| Basic Information | |
|---|---|
| Family ID | F098006 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MTRRILGALRSIVAEPSPDAAVHFHGDGMNGEPAACFDAHCSRPAL |
| Number of Associated Samples | 73 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 89.42 % |
| % of genes near scaffold ends (potentially truncated) | 14.42 % |
| % of genes from short scaffolds (< 2000 bps) | 88.46 % |
| Associated GOLD sequencing projects | 67 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.769 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (26.923 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.692 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.846 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.57% β-sheet: 8.11% Coil/Unstructured: 74.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF13561 | adh_short_C2 | 73.08 |
| PF00106 | adh_short | 6.73 |
| PF08501 | Shikimate_dh_N | 3.85 |
| PF00107 | ADH_zinc_N | 1.92 |
| PF00005 | ABC_tran | 1.92 |
| PF00144 | Beta-lactamase | 1.92 |
| PF00248 | Aldo_ket_red | 0.96 |
| PF00294 | PfkB | 0.96 |
| PF13207 | AAA_17 | 0.96 |
| PF02880 | PGM_PMM_III | 0.96 |
| PF00408 | PGM_PMM_IV | 0.96 |
| PF01243 | Putative_PNPOx | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0169 | Shikimate 5-dehydrogenase | Amino acid transport and metabolism [E] | 3.85 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 1.92 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 1.92 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.92 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.73 % |
| Unclassified | root | N/A | 18.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_110194841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
| 3300002568|C688J35102_117984443 | Not Available | 520 | Open in IMG/M |
| 3300002568|C688J35102_119298254 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300002568|C688J35102_119886722 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300003322|rootL2_10260183 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300004081|Ga0063454_100527761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 839 | Open in IMG/M |
| 3300004479|Ga0062595_102408677 | Not Available | 522 | Open in IMG/M |
| 3300005356|Ga0070674_101559414 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300005441|Ga0070700_100348136 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300005456|Ga0070678_100643622 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300005457|Ga0070662_100510800 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300005459|Ga0068867_101223596 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005535|Ga0070684_101558124 | Not Available | 623 | Open in IMG/M |
| 3300006046|Ga0066652_100009458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6143 | Open in IMG/M |
| 3300006169|Ga0082029_1385645 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300006169|Ga0082029_1549318 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300006755|Ga0079222_11423654 | Not Available | 643 | Open in IMG/M |
| 3300006880|Ga0075429_101841010 | Not Available | 525 | Open in IMG/M |
| 3300006894|Ga0079215_10194389 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300006894|Ga0079215_11267007 | Not Available | 567 | Open in IMG/M |
