Basic Information | |
---|---|
Family ID | F097893 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 40 residues |
Representative Sequence | MEATGETTAVERELAIAASPETVWEFLVDPDKATRWMG |
Number of Associated Samples | 97 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 98.08 % |
% of genes near scaffold ends (potentially truncated) | 97.12 % |
% of genes from short scaffolds (< 2000 bps) | 98.08 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.423 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.038 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.308 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.76% β-sheet: 0.00% Coil/Unstructured: 74.24% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF01022 | HTH_5 | 47.12 |
PF12840 | HTH_20 | 16.35 |
PF10604 | Polyketide_cyc2 | 13.46 |
PF08327 | AHSA1 | 1.92 |
PF01344 | Kelch_1 | 1.92 |
PF13473 | Cupredoxin_1 | 1.92 |
PF03033 | Glyco_transf_28 | 0.96 |
PF12697 | Abhydrolase_6 | 0.96 |
PF08241 | Methyltransf_11 | 0.96 |
PF02518 | HATPase_c | 0.96 |
PF01176 | eIF-1a | 0.96 |
PF13424 | TPR_12 | 0.96 |
PF00313 | CSD | 0.96 |
PF02782 | FGGY_C | 0.96 |
PF00135 | COesterase | 0.96 |
PF00596 | Aldolase_II | 0.96 |
PF01243 | Putative_PNPOx | 0.96 |
PF04542 | Sigma70_r2 | 0.96 |
PF13350 | Y_phosphatase3 | 0.96 |
PF12680 | SnoaL_2 | 0.96 |
PF13248 | zf-ribbon_3 | 0.96 |
PF01804 | Penicil_amidase | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.96 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.96 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.96 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.96 |
COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.96 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000156|NODE_c0311614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 598 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10131532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 608 | Open in IMG/M |
3300000956|JGI10216J12902_102777182 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300004080|Ga0062385_10925483 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300004081|Ga0063454_100261883 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
3300004114|Ga0062593_102400688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia acaciae | 595 | Open in IMG/M |
3300005093|Ga0062594_100560490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 988 | Open in IMG/M |
3300005332|Ga0066388_102363417 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300005356|Ga0070674_101692201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia acaciae | 572 | Open in IMG/M |
3300005468|Ga0070707_100018934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6484 | Open in IMG/M |
3300005534|Ga0070735_10491966 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300005546|Ga0070696_100487491 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300005558|Ga0066698_10593150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia acaciae | 748 | Open in IMG/M |
3300005560|Ga0066670_10086254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1725 | Open in IMG/M |
3300005566|Ga0066693_10474186 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300005569|Ga0066705_10131379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1521 | Open in IMG/M |
3300005576|Ga0066708_11015986 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300005617|Ga0068859_100486396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1330 | Open in IMG/M |
3300006046|Ga0066652_101248469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 702 | Open in IMG/M |
3300006173|Ga0070716_100956022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 674 | Open in IMG/M |
3300006573|Ga0074055_10013635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 901 | Open in IMG/M |
3300006580|Ga0074049_13143541 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300006791|Ga0066653_10269220 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300006845|Ga0075421_101469793 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300006847|Ga0075431_101282641 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300006847|Ga0075431_101415227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
