKRRVTEPIIAAMNAAMGK |
| Ga0207674_110629881 | 3300026116 | Corn Rhizosphere | ESPVDFDLSPGKIEELYKKRVTDQIVAAMAAAMGKDQ |
| Ga0207674_110984361 | 3300026116 | Corn Rhizosphere | IIKRIEESPVDFDLSPAKLDELFKRRVTDAIIAAMRAAMGK |
| Ga0207675_1001966012 | 3300026118 | Switchgrass Rhizosphere | VIRLVEAGFSEGTIIKRIEESPVDFDLSPARIADLQKRRVSEAIIAAMNAAMGDK |
| Ga0209215_10017552 | 3300027266 | Forest Soil | AGFSEGTIIKRIEESPVDFDLSPAKLDELHKHRVTDPIIVAMRAAMGSDPKP |
| Ga0209486_100175161 | 3300027886 | Agricultural Soil | IIKRIESSPVEFDLSPAKLAELQKRRVSDAIIAAMSAAMGIESRPK |
| Ga0310888_101915732 | 3300031538 | Soil | EAGFSEGTIIKRIEDSPVDFDLSPAKLDELFKRRVTDAIIAAMRAAMGGK |
| ⦗Top⦘ |