| 3300007004|Ga0079218_12617337 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300009094|Ga0111539_12161668 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300009100|Ga0075418_11402272 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300009553|Ga0105249_13365567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300009789|Ga0126307_10006594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8208 | Open in IMG/M |
| 3300009789|Ga0126307_10023753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4664 | Open in IMG/M |
| 3300009789|Ga0126307_10081835 | All Organisms → cellular organisms → Bacteria | 2549 | Open in IMG/M |
| 3300009789|Ga0126307_10160258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1803 | Open in IMG/M |
| 3300009789|Ga0126307_10454229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1034 | Open in IMG/M |
| 3300009789|Ga0126307_10790569 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300009789|Ga0126307_10984373 | Not Available | 681 | Open in IMG/M |
| 3300009789|Ga0126307_10998163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 676 | Open in IMG/M |
| 3300009789|Ga0126307_11422076 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300009840|Ga0126313_10009868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5975 | Open in IMG/M |
| 3300009840|Ga0126313_10065621 | All Organisms → cellular organisms → Bacteria | 2599 | Open in IMG/M |
| 3300009840|Ga0126313_10210122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1497 | Open in IMG/M |
| 3300009840|Ga0126313_10549311 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300009840|Ga0126313_10685712 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300009840|Ga0126313_11438254 | Not Available | 572 | Open in IMG/M |
| 3300010036|Ga0126305_10956483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
| 3300010037|Ga0126304_10679372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 695 | Open in IMG/M |
| 3300010038|Ga0126315_10730015 | Not Available | 648 | Open in IMG/M |
| 3300010038|Ga0126315_11058430 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300010039|Ga0126309_10105926 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
| 3300010039|Ga0126309_10158195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1224 | Open in IMG/M |
| 3300010039|Ga0126309_10245178 | Not Available | 1013 | Open in IMG/M |
| 3300010039|Ga0126309_10395469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 826 | Open in IMG/M |
| 3300010040|Ga0126308_10576720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 766 | Open in IMG/M |
| 3300010042|Ga0126314_10026651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3575 | Open in IMG/M |
| 3300010044|Ga0126310_11299467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300010045|Ga0126311_10679464 | Not Available | 822 | Open in IMG/M |
| 3300010045|Ga0126311_11541506 | Not Available | 558 | Open in IMG/M |
| 3300012045|Ga0136623_10000493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11821 | Open in IMG/M |
| 3300012185|Ga0136619_10411840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 514 | Open in IMG/M |