3300006854|Ga0075425_102939193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
3300006854|Ga0075425_103132210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia acaciae | 504 | Open in IMG/M |
3300006871|Ga0075434_102004576 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300007076|Ga0075435_100719933 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300007076|Ga0075435_100839292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 800 | Open in IMG/M |
3300009090|Ga0099827_10873767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 779 | Open in IMG/M |
3300009137|Ga0066709_103963852 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300009147|Ga0114129_13262599 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300010042|Ga0126314_11219703 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300010045|Ga0126311_11430584 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300010166|Ga0126306_10965009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
3300010362|Ga0126377_12778791 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300010867|Ga0126347_1403369 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300012008|Ga0120174_1122291 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300012186|Ga0136620_10156524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1027 | Open in IMG/M |
3300012186|Ga0136620_10160538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1012 | Open in IMG/M |
3300012200|Ga0137382_10199131 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
3300012201|Ga0137365_11036060 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300012354|Ga0137366_11231931 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300012362|Ga0137361_11225428 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300012901|Ga0157288_10189498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
3300012908|Ga0157286_10276304 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300012930|Ga0137407_10364829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1332 | Open in IMG/M |
3300012930|Ga0137407_11406247 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300012960|Ga0164301_10871000 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300012977|Ga0134087_10277169 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300012977|Ga0134087_10361384 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300015358|Ga0134089_10556141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
3300015371|Ga0132258_13074099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1154 | Open in IMG/M |
3300015374|Ga0132255_105824930 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300017792|Ga0163161_10702773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 842 | Open in IMG/M |
3300017965|Ga0190266_11328437 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300018061|Ga0184619_10471087 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300018071|Ga0184618_10437761 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300018073|Ga0184624_10276698 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300018076|Ga0184609_10240043 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300018466|Ga0190268_12097271 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300018468|Ga0066662_10032111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3130 | Open in IMG/M |
3300018469|Ga0190270_13022950 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300021445|Ga0182009_10104401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1297 | Open in IMG/M |
3300025915|Ga0207693_10283851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1297 | Open in IMG/M |
3300025917|Ga0207660_10481679 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300025921|Ga0207652_10300629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1448 | Open in IMG/M |
