| Basic Information | |
|---|---|
| Family ID | F097938 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MRFRAALVLGALLAVATSSTAFGQGFQGGLRGSIKDSGGV |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.12 % |
| % of genes near scaffold ends (potentially truncated) | 99.04 % |
| % of genes from short scaffolds (< 2000 bps) | 94.23 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.269 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere (8.654 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.308 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.808 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF13442 | Cytochrome_CBB3 | 27.88 |
| PF14559 | TPR_19 | 1.92 |
| PF13620 | CarboxypepD_reg | 0.96 |
| PF00593 | TonB_dep_Rec | 0.96 |
| PF13378 | MR_MLE_C | 0.96 |
| PF00069 | Pkinase | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.27 % |
| Unclassified | root | N/A | 6.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig43073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 2170459007|GJ61VE201DVKK0 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300000956|JGI10216J12902_121363071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300004157|Ga0062590_101833326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300004643|Ga0062591_101071226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300005174|Ga0066680_10272159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1079 | Open in IMG/M |
| 3300005175|Ga0066673_10802471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300005289|Ga0065704_10692603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300005332|Ga0066388_100776678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sandarakinorhabdus → unclassified Sandarakinorhabdus → Sandarakinorhabdus sp. | 1554 | Open in IMG/M |
| 3300005332|Ga0066388_105458250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300005356|Ga0070674_100399978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
| 3300005444|Ga0070694_101174345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300005444|Ga0070694_101466094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300005457|Ga0070662_100847863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300005457|Ga0070662_101410880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300005543|Ga0070672_101633334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300005552|Ga0066701_10930809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300005563|Ga0068855_100387488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1534 | Open in IMG/M |
| 3300005617|Ga0068859_100049352 | All Organisms → cellular organisms → Bacteria | 4227 | Open in IMG/M |
| 3300005840|Ga0068870_10645062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300005844|Ga0068862_100048140 | All Organisms → cellular organisms → Bacteria | 3639 | Open in IMG/M |
| 3300005844|Ga0068862_100778985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 932 | Open in IMG/M |
| 3300006173|Ga0070716_100178174 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300006178|Ga0075367_10398522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300006791|Ga0066653_10634424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 545 | Open in IMG/M |
| 3300006800|Ga0066660_10090771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2133 | Open in IMG/M |
| 3300006854|Ga0075425_102438791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300006871|Ga0075434_100096570 | All Organisms → cellular organisms → Bacteria | 2960 | Open in IMG/M |