| 3300012212|Ga0150985_109350512 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300012469|Ga0150984_109365879 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012908|Ga0157286_10300431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
| 3300012941|Ga0162652_100013642 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300012985|Ga0164308_12220403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
| 3300014326|Ga0157380_10332215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1414 | Open in IMG/M |
| 3300014488|Ga0182001_10202035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 728 | Open in IMG/M |
| 3300014488|Ga0182001_10210124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Friedmanniella → environmental samples → uncultured Friedmanniella sp. | 720 | Open in IMG/M |
| 3300014745|Ga0157377_11522788 | Not Available | 533 | Open in IMG/M |
| 3300015371|Ga0132258_10996391 | All Organisms → cellular organisms → Bacteria | 2117 | Open in IMG/M |
| 3300018422|Ga0190265_11234680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 865 | Open in IMG/M |
| 3300018422|Ga0190265_11612499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Friedmanniella → environmental samples → uncultured Friedmanniella sp. | 760 | Open in IMG/M |
| 3300018432|Ga0190275_10124976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2327 | Open in IMG/M |
| 3300018432|Ga0190275_12653632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
| 3300018432|Ga0190275_13275333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300018466|Ga0190268_10396040 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300018469|Ga0190270_10216100 | All Organisms → cellular organisms → Bacteria | 1636 | Open in IMG/M |
| 3300018469|Ga0190270_11498615 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300018469|Ga0190270_12988626 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 535 | Open in IMG/M |
| 3300018476|Ga0190274_10907605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 948 | Open in IMG/M |
| 3300018476|Ga0190274_13517617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
| 3300018482|Ga0066669_10720963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 879 | Open in IMG/M |
| 3300019377|Ga0190264_12124872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300021947|Ga0213856_1102420 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300022195|Ga0222625_1652231 | Not Available | 606 | Open in IMG/M |
| 3300025899|Ga0207642_10337782 | Not Available | 885 | Open in IMG/M |
| 3300025901|Ga0207688_10146067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1394 | Open in IMG/M |
| 3300025937|Ga0207669_10340068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1156 | Open in IMG/M |
| 3300025940|Ga0207691_11050214 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300025972|Ga0207668_10079637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2371 | Open in IMG/M |
| 3300026075|Ga0207708_11300412 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300027639|Ga0209387_1184018 | Not Available | 566 | Open in IMG/M |
| 3300027787|Ga0209074_10324295 | Not Available | 623 | Open in IMG/M |
| 3300027886|Ga0209486_10647183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 676 | Open in IMG/M |
