NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F097912

Metagenome Family F097912

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097912
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 42 residues
Representative Sequence MADIQRISVQQAHAKTKANQALLVCAYEDEAKCRMLNLDGS
Number of Associated Samples 93
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.15 %
% of genes near scaffold ends (potentially truncated) 93.27 %
% of genes from short scaffolds (< 2000 bps) 90.38 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (68.269 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(28.846 % of family members)
Environment Ontology (ENVO) Unclassified
(34.615 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.154 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.04%    β-sheet: 11.59%    Coil/Unstructured: 75.36%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF04679DNA_ligase_A_C 2.88
PF13561adh_short_C2 1.92
PF01734Patatin 1.92
PF03631Virul_fac_BrkB 1.92
PF00069Pkinase 1.92
PF00216Bac_DNA_binding 1.92
PF01545Cation_efflux 0.96
PF01068DNA_ligase_A_M 0.96
PF10996Beta-Casp 0.96
PF02518HATPase_c 0.96
PF14534DUF4440 0.96
PF07521RMMBL 0.96
PF09720Unstab_antitox 0.96
PF13414TPR_11 0.96
PF02630SCO1-SenC 0.96
PF08388GIIM 0.96
PF13518HTH_28 0.96
PF02371Transposase_20 0.96
PF03544TonB_C 0.96
PF02614UxaC 0.96
PF13602ADH_zinc_N_2 0.96
PF02837Glyco_hydro_2_N 0.96
PF10754DUF2569 0.96
PF14022DUF4238 0.96
PF00581Rhodanese 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 7.69
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 3.85
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 1.92
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 1.92
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 1.92
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 1.92
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 1.92
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.96
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.96
COG1225PeroxiredoxinPosttranslational modification, protein turnover, chaperones [O] 0.96
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.96
COG1904Glucuronate isomeraseCarbohydrate transport and metabolism [G] 0.96
COG1999Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC familyPosttranslational modification, protein turnover, chaperones [O] 0.96
COG3250Beta-galactosidase/beta-glucuronidaseCarbohydrate transport and metabolism [G] 0.96
COG3547TransposaseMobilome: prophages, transposons [X] 0.96
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.96
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.27 %
UnclassifiedrootN/A31.73 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_17295543All Organisms → cellular organisms → Bacteria1347Open in IMG/M
3300000955|JGI1027J12803_100493307All Organisms → cellular organisms → Bacteria3430Open in IMG/M
3300002245|JGIcombinedJ26739_101117351Not Available675Open in IMG/M
3300004080|Ga0062385_10315149All Organisms → cellular organisms → Bacteria → Acidobacteria903Open in IMG/M
3300004092|Ga0062389_100682565All Organisms → cellular organisms → Bacteria → Acidobacteria1199Open in IMG/M
3300004268|Ga0066398_10113467All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300005174|Ga0066680_10655233All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300005174|Ga0066680_10667336All Organisms → cellular organisms → Bacteria → Proteobacteria642Open in IMG/M
3300005180|Ga0066685_10763042All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae → Desulfuromonas → unclassified Desulfuromonas → Desulfuromonas sp. TF658Open in IMG/M