| 3300006871|Ga0075434_101023167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
| 3300006904|Ga0075424_101097861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
| 3300006914|Ga0075436_101186870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300009012|Ga0066710_101989137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300009092|Ga0105250_10465054 | Not Available | 569 | Open in IMG/M |
| 3300009094|Ga0111539_12765411 | Not Available | 568 | Open in IMG/M |
| 3300009101|Ga0105247_10365143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300009137|Ga0066709_101473893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
| 3300009137|Ga0066709_103416445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300009147|Ga0114129_10043018 | All Organisms → cellular organisms → Bacteria | 6357 | Open in IMG/M |
| 3300009162|Ga0075423_10672312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1092 | Open in IMG/M |
| 3300009162|Ga0075423_11600348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300009176|Ga0105242_11309735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
| 3300009553|Ga0105249_10501266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1259 | Open in IMG/M |
| 3300009553|Ga0105249_10630769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1128 | Open in IMG/M |
| 3300009553|Ga0105249_10896158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300009792|Ga0126374_11208116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300010304|Ga0134088_10070488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1624 | Open in IMG/M |
| 3300010323|Ga0134086_10393505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300010358|Ga0126370_11468349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300010362|Ga0126377_12852695 | Not Available | 557 | Open in IMG/M |
| 3300010399|Ga0134127_13424232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300010400|Ga0134122_12071503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300010400|Ga0134122_12081556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300011269|Ga0137392_11219193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300012189|Ga0137388_10903797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300012206|Ga0137380_11360119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300012209|Ga0137379_10804929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300012212|Ga0150985_101703426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300012212|Ga0150985_122294541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 931 | Open in IMG/M |
| 3300012509|Ga0157334_1071590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300012893|Ga0157284_10324758 | Not Available | 512 | Open in IMG/M |
| 3300012911|Ga0157301_10272931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300012925|Ga0137419_10611530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300012927|Ga0137416_12059586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300012944|Ga0137410_11802025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300013297|Ga0157378_10477363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1242 | Open in IMG/M |
| 3300014745|Ga0157377_11721990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300015371|Ga0132258_11877218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1509 | Open in IMG/M |