| 3300028587|Ga0247828_10195089 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300028705|Ga0307276_10068814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 815 | Open in IMG/M |
| 3300028720|Ga0307317_10223025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
| 3300028721|Ga0307315_10094893 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300028722|Ga0307319_10064030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1161 | Open in IMG/M |
| 3300028722|Ga0307319_10165328 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300030336|Ga0247826_10031673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2716 | Open in IMG/M |
| 3300030785|Ga0102757_11332726 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300031824|Ga0307413_10385720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1093 | Open in IMG/M |
| 3300031852|Ga0307410_11879602 | Not Available | 533 | Open in IMG/M |
| 3300031903|Ga0307407_11282708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Friedmanniella → environmental samples → uncultured Friedmanniella sp. | 574 | Open in IMG/M |
| 3300031995|Ga0307409_100511672 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300031995|Ga0307409_100910145 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300031996|Ga0308176_12746101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
| 3300032005|Ga0307411_10923941 | Not Available | 777 | Open in IMG/M |
| 3300032126|Ga0307415_100980856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 784 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 26.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.27% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 6.73% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 6.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.88% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.96% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.96% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012185 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021947 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - G-2016_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030785 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1101948412 | 3300000956 | Soil | MTRRLLGALRSIVAEPTTDAHVHFHGDGTNGEPAVCFDASCSRPQLDLR* |
| C688J35102_1179844431 | 3300002568 | Soil | MTRRILGALRSLVAEPDADSAVHFHGDGLNGEPAACFDAHCS |
| C688J35102_1192982541 | 3300002568 | Soil | MTRRILGALRSIVAEPHPDDAVHFHGDGINGEPAACFDAHCSRPAL* |
| C688J35102_1198867221 | 3300002568 | Soil | MTRRILGALRSLVEEPHPDAMVHFHGDGLQGEPSACFDAQCRRPALDV* |
| rootL2_102601832 | 3300003322 | Sugarcane Root And Bulk Soil | MTRRLLGALRSIVAEPSPDAAVHFHGDGLNGEPAACFDAHCRRPTLEV* |
| Ga0063454_1005277612 | 3300004081 | Soil | MTRRILGALRSIVAEPRADEAVHFHGDGMNGEPAACFDANCSRPAL* |
| Ga0062595_1024086772 | 3300004479 | Soil | MTRRILDALRSIVAEPSADAAVHFHGDGLNGEPAVCFDAHCARPAL* |
| Ga0070674_1015594142 | 3300005356 | Miscanthus Rhizosphere | LGALRSIVAEPTPDAAVHFHGDGTHGAPAACFDAHCRRPTLEV* |
| Ga0070700_1003481361 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRILGALRSIVAEPNPDAAVHFHGDGLNGEPAACFDARCSRPALS* |
| Ga0070678_1006436222 | 3300005456 | Miscanthus Rhizosphere | MTRRLLGALRSIVAEPTPDAAVHFHGDGTHGEPAACFDAHCRRPTLEV* |