3300005180|Ga0066685_11130871All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → Synergistaceae → Acetomicrobium → Acetomicrobium thermoterrenum511Open in IMG/M
3300005332|Ga0066388_103630950Not Available788Open in IMG/M
3300005440|Ga0070705_101282332Not Available607Open in IMG/M
3300005445|Ga0070708_100419052All Organisms → cellular organisms → Bacteria1263Open in IMG/M
3300005445|Ga0070708_100741907All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300005555|Ga0066692_10985955All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300005559|Ga0066700_10792025All Organisms → cellular organisms → Bacteria → Proteobacteria639Open in IMG/M
3300005560|Ga0066670_10820899All Organisms → cellular organisms → Bacteria → Proteobacteria564Open in IMG/M
3300005586|Ga0066691_10618616All Organisms → cellular organisms → Bacteria → Proteobacteria643Open in IMG/M
3300005598|Ga0066706_11384864All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300005602|Ga0070762_10147338All Organisms → cellular organisms → Bacteria1406Open in IMG/M
3300005764|Ga0066903_101435825All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1298Open in IMG/M
3300005843|Ga0068860_101445945All Organisms → cellular organisms → Bacteria → Acidobacteria709Open in IMG/M
3300005921|Ga0070766_11200093All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300006173|Ga0070716_100607186Not Available824Open in IMG/M
3300006903|Ga0075426_10313958All Organisms → cellular organisms → Bacteria → Acidobacteria1148Open in IMG/M
3300007258|Ga0099793_10330612All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium743Open in IMG/M
3300009038|Ga0099829_10625054Not Available895Open in IMG/M
3300009789|Ga0126307_10747005All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300010046|Ga0126384_12333001Not Available517Open in IMG/M
3300010159|Ga0099796_10309775Not Available671Open in IMG/M
3300011271|Ga0137393_10363931Not Available1236Open in IMG/M
3300012096|Ga0137389_11089032Not Available685Open in IMG/M
3300012198|Ga0137364_10297685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_2_20CM_53_111197Open in IMG/M
3300012199|Ga0137383_11034948All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Bryocella → Bryocella elongata597Open in IMG/M
3300012202|Ga0137363_10645854All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium894Open in IMG/M
3300012203|Ga0137399_10062207All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_672767Open in IMG/M
3300012203|Ga0137399_10167899Not Available1764Open in IMG/M
3300012205|Ga0137362_10306628Not Available1375Open in IMG/M
3300012205|Ga0137362_10974836Not Available722Open in IMG/M
3300012211|Ga0137377_11919605Not Available509Open in IMG/M
3300012361|Ga0137360_10148410All Organisms → cellular organisms → Bacteria1855Open in IMG/M
3300012362|Ga0137361_10346176All Organisms → cellular organisms → Bacteria → Acidobacteria1364Open in IMG/M
3300012582|Ga0137358_10799308Not Available626Open in IMG/M
3300012683|Ga0137398_10776339Not Available669Open in IMG/M
3300012685|Ga0137397_11153227Not Available561Open in IMG/M
3300012917|Ga0137395_11063511All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300012917|Ga0137395_11086476Not Available568Open in IMG/M
3300012918|Ga0137396_10522112Not Available880Open in IMG/M
3300012922|Ga0137394_11118373All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300012922|Ga0137394_11142383All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300012923|Ga0137359_11782571All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300012927|Ga0137416_10079196All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_672410Open in IMG/M