3300025924|Ga0207694_11598584 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300025926|Ga0207659_10414253 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300025933|Ga0207706_11474656 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300025939|Ga0207665_10496291 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300026041|Ga0207639_11765460 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300026075|Ga0207708_11853678 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300026313|Ga0209761_1201053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 875 | Open in IMG/M |
3300026330|Ga0209473_1137001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1004 | Open in IMG/M |
3300027716|Ga0209682_10014559 | All Organisms → cellular organisms → Bacteria | 1913 | Open in IMG/M |
3300027909|Ga0209382_11893096 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300027986|Ga0209168_10524006 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300028717|Ga0307298_10193215 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300028722|Ga0307319_10097192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
3300028807|Ga0307305_10562426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 509 | Open in IMG/M |
3300028819|Ga0307296_10262484 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300028878|Ga0307278_10079023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1482 | Open in IMG/M |
3300028881|Ga0307277_10075541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1403 | Open in IMG/M |
3300028885|Ga0307304_10299393 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300030007|Ga0311338_11114172 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300031234|Ga0302325_11129759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1052 | Open in IMG/M |
3300031681|Ga0318572_10221860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1107 | Open in IMG/M |
3300031716|Ga0310813_10586453 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300031740|Ga0307468_101669292 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300031819|Ga0318568_10625656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 670 | Open in IMG/M |
3300031824|Ga0307413_11824545 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300031847|Ga0310907_10741263 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300031854|Ga0310904_11424463 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300032001|Ga0306922_11511802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 671 | Open in IMG/M |
3300032012|Ga0310902_10716015 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300032013|Ga0310906_10102417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1573 | Open in IMG/M |
3300032091|Ga0318577_10526134 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300032783|Ga0335079_10849932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 941 | Open in IMG/M |
3300033475|Ga0310811_11349563 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300033550|Ga0247829_11460760 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300033550|Ga0247829_11834066 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.42% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.65% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.77% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.88% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.88% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.88% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.92% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.92% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.92% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.92% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.92% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.96% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.96% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.96% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.96% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
NODE_03116142 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MDATAETTSVERMLSIAASPETVWGFLVDPDKATRWMGTACTF |