| Ga0070662_1005108002 | 3300005457 | Corn Rhizosphere | MTRRILGALRSIVAEPSPDAAVHFHGDGLNGEPAACFDARCSRPALS* |
| Ga0068867_1012235962 | 3300005459 | Miscanthus Rhizosphere | MTRRILGALRSIVAEPNPDAAVHFHGDGLNGEPAACFDARCSR |
| Ga0070684_1015581242 | 3300005535 | Corn Rhizosphere | MTRRILGALRSIVAEPRPDDAVHFHGDGLHGEPAACFDAHCSRPAL* |
| Ga0066652_1000094583 | 3300006046 | Soil | MTRRLLGALRSIIAEPAPDAAVHFHGDGPNGEAAACFDAHCARPALDLS* |
| Ga0082029_13856451 | 3300006169 | Termite Nest | IVAEPSPDAAVHFHGDGLNGEPAACFDTHCRRPTLEV* |
| Ga0082029_15493182 | 3300006169 | Termite Nest | MTRRLLGALRSIIAEPSPDAAVHFHGDGINGEPAACFDAHCGRPALEV* |
| Ga0079222_114236541 | 3300006755 | Agricultural Soil | MTRRFLGALRSIIAEPAPDAAVHFHGDGPNGEAAVCFDSHCARPALDIR* |
| Ga0075429_1018410102 | 3300006880 | Populus Rhizosphere | MTRRFLGALRSIVAEPRPDDAVHFHGDGMNGEPAACFDAHCSRPAL* |
| Ga0079215_101943892 | 3300006894 | Agricultural Soil | MTRRLLGALRSIIAEPSPDAAVHFHGDGIYGEPAACFDAHCRRPTLEV* |
| Ga0079215_112670072 | 3300006894 | Agricultural Soil | MTRRFLGALRSIIAEPTPDAAVHFHGDGINGEPAACFDAHCPRPTLEV* |
| Ga0079218_126173372 | 3300007004 | Agricultural Soil | MTRRLLGALRSIIAEPTPDAAVHFHGDGINGEPAACFDAHCPRPTLEV* |
| Ga0111539_121616681 | 3300009094 | Populus Rhizosphere | MTRRILGALRSIVAEPRPDDAVHFHGDGLNGEPAACFDAHCSRPAL* |
| Ga0075418_114022722 | 3300009100 | Populus Rhizosphere | MTRRLLGALRSIVAEPNPDAAVHFHGDGLNGEPAACFDARCSRPALS* |
| Ga0105249_133655671 | 3300009553 | Switchgrass Rhizosphere | MTRRILGALRSIVAEPNPDAAVHFHGDGLNGEPAACFDARCSRPAL |
| Ga0126307_100065947 | 3300009789 | Serpentine Soil | MTRRLLGALRSIIAEPSPDAAVHFHGDGTHGEPAACFDAHCRRPALEV* |
| Ga0126307_100237533 | 3300009789 | Serpentine Soil | MTRRLLGALRSIIAEPSPDAAVHFHGDGINGEPAACFNARCSRPAL* |
| Ga0126307_100818352 | 3300009789 | Serpentine Soil | MTRRILSALRSIVTEPSPDAAVHFHGDGLNGEPAACFDARCSRPAL* |
| Ga0126307_101602582 | 3300009789 | Serpentine Soil | MTRRILGALRSLVAEPRPDDAVHFHGDGINGEPAVCFDAHCSRPAL* |
| Ga0126307_104542292 | 3300009789 | Serpentine Soil | MTRRLLGALRSIIAEPSPDAAVHFHGDGINGEPAACFDAHCRRPTLEV* |
| Ga0126307_107905691 | 3300009789 | Serpentine Soil | QGSTPMTRLLGALRSIIAEPSPDAAVHFHGDGFNGEPAACFDAHCRRPTLEV* |
| Ga0126307_109843732 | 3300009789 | Serpentine Soil | MTQRILGALRSLVAEPSADSSVHFHGDGLRGEPAACFDTQCSRPALKV* |
| Ga0126307_109981632 | 3300009789 | Serpentine Soil | MGALRSIIAEPSPDAAVHFHGDGINGEPAACFDAHCRRPTLEV* |
| Ga0126307_114220761 | 3300009789 | Serpentine Soil | MTRRLLGALRSIIAEPSPDAAVHFHGDGINGEPAACFDAQCRRPTLEV* |
| Ga0126313_100098685 | 3300009840 | Serpentine Soil | MTRRLLGALRSIIAAPSPDAAVHFHGDGIHGEPAECFDAHCRRPTLEV* |
| Ga0126313_100656213 | 3300009840 | Serpentine Soil | MTRRLLGALRSIITEPSPDAAVHFHGDGINGEPAACFNARCSRPAL* |
| Ga0126313_102101223 | 3300009840 | Serpentine Soil | MTRRLLGALRSIIAEPSPDAAVHFHGDGINGEPAVCFDAHCRRPILEV* |
| Ga0126313_105493112 | 3300009840 | Serpentine Soil | MTRRLLGALRSIIAEPRPDAAVHFHGDGMNGEPAVCFDATCSRPAL* |
| Ga0126313_106857122 | 3300009840 | Serpentine Soil | MTRRILGALRSLVAEPTADAAVHFHRDGLNGEPAACFDDRCSRPALEIR* |
| Ga0126313_114382542 | 3300009840 | Serpentine Soil | MTRRILGALRSLVAEPAADAAVHFHRDGLNGEPAACFDDRCSRPALEIR* |
| Ga0126305_109564832 | 3300010036 | Serpentine Soil | MTRRILGALRSLVAEPRPDDAVHFHGDGINGEPAACFDARCSRPAL* |
| Ga0126304_106793722 | 3300010037 | Serpentine Soil | MTRRILGALRSLVAEPRADDAVHFHGDGLNGEPAVCFDAHCSRPAL* |