3300012929|Ga0137404_10888648All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300012944|Ga0137410_11758362Not Available546Open in IMG/M
3300012957|Ga0164303_10224605Not Available1058Open in IMG/M
3300013308|Ga0157375_10810036All Organisms → cellular organisms → Bacteria → Acidobacteria1085Open in IMG/M
3300014157|Ga0134078_10297913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales693Open in IMG/M
3300015242|Ga0137412_10561318Not Available868Open in IMG/M
3300015265|Ga0182005_1262024All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300015373|Ga0132257_104510739Not Available507Open in IMG/M
3300016404|Ga0182037_10004154All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium7907Open in IMG/M
3300018433|Ga0066667_12131854Not Available520Open in IMG/M
3300019786|Ga0182025_1155016All Organisms → cellular organisms → Bacteria2337Open in IMG/M
3300020199|Ga0179592_10531737All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300020581|Ga0210399_10060753All Organisms → cellular organisms → Bacteria3049Open in IMG/M
3300021088|Ga0210404_10466167All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300021168|Ga0210406_10342045Not Available1208Open in IMG/M
3300021168|Ga0210406_11004646All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300021171|Ga0210405_10096354All Organisms → cellular organisms → Bacteria2334Open in IMG/M
3300021178|Ga0210408_11147172All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300021401|Ga0210393_10114166All Organisms → cellular organisms → Bacteria2156Open in IMG/M
3300021433|Ga0210391_10339055All Organisms → cellular organisms → Bacteria → Acidobacteria1179Open in IMG/M
3300021477|Ga0210398_10340349All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1223Open in IMG/M
3300021478|Ga0210402_10396665All Organisms → cellular organisms → Bacteria → Acidobacteria1281Open in IMG/M
3300021559|Ga0210409_10492023All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300022756|Ga0222622_10293141All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300025910|Ga0207684_10499001All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300025961|Ga0207712_11951102All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300026035|Ga0207703_11382648All Organisms → cellular organisms → Bacteria → Acidobacteria677Open in IMG/M
3300026118|Ga0207675_100595382All Organisms → cellular organisms → Bacteria → Acidobacteria1108Open in IMG/M
3300026320|Ga0209131_1261649All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300026332|Ga0209803_1226035Not Available659Open in IMG/M
3300026557|Ga0179587_10098475All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1766Open in IMG/M
3300027629|Ga0209422_1151254Not Available520Open in IMG/M
3300027654|Ga0209799_1010179All Organisms → cellular organisms → Bacteria → Acidobacteria2008Open in IMG/M
3300027660|Ga0209736_1034547All Organisms → cellular organisms → Bacteria → Acidobacteria1489Open in IMG/M
3300027727|Ga0209328_10092965All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium921Open in IMG/M
3300027889|Ga0209380_10766047All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300027895|Ga0209624_10447668Not Available861Open in IMG/M
3300028380|Ga0268265_10270928All Organisms → cellular organisms → Bacteria1514Open in IMG/M
3300028906|Ga0308309_10450669All Organisms → cellular organisms → Bacteria → Proteobacteria1108Open in IMG/M