| 3300016445|Ga0182038_11946952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300018064|Ga0187773_10643668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300018071|Ga0184618_10256783 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 740 | Open in IMG/M |
| 3300021080|Ga0210382_10053260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1597 | Open in IMG/M |
| 3300021080|Ga0210382_10206843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300025925|Ga0207650_11018192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300025930|Ga0207701_11701504 | Not Available | 505 | Open in IMG/M |
| 3300025949|Ga0207667_11423027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300025957|Ga0210089_1031871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300025960|Ga0207651_10433231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1125 | Open in IMG/M |
| 3300025961|Ga0207712_10024057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4028 | Open in IMG/M |
| 3300025961|Ga0207712_10453077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
| 3300025961|Ga0207712_11341449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300025961|Ga0207712_11414789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300025972|Ga0207668_11902062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300026035|Ga0207703_11762434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300026067|Ga0207678_10864358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300026095|Ga0207676_12436029 | Not Available | 520 | Open in IMG/M |
| 3300026297|Ga0209237_1264541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300028380|Ga0268265_10210862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1692 | Open in IMG/M |
| 3300028380|Ga0268265_11048284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300028380|Ga0268265_12231746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300028708|Ga0307295_10096953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
| 3300028792|Ga0307504_10168067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300029987|Ga0311334_11768421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300031057|Ga0170834_114128050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300031231|Ga0170824_115869578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300031562|Ga0310886_10054175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1830 | Open in IMG/M |
| 3300031740|Ga0307468_100258672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1231 | Open in IMG/M |
| 3300031858|Ga0310892_10480828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300032126|Ga0307415_101873206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300032180|Ga0307471_103532531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300032211|Ga0310896_10887574 | Not Available | 515 | Open in IMG/M |
| 3300032770|Ga0335085_12179928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300032782|Ga0335082_11377148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300033433|Ga0326726_11144992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300033807|Ga0314866_011223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1197 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 8.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.88% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.96% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025957 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0073.00003320 | 2166559005 | Simulated | MLGALLVVAAAGSAFGQGFQGGLRGSVKDAGGVIPALKSR |