| Ga0126315_107300152 | 3300010038 | Serpentine Soil | MTRRLLGALRSIVAEPHPDAAVHFHRDGINGEPAVCFDANCSRPAL* |
| Ga0126315_110584302 | 3300010038 | Serpentine Soil | MTRRLLGALRSIVAEPTPDAAVHFHGDGTNGEPAACFDTHCRRPTLEV* |
| Ga0126309_101059262 | 3300010039 | Serpentine Soil | MTRRIMDAFRALLTDPSPEAAVHFHGDGLNGEPAACFDAGCNRPALDVR* |
| Ga0126309_101581952 | 3300010039 | Serpentine Soil | MTRRILGALRSIVAEPSPDAAVHFHGDGLNGEPAACFDARCRRPNLEV* |
| Ga0126309_102451782 | 3300010039 | Serpentine Soil | MTRRLLGALRSIIAEPSPDAAVHFHGDGMNGEPAACFDARCSRPAL* |
| Ga0126309_103954692 | 3300010039 | Serpentine Soil | MTRRILGALRSLVAEPGADSHVHFHGDGLNGEPAACFDSHCRRPALEVR* |
| Ga0126308_105767202 | 3300010040 | Serpentine Soil | MTRRLLGALRSIVAEPTPDAAVHFHGDGTNGEPAACFDAHCRRPTLEV* |
| Ga0126314_100266514 | 3300010042 | Serpentine Soil | MTRRLLGALRSIIAEPSPDAAVHFHGDGINGEPAACFDARCSRPAL* |
| Ga0126310_112994672 | 3300010044 | Serpentine Soil | MTRRLLGALRSIVAEPTPDAAVHFHGDGTNGEPAVCFDANCSRPALELR* |
| Ga0126311_106794641 | 3300010045 | Serpentine Soil | MTRRILGALRSLVAEPTADSAVHFHGDGLNGEPAACFDARCSRPAL* |
| Ga0126311_115415062 | 3300010045 | Serpentine Soil | MTRRIMSALRSLVVEPSPESVVHFHGDGLNGEPSACFDARCRRPALSL* |
| Ga0136623_1000049311 | 3300012045 | Polar Desert Sand | MTRRIMDAFRTLLAEPSAESAVHFHGDGFNGEPAACFDDRCRRPALDV* |
| Ga0136619_104118401 | 3300012185 | Polar Desert Sand | RRIMDAFRTLLAEPSAESAVHFHGDGFNGEPAACFDDRCRRPALDV* |
| Ga0150985_1093505122 | 3300012212 | Avena Fatua Rhizosphere | MTARIMSALRSLVADPEPDAAVHFHGDGLHGEPAACFDARCTRPALQV* |
| Ga0150984_1093658792 | 3300012469 | Avena Fatua Rhizosphere | MTRRILGALRSIVAEPRPDDAVHFHHDGMNGEPAACFDANCSRPAL* |
| Ga0157286_103004312 | 3300012908 | Soil | MTRRILGALRYIVSEPSPDAAVHFHGDGLNGEPAACFDARCSRPAL* |
| Ga0162652_1000136421 | 3300012941 | Soil | MTRRILGALRSIVAEPRPDDAVHFHSDGMYGEPAACFDANCSRPAL* |
| Ga0164308_122204031 | 3300012985 | Soil | MTRRILGALRSIVAEPRPDDAVHFHGDGMHGEPAACFDAHCSRPAL* |
| Ga0157380_103322153 | 3300014326 | Switchgrass Rhizosphere | RSIVAEPNPDAAVHFHGDGLNGEPAACFDARCSRPALS* |
| Ga0182001_102020352 | 3300014488 | Soil | MTRRLLGALRSIIAEPSPDAAVHFHGDGTHGEPAACFDAHCRRPTLEV* |
| Ga0182001_102101242 | 3300014488 | Soil | MTRRIMSALRSLVAEPSTDSVVHFHREGLRGEPAACFDARCTRPALDV* |
| Ga0157377_115227882 | 3300014745 | Miscanthus Rhizosphere | RRLLGALRSIVAEPTPDAAVHFHGDGTHGEPAACFDAHCRRPTLEV* |
| Ga0132258_109963912 | 3300015371 | Arabidopsis Rhizosphere | MTRRLLGALRSIVAEPTPDAAVHFHGDGTHGEPAACFDAHCRRPTLDV* |
| Ga0190265_112346802 | 3300018422 | Soil | MTRRILGALRSLVAEPGADSSVHFHGDGLRGEPTACFDANCSRPALEV |
| Ga0190265_116124991 | 3300018422 | Soil | MTRRLLGALRSIIAEPSPDAAVHFHGDGTHGEPAACFDAHCRRPTLEV |
| Ga0190275_101249762 | 3300018432 | Soil | MTRRLLGALRSIIAEPSPDAAVHFHGDGFNGEPAACFDAHCRRPTLEV |
| Ga0190275_126536322 | 3300018432 | Soil | MTRRLLGALRSIIAEPSPDAAVHFHGDGIYGEPAVCFDAHCRRPTLEV |
| Ga0190275_132753331 | 3300018432 | Soil | MTRRILGALRSLIAEPVTDSSVHFHGDGLHGEPSACFDAHCRRPALSV |
| Ga0190268_103960401 | 3300018466 | Soil | MTRRLLGALRSIIAEPSPDAAVHFHGDGSNGEPAVCFDAHCPRPTLE |
| Ga0190270_102161002 | 3300018469 | Soil | MTRRLLGALRSIIAEPTPDAAVHFHGDGLNGEPAACFDARCSRPALS |
| Ga0190270_114986152 | 3300018469 | Soil | MTRRLLGALRSIIAEPSPDAAVHFHGDGSNGEPAACFDAHCRRPTLEV |