3300031057|Ga0170834_100466992All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300031128|Ga0170823_12087632All Organisms → cellular organisms → Bacteria1545Open in IMG/M
3300031708|Ga0310686_100256781Not Available883Open in IMG/M
3300031708|Ga0310686_114008847All Organisms → cellular organisms → Bacteria7438Open in IMG/M
3300031753|Ga0307477_10279640Not Available1154Open in IMG/M
3300031942|Ga0310916_11648657Not Available520Open in IMG/M
3300031959|Ga0318530_10200318All Organisms → cellular organisms → Bacteria → Acidobacteria819Open in IMG/M
3300031962|Ga0307479_10235601Not Available1805Open in IMG/M
3300031962|Ga0307479_10292020All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1611Open in IMG/M
3300031962|Ga0307479_10431479All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1302Open in IMG/M
3300032075|Ga0310890_10796168All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300032180|Ga0307471_102942394Not Available604Open in IMG/M
3300032205|Ga0307472_100100480Not Available1988Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil28.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.54%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.77%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.88%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.92%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.92%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.96%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.96%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_011000002088090014SoilMADMAHIERIDVKQAREKAHQALLVCAYENEAKHRMF
JGI1027J12803_10049330763300000955SoilMVDIKRISAQQAHAKTKANQALLVCAYEDEAKCRMLNLDG
JGIcombinedJ26739_10111735123300002245Forest SoilMADIQGIDAQQTHTKAKSNQALLVCAYEDEAKCRRLNLEGSIYRSPASSRG*
Ga0062385_1031514913300004080Bog Forest SoilMADIKRISVQQAHAKTEAKQALLVCAYEDEAKCRMLNLDGSISF
Ga0062389_10068256513300004092Bog Forest SoilMSQGGQMADIKRISVQQAHAKTEAKQALLVCAYEDEAKCRMLNLD
Ga0066398_1011346713300004268Tropical Forest SoilMVDMADIERISVKQAREKAHQALLVCAYENEAKHRMSTSSIS*
Ga0066680_1065523323300005174SoilMADIKRISVQQAQAKTKANQALLVCAYEDEAKCRMLNLDGSISF
Ga0066680_1066733623300005174SoilMADVKRISVQQAYAKTNANQALLVCAYEDEAKCRMLNLDGSISF
Ga0066685_1076304213300005180SoilMADNQRISAQQAHAKSKAKQALLACAYEDEAKCRMLNLDGSISFA
Ga0066685_1113087113300005180SoilMADIKRISVQQAHAKTKANQALLVCAYEDEAKCRMLNLDGSISF
Ga0066388_10363095023300005332Tropical Forest SoilMADISDMERISAKQAREKAHQALLVCAYENEVKHRMLNLDGSVSLANF
Ga0070705_10128233223300005440Corn, Switchgrass And Miscanthus RhizosphereMADMADIERIGVKQARGKAHQALLVCAYENEAKHRMFNLDGSISL
Ga0070708_10041905243300005445Corn, Switchgrass And Miscanthus RhizosphereMADMAHIERIDVKQAREKAHQALLVCAYENEAKHRMFNLDGSISL
Ga0070708_10074190723300005445Corn, Switchgrass And Miscanthus RhizosphereMADMADIERIGVKQARGKAHQALLVCAYENEAKHRMFNR*
Ga0066692_1098595523300005555SoilMADIKRISVQQAQAKTKANQALLVCAYEDEAKCRMLNLDGSISFA
Ga0066700_1079202523300005559SoilMADVKRISVQQAYAKTNANQALLVCAYEDEAKCRMLNLDGSIS
Ga0066670_1082089923300005560SoilMADVKRISVQQAYAKTNANQALLVCAYEDEAKCRMLNLDG
Ga0066691_1061861623300005586SoilMADVKRISVQQAYAKTNANQALLVCAYEDEAKCRMLNLDGSISFA
Ga0066706_1138486413300005598SoilMADIKRISVQQAYAKTKANQALLVCAYEDEAKCRMLNLDGSISFA
Ga0070762_1014733833300005602SoilMADIQRISVQQAHAKTKANQALLVCAYEDEAKCRM
Ga0066903_10143582523300005764Tropical Forest SoilMADIERISVKQAREKAHQALLVCAYENEAKHRMFNLDGS
Ga0068860_10144594523300005843Switchgrass RhizosphereMADIERIGVKQAHEKVHQALLVCAYENEAKHRMFNLD
Ga0070766_1120009313300005921SoilMAEIQRISVQQAHAKTKANQALLVCAYEDEAKCQR