| L02_03119460 | 2170459007 | Grass Soil | MRFRAALLIGAFLAVVTSGTAFGQGFQGGLRGAVK |
| JGI10216J12902_1213630711 | 3300000956 | Soil | MRIRAAFLLGAFLAAITSVTVHGQGFQGGLRGSIKDSGGVIPGIEV |
| Ga0062590_1018333261 | 3300004157 | Soil | MRVRASLVFGALLVLVSPPLAAGQGFQGGLRGSLKDAGGVVPGV |
| Ga0062591_1010712261 | 3300004643 | Soil | MRVRASLVFGALLVVLVSPPPAAGQGFQGGLRGSLKDAGGVV |
| Ga0066680_102721591 | 3300005174 | Soil | MRFPAALLLGAFFAVVASGTALGQGFQGGLRGAVKDAGGVIPGVEV |
| Ga0066673_108024712 | 3300005175 | Soil | MRTRAALLLAAFAVLSHAGAVFGQGFQGGLRGAVKDAGGVVPGVEVTLTN |
| Ga0065704_106926031 | 3300005289 | Switchgrass Rhizosphere | MRIRVALMLGAFLAVITSASVFGQGFQGGLRGSVKDSGGVIPGVEVT |
| Ga0066388_1007766781 | 3300005332 | Tropical Forest Soil | MKFRTALILGALLAVISPGFAIGQGFQGGLRGAIKDSGGVVPGVDVT |
| Ga0066388_1054582502 | 3300005332 | Tropical Forest Soil | MRIRAALLLAAFLAVVTSGTAFGQGFQGGLRGSVKDAGGVVPGVE |
| Ga0070674_1003999782 | 3300005356 | Miscanthus Rhizosphere | MRVLASLVVGALLVLVTPHLAGGQGFQGGLRGALKDAGGVVPGVEVTLTN |
| Ga0070694_1011743452 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNRVALLLGAFLAVGISSAAFGQGFQGGVRGSVKDSGGVVPGVEVTLT |
| Ga0070694_1014660942 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFRAALILGALLALATTGTVFGQGFQGGIRGSIKDSGGVVP |
| Ga0070662_1008478631 | 3300005457 | Corn Rhizosphere | MRFRAALLFGAFLAVVTSSTAFGQGFQGGLRGAIKDSGGVIPGV |
| Ga0070662_1014108802 | 3300005457 | Corn Rhizosphere | MRFRATLMGALLVVLTAGTVFGQGFQGGLRGSLKDAGGVVPG |
| Ga0070672_1016333342 | 3300005543 | Miscanthus Rhizosphere | MRVRASLVFGALLVVLASPHLAAGQGFQGGLRGSLKDAGG |
| Ga0066701_109308092 | 3300005552 | Soil | MRLRAALLLGALLTAFTAHAVYGQGFQGGLRGAVKDPG |
| Ga0068855_1003874882 | 3300005563 | Corn Rhizosphere | MRFRAALFLGALLLATHAGSVFGQGFQGGLRGSIKD |
| Ga0068859_1000493521 | 3300005617 | Switchgrass Rhizosphere | MRFRAALLLGAFLAAVTSSTAFGQGFQGGLRGAIKDSGGVIPGVEVTLT |
| Ga0068870_106450621 | 3300005840 | Miscanthus Rhizosphere | MRFRATLMLGALLVVAAASSVFGQGFQGGLRGSIKDAGGVIP |
| Ga0068862_1000481401 | 3300005844 | Switchgrass Rhizosphere | MKFRAALIGALLVVVTAGSVFGQGFQGGIRGSLKDSG |
| Ga0068862_1007789851 | 3300005844 | Switchgrass Rhizosphere | MRVRASLVFGALLVVLASPHLAAGQGFQGGLRGSLK |
| Ga0070716_1001781741 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIRAALALAFLLAVTHASGVFGQGFQGGLRGAVKDAGGVIP |
| Ga0075367_103985221 | 3300006178 | Populus Endosphere | MRFRATLMLGALLVVAAAGSVFGQGFQGGLRGSVKDSGG |
| Ga0066653_106344241 | 3300006791 | Soil | MRFRAALMFGALLAVLTTGTASGQGFQGGIRGSIKDSGG |
| Ga0066660_100907713 | 3300006800 | Soil | MRFRAALAFGAFIAAASATSVFGQGFQGGLRGAIKDPGGVLPGV |
| Ga0075425_1024387911 | 3300006854 | Populus Rhizosphere | MTIRLSAVVGALVVLLAASSAVGQGFYGGLRGSVKDSGGVIPGVEVT |
| Ga0075434_1000965703 | 3300006871 | Populus Rhizosphere | MRFRAALTVGALLAVIIPGLAFGQGFQGGLRGSIKDSG |
| Ga0075434_1010231672 | 3300006871 | Populus Rhizosphere | MRFRAALLLGAFLAVMTSSDAFGQGFQGGLRGSVKDSGG |
| Ga0075424_1010978612 | 3300006904 | Populus Rhizosphere | MKFRATLFVGALLAVISPGLAFGQGFQGGLRGSIKDSGGVVPGV |
| Ga0075436_1011868701 | 3300006914 | Populus Rhizosphere | MRIRASLILGAWVVVSVSASAFGQGFQGGLRGSIKDSGGVVPGVEVTL |
| Ga0066710_1019891373 | 3300009012 | Grasslands Soil | MRFRAALMMGALLVVTTAGAVFGQGFQGGLRGSVKDSGGVIPGVEV |
| Ga0105250_104650541 | 3300009092 | Switchgrass Rhizosphere | MRVRASLVFGALLVVLASSHLAAGQGFQGGLRGSLK |
| Ga0111539_127654111 | 3300009094 | Populus Rhizosphere | MRLRAALLSAAFLAVVTTSTAFGQGFQGGLRGSIKDSGG |
| Ga0105247_103651432 | 3300009101 | Switchgrass Rhizosphere | MSVRASLVFGAALVLASSLVAAGQGFQGGLRGSVKD |