| Ga0190270_129886262 | 3300018469 | Soil | MTRRILGALRSIVAEPSPDAAVHFHGDGMNGEPAACFDAHCSRPAL |
| Ga0190274_109076052 | 3300018476 | Soil | MTRRLLGALRSIIAEPSPDAAVHFHGDGINGEPAVCFDAHCRRPTLEV |
| Ga0190274_135176172 | 3300018476 | Soil | MTRRILGALRSIVAEPSPDAAVHFHGDGLNGEPAACFDARCSRPAL |
| Ga0066669_107209632 | 3300018482 | Grasslands Soil | MTRRLLGALRSIIAEPAPDAAVHFHGDGPNGEAAACFDAHCARPALDLS |
| Ga0190264_121248721 | 3300019377 | Soil | MTRRILGALRALVAEPTADAAVHFHGDGINGEPAACFDDRCSRPVLETR |
| Ga0213856_11024202 | 3300021947 | Watersheds | MTRRILGALRSIVAEPKPDAAVHFHGDGLNGEPAACFDARCSRPALS |
| Ga0222625_16522311 | 3300022195 | Groundwater Sediment | MTRRFLGALRSIVAEPRPDDAVHFHGDGLNGEPAACFDANCSRPAL |
| Ga0207642_103377822 | 3300025899 | Miscanthus Rhizosphere | MTRRILGALRSIVAEPNPDAAVHFHGDGLNGEPAACFDARCSRPALS |
| Ga0207688_101460671 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRILGALRSIVAEPSPDAAVHFHGDGLNGEPAACFDARCSRPALS |
| Ga0207669_103400682 | 3300025937 | Miscanthus Rhizosphere | MTRRILGALRSIVAEPRPDDAVHFHGDGMHGEPAACFDAHCSRPAL |
| Ga0207691_110502142 | 3300025940 | Miscanthus Rhizosphere | MTRRLLGALRSIVAEPTPDAAVHFHGDGTYGEPAACFDAHCRRPTLEV |
| Ga0207668_100796372 | 3300025972 | Switchgrass Rhizosphere | MTRRLLGALRSIVAEPTPDAAVHFHGDGTHGEPAACFDAHCRRPTLEV |
| Ga0207708_113004121 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LRSIVAEPTPDAAVHFHGDGTHGEPAACFDAHCRRPTLEV |
| Ga0209387_11840181 | 3300027639 | Agricultural Soil | RTRIDPMTRRLLGALRSIIAEPSPDAAVHFHGDGIYGEPAACFDAHCRRPTLEV |
| Ga0209074_103242951 | 3300027787 | Agricultural Soil | MTRRFLGALRSIIAEPAPDAAVHFHGDGPNGEAAVCFDSHCARPALDIR |
| Ga0209486_106471832 | 3300027886 | Agricultural Soil | MTRRLLGALRSIIAEPSPDAAVHFHGDGSHGEPAACFDAHCRRPTLEV |
| Ga0247828_101950891 | 3300028587 | Soil | MTRRILGALRSIVAEPRPDDAVHFHGDGLHGEPAACF |
| Ga0307276_100688141 | 3300028705 | Soil | MTRRIMDALRTLLADPSPEAAVHAHADGLNGEPAVCFDARCSRPALDAR |
| Ga0307317_102230252 | 3300028720 | Soil | MTRRILGALRSIVAEPRPDDAVHFHSDGMYGEPAACFDANCSRPAL |
| Ga0307315_100948932 | 3300028721 | Soil | MTRRILGALRSIVAEPSPDAAVHFHGDGMNGEPAACFDVRCSRPAL |
| Ga0307319_100640302 | 3300028722 | Soil | MTRRLLGALRSIVAEPHPDAAVHFHGDGTNGEPAACFDANCSRPAL |
| Ga0307319_101653282 | 3300028722 | Soil | MTRRILGALRSIVAEPSPDAAVHFHGDGMNGEPAACFDVHCSRPAL |
| Ga0247826_100316733 | 3300030336 | Soil | MTRRILGALRSIVAEPRPDDAVHFHGDGLHGEPAACFDAHCSRPAL |
| Ga0102757_113327261 | 3300030785 | Soil | DPMTRRILGALRSIIAEPSPDAAVHFHNDGTHGEPAVCFDAHCSRPSLDV |
| Ga0307413_103857202 | 3300031824 | Rhizosphere | MTRRFLGALRSIIAEPSPDAAVHFHGDGIHGEPAECFDAHCRRPTLEV |
| Ga0307410_118796021 | 3300031852 | Rhizosphere | MTRRILGALRSLVAEPAADAAVHFHRDGLNGEPAACFDDRCSRPALELR |
| Ga0307407_112827081 | 3300031903 | Rhizosphere | MTRRLLGALRSIVAEPTPDAAVHFHGDGTNGEPAAC |
| Ga0307409_1005116721 | 3300031995 | Rhizosphere | MTRRLLGALRPIIAEPSPDAAVHFHGDGIHGEPAECFDAHCRRPTLEV |
| Ga0307409_1009101451 | 3300031995 | Rhizosphere | MTRRLLGALRSIITEPSPDAAVHFHGDGINGEPAVCFDAHCRRPTLEV |
| Ga0308176_127461011 | 3300031996 | Soil | MTRRLLGALRSIVAEPHPESTVHFHGDGTNGEPAVCFDANCSRPALEVG |
| Ga0307411_109239412 | 3300032005 | Rhizosphere | MTRRILSALRSIVAEPSPDAAVHFHGDGMNGEPAACFDAHCSRPAL |
| Ga0307415_1009808562 | 3300032126 | Rhizosphere | MTRRLLGALRSIIAEPRPDAAVHFHGDGMNGEPAACFDAHCSRPAL |
| ⦗Top⦘ |