Ga0070716_10060718623300006173Corn, Switchgrass And Miscanthus RhizosphereMADMARISVKQARGKAHQALLVCAYENEAKHRMFNLDGSISLA
Ga0075426_1031395843300006903Populus RhizosphereMADMADIERIGVKQARGKAHQALLVCAYENEAKHRMFNLDGSISLANFRS
Ga0099793_1033061223300007258Vadose Zone SoilMADIERISAQQAHAKTKANQALLVCAYEDEAKCRMLNLDGS
Ga0099829_1062505413300009038Vadose Zone SoilMADIQRISAQEAHTKTKANQALLVCAYEDEAKCRMLN
Ga0126307_1074700523300009789Serpentine SoilMADIERISVDEAHRRVAANQALLVCAYEDDARCRMLNLDGSMSLT
Ga0126384_1233300123300010046Tropical Forest SoilMADTADIERISVKQAREKAHQALLVCAYENEAKHRILNLDGSISLANFRSRLASLPK
Ga0099796_1030977523300010159Vadose Zone SoilMADIERINAQQTHTQAESNRALLVCAYEDEAKCRMLNLDG
Ga0137393_1036393113300011271Vadose Zone SoilMADIERISAQQSHTKAKSNQALLVCAYEDEAKCRMLNLDGSISF
Ga0137389_1108903223300012096Vadose Zone SoilMQRPTDIGRGGDMADIQRISVQQAHAKTKANQALLVCAYEDEAKCRMLNL
Ga0137364_1029768513300012198Vadose Zone SoilVVDIERISAQQAHAKIKANQALLVCAYEDEAKCNMFNLEGSISFTS
Ga0137383_1103494823300012199Vadose Zone SoilMADIKRISVQQAYAKTKANQALLVCAYEDEAKCRMLNLDGSIS
Ga0137363_1064585433300012202Vadose Zone SoilMADIKRISVQQAYAKTKANQALLVCAYEDEAKCRML
Ga0137399_1006220713300012203Vadose Zone SoilMADIKRISVQQAYAKTKANQALLVCAYEDEAKCRM
Ga0137399_1016789933300012203Vadose Zone SoilMTDIERISVQQARAKTKANQVLLVCAYEDEAKCRMLNLDGSI
Ga0137362_1030662813300012205Vadose Zone SoilMADIERISAQQAHTNAKSNQALLVCAYEDEAKCRMLN
Ga0137362_1097483613300012205Vadose Zone SoilMADIQRISAQEAHAKTKANQALLVCAYEDEAKCRMLNL
Ga0137377_1191960513300012211Vadose Zone SoilMAQGGQMAEIKRISVQQAYAKTNANQALLVCAYEDEAKCRMLN
Ga0137360_1014841053300012361Vadose Zone SoilMADVERISVQQAHAKTNAKQALLVCAYEDEAKCRMFNLEGSISFTKF
Ga0137361_1034617613300012362Vadose Zone SoilMAQGGQMADIKRISVQQAYAKTKANQALLVCAYEDE
Ga0137358_1079930813300012582Vadose Zone SoilMADIERISVQQAQAKTKANQALLVCAYEDEAKCRMLNLEGSIS
Ga0137398_1077633923300012683Vadose Zone SoilMADIERIGAQQAHTKAKSNQALLVCAYEDEAKCRML
Ga0137397_1115322723300012685Vadose Zone SoilMADIERISVQQAHTKSKSNQALLVCAYEDEAKCRMLNLDDSISFTSF
Ga0137395_1106351113300012917Vadose Zone SoilMADIERISAQQAHAKTKANQALLVCAYEDEAKCRMLNLDGSISFA
Ga0137395_1108647613300012917Vadose Zone SoilMADIQRISAQQAHAKSKANQALLVCAYEDEAKCRMLNLDGSISFAS
Ga0137396_1052211233300012918Vadose Zone SoilMADIERISAQQAHTKATSKQALLVCGYEDEAKCRMFNLDGSISFTSF
Ga0137394_1111837313300012922Vadose Zone SoilMADIERISVQEAHPKTNANQALLVCAYEDEAKCRM
Ga0137394_1114238313300012922Vadose Zone SoilMADIERISVQEAHRKTKATQALLVCAYEDEAKCRMLN
Ga0137359_1178257123300012923Vadose Zone SoilMADIKRISVQQAHAKTKANQALLVCAYEDEAKCRMLNLDGSISFAAL
Ga0137416_1007919613300012927Vadose Zone SoilMAQGGQMADIKRISVQQAYAKTKANQALLVCAYEDEAKCRM
Ga0137404_1088864813300012929Vadose Zone SoilMADIERISVEEAHRKLKENQALLVCAYEDEAKCRMLDL
Ga0137410_1175836213300012944Vadose Zone SoilMADIERISVQQAHTKSKSNQALLVCAYEDEAKCRMLNLDGSIS
Ga0164303_1022460533300012957SoilMADMADIERISVKQARGKAHQALLVCAYENEAKHRMFNLDGTISLADFQ
Ga0157375_1081003633300013308Miscanthus RhizosphereMADMADIERISVKQARGKAHQALLVCAYENEAKHR
Ga0134078_1029791313300014157Grasslands SoilMAQGGQMADVKRISVQQAYAKTNANQALLVCAYEDEAKCRMLNLDGSISF
Ga0137412_1056131823300015242Vadose Zone SoilMADIERISAQQANTKAKSNQALLVCAYEDEAKCRMLN
Ga0182005_126202423300015265RhizosphereMDVQRISVGDARRKVQAKQALLVCAYEDAAKCRMVNLE
Ga0132257_10451073913300015373Arabidopsis RhizosphereMADIERIGVIQARGKAHQALLVCAYENEAKHRMFNLDGSISLANFRS
Ga0182037_10004154103300016404SoilMVDIERISVKQAREKAHQALLVCAYENEAKQRMFNLDGSISLA
Ga0066667_1213185413300018433Grasslands SoilVPEITRIPVEEAHQKTSAGQALLVCAYDDEAKCRTFNLKG
Ga0182025_115501623300019786PermafrostMADIKRISVQQAHAKTKANQALLVCAYEDEAKCRMLNLDGSISFA