| Ga0066709_1014738931 | 3300009137 | Grasslands Soil | MMRTRAALLLAAFAVLSHAGAVFGQGFQGGLRGAVKDAGGVVPGVE |
| Ga0066709_1034164452 | 3300009137 | Grasslands Soil | VVVTSSAAFGQGFQGGLRGSIKDSGGVIPGVEVTLTNE |
| Ga0114129_100430184 | 3300009147 | Populus Rhizosphere | MRLRAALIGAFLTVAASGTLFGQGFQGGLRGSIKDAG |
| Ga0075423_106723122 | 3300009162 | Populus Rhizosphere | MRFGASLMLGALLVVATANAGFGQGFQGGLRGSVKDAGG |
| Ga0075423_116003481 | 3300009162 | Populus Rhizosphere | MLGAFLAVVTSGTVFGQGFQGGLRGAVKDSGGVIPGVE |
| Ga0105242_113097352 | 3300009176 | Miscanthus Rhizosphere | MSVRASLVFGAALVLASSLVAAGQGFQGGLRGSIKDSGGVI |
| Ga0105249_105012661 | 3300009553 | Switchgrass Rhizosphere | MRFRAALLLGAFLAVVTSGTASGQGFQGGLRGSVKDAGGVVPGVEVT |
| Ga0105249_106307692 | 3300009553 | Switchgrass Rhizosphere | MKLRASLVVGALLVLVTSHRAAGQGFQGGLRGALKDAGGVVPGVEVTLT |
| Ga0105249_108961581 | 3300009553 | Switchgrass Rhizosphere | MRLRAGLLPAAFLAVVTTSTAFGQGFQGGLRGSIKDSG |
| Ga0126374_112081162 | 3300009792 | Tropical Forest Soil | MTWLRAVLAGAVVTLATSGALFGQGFQGGIRGSVKDSGGVVP |
| Ga0134088_100704883 | 3300010304 | Grasslands Soil | MMGALLVVSTAGAVFGQGFQGGLRGSVKDSGGVIPGV |
| Ga0134086_103935052 | 3300010323 | Grasslands Soil | MRAALLLAALAVLTQAGTLFGQGFQGGLRGSIKDPGGVLPGVEVTLTN |
| Ga0126370_114683491 | 3300010358 | Tropical Forest Soil | MTWLRAVLAGAVVTLATSGALFGQGFQGGIRGSVKD |
| Ga0126377_128526952 | 3300010362 | Tropical Forest Soil | MRIRALFVGASLVVSVAVSAYGQGFQGGVRGSIKDSGGV |
| Ga0134127_134242321 | 3300010399 | Terrestrial Soil | MRFRAALIIGALLAVLSSGIAFGQGFQGGVRGSIKDSG |
| Ga0134122_120715032 | 3300010400 | Terrestrial Soil | MRVRASLVVGALLVLATPHLAAGQGFQGGLRGALKDAGGVVPGVEVTLL |
| Ga0134122_120815561 | 3300010400 | Terrestrial Soil | MRTRVALVLAVFLVGTASALFGQGFQGGLRGSIKDAVGVVPGVEV |
| Ga0137392_112191931 | 3300011269 | Vadose Zone Soil | MLGELLVVIAAGAVFGQGFKGGLRGSLKDSGGVVPG |
| Ga0137388_109037971 | 3300012189 | Vadose Zone Soil | MRFRAALVLGALLAMASSSTAFGQGFQGGLRGSIKDSGGVIPGVEVTL |
| Ga0137380_113601192 | 3300012206 | Vadose Zone Soil | MRFPAALLFGAFLAAVASGTALGQGFQGGLRGAVKDAGGVIPGVEV |
| Ga0137379_108049291 | 3300012209 | Vadose Zone Soil | MMRTRAALLLAVFAVLLQSSALFGQGFQGGLRGQIKDPGGVLPGAEVT |
| Ga0150985_1017034261 | 3300012212 | Avena Fatua Rhizosphere | MRFRAALVGALLVVVSSGLAFGQGFQGGLRGSVKDSGG |
| Ga0150985_1222945412 | 3300012212 | Avena Fatua Rhizosphere | MRFRAALFLGALLLATHAGSVFGQGFQGGLRGSIK |
| Ga0157334_10715902 | 3300012509 | Soil | MRFRAAFSLGAFLAVVTSSDALGQGFQGGLRGSLKDSGGVI |
| Ga0157284_103247581 | 3300012893 | Soil | MRIGASLVFGALLVVVVSPQPAAGQGFQGGLRGSLKDAG |
| Ga0157301_102729311 | 3300012911 | Soil | MRLRASLVVGAVLVLLTSHLAAGQGFQGGLRGSLKDTGGVVPGVE |
| Ga0137419_106115301 | 3300012925 | Vadose Zone Soil | MRAALVGAFLTVAASGTLFGQGFQGGLRGSIKDPG |
| Ga0137416_120595861 | 3300012927 | Vadose Zone Soil | MRAALLLGAILTLAVSGTLFAQGFQGGLRGSIKDAGGV |
| Ga0137410_118020252 | 3300012944 | Vadose Zone Soil | MRFRAALLLGAFVAALTSSTAFGQGFQGCLRGSIKDSG |
| Ga0157378_104773633 | 3300013297 | Miscanthus Rhizosphere | VRFRATLIGALLVVLTAGTVFGQGFQGGLRGSLKDAGG |
| Ga0157377_117219901 | 3300014745 | Miscanthus Rhizosphere | MRIRVALIGAFLAVVTSGTVFGQGFQGGLRGSVKDSGGVIP |
| Ga0132258_118772181 | 3300015371 | Arabidopsis Rhizosphere | MRIRAALLIGALLAMISPGLVFGQGFQGGLRGAVKD |
| Ga0182038_119469522 | 3300016445 | Soil | MKVRAALIIGAFLAVLSPGGAFGQGFQGGLRGVIKDSGGVVPGVEVTL |
| Ga0187773_106436681 | 3300018064 | Tropical Peatland | MRFRAALVLGALLAVATSSTAFGQGFQGGLRGSIKDSGGV |