AF_2010_repII_A1DRAFT_101315323 | 3300000597 | Forest Soil | MASATETTTVVREIAIDASPETVWQFLVDPQKATRWMGMA |
JGI10216J12902_1027771821 | 3300000956 | Soil | MQKTAETTAIERELAIDASPETVWEFLVDPEKATRWMGMNA |
Ga0062385_109254832 | 3300004080 | Bog Forest Soil | MEQTTEKTTVEREIAIDASPETVWGFLTEPEKVLRWWGQSISF |
Ga0063454_1002618831 | 3300004081 | Soil | MSTTEQVVFQREVEIAASPETVWQFLVEPEKLARWKGRLA |
Ga0062593_1024006882 | 3300004114 | Soil | METTTETAVERELAIDASPETVWEFLVDPEKLATWFGSRAWLDPR |
Ga0062594_1005604901 | 3300005093 | Soil | MASVTETAVVRELTIAARPETVWEFLVDPEKATRWMGIEATL |
Ga0066388_1023634173 | 3300005332 | Tropical Forest Soil | MESTAETTVVHREIAIAARPETVWGFLVDSEKATRWMGTTATFDA |
Ga0070674_1016922012 | 3300005356 | Miscanthus Rhizosphere | MEKTAEKTSLEREVAIAASPETVWEFLVDPEKSTRWMGMNCMFE |
Ga0070707_1000189341 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MESATETTSVVREIAIAASPETVWQFLVGPERATRWMGQAATFDP |
Ga0070735_104919661 | 3300005534 | Surface Soil | VDATTESTTIERELAIAARPETVWELLTDPIEATRWMGQSAAFDL |
Ga0070696_1004874913 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VETTTETTVERELAIEASPETVWEFLVDPEKLASWFGSQAW |
Ga0066698_105931501 | 3300005558 | Soil | VESATETNVVERELIIEASPETVWEFLVDSEKATAWM |
Ga0066670_100862541 | 3300005560 | Soil | MDATTEMTTIERELTIAASPETVWQFLVDPDKATRWMGQRATFEA |
Ga0066693_104741862 | 3300005566 | Soil | MAKTAEQVVIERDVAIAASPETVWGFLVDPEKQQRWMGQD |
Ga0066705_101313794 | 3300005569 | Soil | MDATTETTSVEREVAIAASPETVWAFLVEPDKATR |
Ga0066708_110159862 | 3300005576 | Soil | MDATTETTSVEREVAIAASPQTVWAFLVEPDKATRWMGQTA |
Ga0068859_1004863964 | 3300005617 | Switchgrass Rhizosphere | METTAETTRVEREVAIAASPETVWEFLVDPEKAVRW |
Ga0066652_1012484691 | 3300006046 | Soil | VESTTEQIAVTRELVIDASPETVWEFLVDPEKIVRWK |
Ga0070716_1009560221 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | METTTETAVEREVEIDASPETVWQFLIEADKLDRWFGNQAWLDP |
Ga0074055_100136353 | 3300006573 | Soil | MDATTETMSVERTLSIEASPEAVWEFLVDPDKATRWMGQTCTF |
Ga0074049_131435411 | 3300006580 | Soil | MDATTETMSVERTLSIEASPEAVWEFLVDPDKATRWMGQTCTFEA |
Ga0066653_102692201 | 3300006791 | Soil | MANATETTSVVREIAIDASPETVWQFLVDPEKATRWMGQRATLDP |
Ga0075421_1014697931 | 3300006845 | Populus Rhizosphere | MDATRDTTAVERELAIDASPEAVWEFLVDPEKATRWMGQKATFEP |
Ga0075431_1012826413 | 3300006847 | Populus Rhizosphere | METTAETILVERELMIAARPETVWEFLVDADKLARWMCTAASL |
Ga0075431_1014152271 | 3300006847 | Populus Rhizosphere | VDAVTDTTTVVERELEIDASPETVWEFLVDPEKATRWM |
Ga0075425_1029391931 | 3300006854 | Populus Rhizosphere | METMTESTVEREVAIAAPPETVWRFLVEPELAARWMGE |
Ga0075425_1031322101 | 3300006854 | Populus Rhizosphere | MEASTETAVRREIAIAASPETVWEFLVQPEKATRWMGK |
Ga0075434_1020045761 | 3300006871 | Populus Rhizosphere | MESATETTIYERELTIAASPETVWQFFVDPEKATRWM |
Ga0075435_1007199331 | 3300007076 | Populus Rhizosphere | MDATAETTSVERTLSIAASPETVWGFLVDPDKATRWMGTACTFD |
Ga0075435_1008392921 | 3300007076 | Populus Rhizosphere | METTTETTRVEREVAIAASPETVWEFLVDPDKATRW |
Ga0099827_108737673 | 3300009090 | Vadose Zone Soil | MATNATETVAIERELVIAASPETVWEFLVDPAKAG |
Ga0066709_1039638522 | 3300009137 | Grasslands Soil | VEKTADTTSVEREVTIAASRETIWEFLVDPDKATRCVRM |
Ga0114129_132625992 | 3300009147 | Populus Rhizosphere | MNPLAESRSIEREILIAARPETVWELLADPREAVRWMGQSATFD |
Ga0126314_112197031 | 3300010042 | Serpentine Soil | MAKTAEQVVIERDVAIAASPETVWDFLVEPEKQQRWMGQDVT |
Ga0126311_114305841 | 3300010045 | Serpentine Soil | VETTTETTVERELAIDASPETVWEFLVDPEKLSRW |
Ga0126306_109650091 | 3300010166 | Serpentine Soil | MEASTETAVRREIQIAARPETVWEFLVQPEKATRWM |
Ga0126377_127787912 | 3300010362 | Tropical Forest Soil | MDATRESTTVERELTIDAGPEAVWAFLVDPEKATRLMGEKAIFE |
Ga0126347_14033692 | 3300010867 | Boreal Forest Soil | METTAEQTSLVREVEIAASPETVWQHLVDSDKALRWWGQHM |
Ga0120174_11222911 | 3300012008 | Permafrost | MESTTEKVSLEREVQIAASPETVWEFLVDEEKVARWMGE |
Ga0136620_101565244 | 3300012186 | Polar Desert Sand | MHATTESISVERELTIAASPETVWELLVDPEQAIRWMGQTA |
Ga0136620_101605383 | 3300012186 | Polar Desert Sand | VHATTESISVERELTIAASPETVWELLVDPEQAIRWMGQTA |
Ga0137382_101991314 | 3300012200 | Vadose Zone Soil | MASSTETAVERTIAIDASPETVWQFLVDPEKTTAWWGM |