Ga0179592_1053173713300020199Vadose Zone SoilMADIERISAQQAHTKAESNQALLVCAYEDEAKCRMLNLDGSI
Ga0210399_1006075313300020581SoilMADIQRITVQQAYAKTKANQALLVCAYEDEAKCRKLSLDGSISFASL
Ga0210404_1046616733300021088SoilMADIERISVQQAHAKANQALLVCAYEDEAKCRMLNLDGSIS
Ga0210406_1034204523300021168SoilMADIQRISVQEAHAKTKAKQALLVCAYEDEAKCRK
Ga0210406_1100464623300021168SoilMADIKRISVQQAHAKTKANQALLVCAYEDEAKCRM
Ga0210405_1009635433300021171SoilMADIKRISVQQAHAKTNAKQALLVCAYEDEAKCRMFNLEGSLSFTKF
Ga0210408_1114717213300021178SoilMADIKRISVQQAHAKTNAKQALLVCAYEDEAKCRMFNLEGSISFTK
Ga0210393_1011416643300021401SoilMAEVERISVEQAYRRVKEHQALLVCAYEDEAKCRML
Ga0210391_1033905513300021433SoilMADIKRISVQQAHAKTKAKQALLVCAYEDEAKCQRLNLDGSISF
Ga0210398_1034034933300021477SoilMADIKRIGVQQAYAKTKANQALLVCAYEDEAKCRMLNLDGSISF
Ga0210402_1039666533300021478SoilMADIQRISVQQAHAKTKANQALLVCAYEDEAKCRMLNLDGS
Ga0210409_1049202313300021559SoilMADVERIGVEQAHAKANQALLVCAYEDEAKCRVFNLAGSISLAN
Ga0222622_1029314113300022756Groundwater SedimentMADIERISVEDAHKKLKENQALLVCAYEDEAKCRMLNLDGS
Ga0207684_1049900113300025910Corn, Switchgrass And Miscanthus RhizosphereMADIKRISVQQAYAKTKANQALLVCAYEDEAKCRMLNLDGSISFAS
Ga0207712_1195110213300025961Switchgrass RhizosphereMPDIERISVEDAHRKVGANQALLVCAYEDEAKCRAVNL
Ga0207703_1138264813300026035Switchgrass RhizosphereMADIERIGVKQAHEKVHQALLVCAYENEAKHRMFNLDDSIS
Ga0207675_10059538213300026118Switchgrass RhizosphereMPDIERISVEEAHRKVGANQALLVCAYEDEAKCRAVNL
Ga0209131_126164923300026320Grasslands SoilMADIQRISAQEAHAKTKANQALLVCAYEDEAKCRMLNLDGSI
Ga0209803_122603513300026332SoilMANMADIERIGVKQARGKAHQALLVCAYESEAKHRMFNLDGSISLANFRS
Ga0179587_1009847533300026557Vadose Zone SoilMADIKRISVQQAYAKTKANQALLVCAYEDEAKCRMLN
Ga0209422_115125423300027629Forest SoilMADIERINAQQAHTKAKSNQALLVCAYEDEAKCRMLNL
Ga0209799_101017933300027654Tropical Forest SoilMVDMADIERISVKQAREKAHQALLVCAYENEAKHRMSTSSIS
Ga0209736_103454713300027660Forest SoilVADIQRISVQEAHAKTKANQALLVCAYEDEAKCRMLNLDGSI
Ga0209328_1009296513300027727Forest SoilMADIQRISAQQAHAKSKANQALLVCAYEDEAKCRMLNLDGSIS
Ga0209380_1076604723300027889SoilMAEIQRISVQQAHAKTKANQALLVCAYEDEAKCQRLSLDGSIS
Ga0209624_1044766823300027895Forest SoilMADIKRIGVQQAYAKTKANQALLVCAYEDEAKCRMLNLD
Ga0268265_1027092813300028380Switchgrass RhizosphereMAEIERISAEETHRKVDANQALLVCAYEDDAKCRMV
Ga0308309_1045066913300028906SoilMADIQGIDAQQTHTKAKSNQALLVCAYEDEAKCRRLNLDGSISFANFKSR
Ga0170834_10046699213300031057Forest SoilMADIKRISVQQAHAKTKANQALLVCAYEDEAKCRMLNL
Ga0170823_1208763213300031128Forest SoilMAEVERISVEQAYRRVKEHQGLLVCAYEDEAKCRMLNLDGSI
Ga0310686_10025678133300031708SoilMADIQRISVQQAHAKTKANQALLVCAYEDEAKCRMLNLDG
Ga0310686_11400884713300031708SoilMADIKRISVQQAHAKTKANQALLVCAYEDEAKCRMLNLDG
Ga0307477_1027964023300031753Hardwood Forest SoilMADIERISAEKAHERADQALLVCAYEDEAKYRLCRVTGKVRS
Ga0310916_1164865723300031942SoilMADIERISVKQAREKAHQALLVCAYDNEAKYRIANLEDSISLADFRSR
Ga0318530_1020031813300031959SoilMADIERISVKQAREKANQALLVCAYDNEAKYRIVNLEGSISLAH
Ga0307479_1023560133300031962Hardwood Forest SoilMADIHRISAQQAHAKSKANQALLVCAYEDEAKCRMLNLDGSISFASL
Ga0307479_1029202053300031962Hardwood Forest SoilMADIKRISVQQAYAKTKANQALLVCAYEDEAKCRMLNLD
Ga0307479_1043147923300031962Hardwood Forest SoilMAQGGQMADIKRISVQQAYAKTKTKTKTKTKTNQALLVCAYEDEEK
Ga0310890_1079616813300032075SoilMAEIERISAEETHRKVDANQALLVCAYEDDAKCRMVNLE
Ga0307471_10294239423300032180Hardwood Forest SoilMADVKRISVQQAYAKTKANQALLVCAYEDEAKCRM
Ga0307472_10010048033300032205Hardwood Forest SoilMADIHRISAQQAHAKSKANQALLVCAYEDEAKCRMLNLERSISFAS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.