| Ga0184618_102567831 | 3300018071 | Groundwater Sediment | MRVRASLVVGAVLVLATSHFAAGQGFQGGLRGSVKDSGG |
| Ga0210382_100532602 | 3300021080 | Groundwater Sediment | MRVRASLVVGAVLVLATSHLAAGQGFQGGLRGSLKDTGGVVPGVEV |
| Ga0210382_102068432 | 3300021080 | Groundwater Sediment | MRIRASLVVGAVLVLATSHFAAGQGFQGGLRGSVKDSG |
| Ga0207650_110181922 | 3300025925 | Switchgrass Rhizosphere | MRLRASLVVGAVLVLLTSHLAAGQGFQGGLRGSLKDTGGV |
| Ga0207701_117015042 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFRATLIFGALLVVATASSVFGQGFQGGLRGSIKDAGGV |
| Ga0207667_114230272 | 3300025949 | Corn Rhizosphere | MRFRAALFLGALLLATHAGSVFGQGFQGGLRGSIKDAGGVIP |
| Ga0210089_10318712 | 3300025957 | Natural And Restored Wetlands | MKFRSALILGALLAVISPGFAFGQGFQGGLRGSVK |
| Ga0207651_104332313 | 3300025960 | Switchgrass Rhizosphere | MRFRAALLLGAFLAVVTSSTAFGQGFQGGLRGAIKDSGGVIPGV |
| Ga0207712_100240571 | 3300025961 | Switchgrass Rhizosphere | MRVRASLVFGALLVVLASPHLAAGQGFQGGLRGSLKDAGGVVPGVEVVLT |
| Ga0207712_104530771 | 3300025961 | Switchgrass Rhizosphere | MKLRASLFVGALLVLVTSHLAAGQGFQGGLRGALKD |
| Ga0207712_113414491 | 3300025961 | Switchgrass Rhizosphere | MKFRAALIGALLVVVTAGSVFGQGFQGGIRGSLKDSGGVVPGV |
| Ga0207712_114147892 | 3300025961 | Switchgrass Rhizosphere | MRLRASLVVGAVLVLVTSHLAAGQGFQGGLRGSLKDTGGV |
| Ga0207668_119020621 | 3300025972 | Switchgrass Rhizosphere | MRVRASLVFGALLVILASSHLAAGQGFQGGLRGSLKDAGGVVPGVEV |
| Ga0207703_117624342 | 3300026035 | Switchgrass Rhizosphere | MSVRASLVFGAALVLASSLVAAGQGFQGGLRGSIKDSG |
| Ga0207678_108643581 | 3300026067 | Corn Rhizosphere | MRFRATLILGALLVVAAAGSVFGQGFQGGLRGSVKD |
| Ga0207676_124360292 | 3300026095 | Switchgrass Rhizosphere | MSVRASLVFGAALVLASSLVAAGQGFQGGLRGSIKD |
| Ga0209237_12645411 | 3300026297 | Grasslands Soil | MRIRASLILGASLMVSITASVYGQGFQGGLRGSIKDSGG |
| Ga0268265_102108623 | 3300028380 | Switchgrass Rhizosphere | MKFRAALIGALLVVVTAGSVFGQGFQGGIRGSLKDSGGVVPG |
| Ga0268265_110482841 | 3300028380 | Switchgrass Rhizosphere | MRFRAALIGALLVVVTAGSVFGQGFQGGIRGSLKDSGGV |
| Ga0268265_122317462 | 3300028380 | Switchgrass Rhizosphere | MRFRATLIIGALLVVATAGSVFGQGFQGTLRGSIKDAGGVIPG |
| Ga0307295_100969532 | 3300028708 | Soil | MRVGATLVFGAVLVLALSPFAAGQGFQGGVRGSIKDSG |
| Ga0307504_101680671 | 3300028792 | Soil | MRFRAALVLGAVLLVVTSSAVFGQGFQGGLRGSIKDAGGVI |
| Ga0311334_117684212 | 3300029987 | Fen | MKLRAALILGALLVLSTSNALFAQGFQGGLRGSVKDNGGVVPGVE |
| Ga0170834_1141280502 | 3300031057 | Forest Soil | MRFRAALVVCALVSAATPNVVFGQGFQGGLRGAIKDAGGVVP |
| Ga0170824_1158695781 | 3300031231 | Forest Soil | MRIRAALIIGALLVVTSSGVVFGQGFQGGLRGSIKDAGGV |
| Ga0310886_100541751 | 3300031562 | Soil | MKFRTALILGALLAVISPGFAFAQGFQGGLRGSIKDS |
| Ga0307468_1002586723 | 3300031740 | Hardwood Forest Soil | MRFRAALIGALLVVVTAGHLFAQGFQGGIRGSLKDAGGVVPGVEVTLTN |
| Ga0310892_104808282 | 3300031858 | Soil | MRFRAALLLGAFLAVVTSSTAFGQGFQGGLRGAIKDSGGVIPGVE |
| Ga0307415_1018732062 | 3300032126 | Rhizosphere | MRFRGALIGALLVVATAGSVFGQGFQGGIRGSLKDAGGVVPGVEVT |
| Ga0307471_1035325312 | 3300032180 | Hardwood Forest Soil | MRIRALVFGAVVVVSVAASVAGQGFQGGIRGSIKDSGGVVP |
| Ga0310896_108875742 | 3300032211 | Soil | MRIRVALMLGAFLATVTSVTVFGQGFQGGLRGSVK |
| Ga0335085_121799282 | 3300032770 | Soil | MRIRAALAGALLAVLAASPLFGQGFQGGLRGAMKDQ |
| Ga0335082_113771482 | 3300032782 | Soil | MRIRATLVGALLAVLAASPLFGQGFQGGLRGAVKDQGGVLPGVEVTL |
| Ga0326726_111449922 | 3300033433 | Peat Soil | MRFRAALVLGALLALASSSTAFGQGFQGGLRGSIKDSGGVIPGVEVTL |
| Ga0314866_011223_2_130 | 3300033807 | Peatland | MRIRATLIGALLAVLAASPLFGQGFQGGLRGAFKDPGGVLPGV |
| ⦗Top⦘ |