Ga0137365_110360603 | 3300012201 | Vadose Zone Soil | VETTTETTVERELAIDASPETVWEFLVDPEKLSRWFGSRAW |
Ga0137366_112319311 | 3300012354 | Vadose Zone Soil | MEATTETISVEREIAIAASPETVWQFLVEPEKAIRWMGQTASL |
Ga0137361_112254283 | 3300012362 | Vadose Zone Soil | VETTTETTVERELAIDANPEIVWEFLVDPEKLSRWFGG |
Ga0157288_101894983 | 3300012901 | Soil | VETTTETTVERELAIDASPETVWEFLIDPEKLASWFG |
Ga0157286_102763041 | 3300012908 | Soil | METTTETAVERELAIDASPETVWEFLVDPEKLATWFGSRAWLDP |
Ga0137407_103648293 | 3300012930 | Vadose Zone Soil | METTTETAVERELAIDASPETVWEFLVDPDKLASWFGSR |
Ga0137407_114062471 | 3300012930 | Vadose Zone Soil | METTTDTTAIERELAIAASPETVWDFLVAPEKAVRWMGE |
Ga0164301_108710003 | 3300012960 | Soil | MASSTDTAVERTIAIDASPETVWQFLVDPEKTTAWWGMTASFDPRP |
Ga0134087_102771691 | 3300012977 | Grasslands Soil | MANATETTSVVREIAIDASPDTVWQFLVDPEKATRWMGQRATLDP |
Ga0134087_103613843 | 3300012977 | Grasslands Soil | MAKTAEQVVIERDVAIAASPETVWGFLVDPEKQKRWMGQDVTADVRP |
Ga0134089_105561412 | 3300015358 | Grasslands Soil | METTTDVAVEREVAIAASPETVWQFLVDPEKATT* |
Ga0132258_130740993 | 3300015371 | Arabidopsis Rhizosphere | MEQTTEQVTIERELEIAASPGTVWGFLVDPEKAVRWMGI |
Ga0132255_1058249301 | 3300015374 | Arabidopsis Rhizosphere | METTATTEAPVYERELQIDASPETVWEFLVDPEKVARWK |
Ga0163161_107027733 | 3300017792 | Switchgrass Rhizosphere | MEASTETAVRREIAIAARPETVWEFLVQPEKATRWMGK |
Ga0190266_113284372 | 3300017965 | Soil | MGSVTETNAMVRELEIAASPETVWGFLVDPARAERWMGQSGTFDARRRLVHDL |
Ga0184619_104710871 | 3300018061 | Groundwater Sediment | MEASTETAVRREIAIAASPETIWEFLVDPEKATRWMGRSASFD |
Ga0184618_104377612 | 3300018071 | Groundwater Sediment | MASSTETAVERTIAIDASPETVWQFLVDPEKTTAWWGMTASF |
Ga0184624_102766983 | 3300018073 | Groundwater Sediment | MEKTAEKTKASLEREVAIAASPETVWEFLVDPQKATLWMGQ |
Ga0184609_102400433 | 3300018076 | Groundwater Sediment | MEATGETTAVERELAIAASPETVWEFLVDPDKATRWMG |
Ga0190268_120972711 | 3300018466 | Soil | MASVTEETAVVRELSIAARPETVWEFLVDPDKVTRW |
Ga0066662_100321111 | 3300018468 | Grasslands Soil | MESAIETTSVVREIAIAASPETVWQFLVDPERATLWMG |
Ga0190270_130229503 | 3300018469 | Soil | MQTTADTVSIEREVSIAARPETVWEFLVDPEKAARWMG |
Ga0182009_101044011 | 3300021445 | Soil | METTTETMVEREVEIAAAPETVWQFLVDPEKVARWFGSR |
Ga0207693_102838511 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MASTIERLEVVRELTIDARPDTVWEFLVDPLKAALWMGQK |
Ga0207660_104816794 | 3300025917 | Corn Rhizosphere | VTSATDVTVVERELLIDASPETVWELLVDPAKATS |
Ga0207652_103006293 | 3300025921 | Corn Rhizosphere | VDATTESSTSVVREIEIAASPETVWEMLTDENEATRWMGQ |
Ga0207694_115985843 | 3300025924 | Corn Rhizosphere | VDATTESSTSVVREFEIAASPETVWELLTDENEAT |
Ga0207659_104142533 | 3300025926 | Miscanthus Rhizosphere | MARTAEQVVIEREVDIAASPETVWGFLVDPEKQKR |
Ga0207706_114746561 | 3300025933 | Corn Rhizosphere | MEKTAEKTSLEREVAIAASPETVWEFLVDPDKSTRWMGMNCLFE |
Ga0207665_104962911 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VDATTESIRVERELQIAASPQTIWELLTDEREATRWMGQLAQ |
Ga0207639_117654602 | 3300026041 | Corn Rhizosphere | METTTETAVEREVEIDASPETVWQFLIEADKLDRWFGNQAWLDPRVAR |
Ga0207708_118536781 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MERTIEQISLEREITIAASPQTVWEFLVDPDKAIRWM |
Ga0209761_12010533 | 3300026313 | Grasslands Soil | MEATTETTSVERELAIAASPETVWELLVDPDKATRWMGQAAS |
Ga0209473_11370011 | 3300026330 | Soil | MEATTETTSVEREIAIAASPETVWQFLVDPEKAIRWM |
Ga0209682_100145593 | 3300027716 | Wetland Sediment | MGSVTEATSVVRELTIAARPETVWEFLVDPGKAERWM |
Ga0209382_118930963 | 3300027909 | Populus Rhizosphere | MDATRDTTAVERELAIDASPEAVWEFLVDPQKATRW |
Ga0209168_105240061 | 3300027986 | Surface Soil | VDATTESTTIERELAIAARPETVWELLTDPIEATRWMGQSAAFDLR |
Ga0307298_101932151 | 3300028717 | Soil | MAKTAEQVVIERDVAIAASPETVWGFLVDPEKQKRWMGQ |
Ga0307319_100971923 | 3300028722 | Soil | MEASTETAVTREVAIAASPETVWEFLVDPEKATRWM |
Ga0307305_105624261 | 3300028807 | Soil | VANATETVAVERALVIAASPETVWELLVDPEKAGLWMG |
Ga0307296_102624841 | 3300028819 | Soil | MEATGETTAVERELAIAASPEAVWEFLVDPDKATRWMGQSA |
Ga0307278_100790231 | 3300028878 | Soil | MEASTETAVRREIEIAARPETVWEFFVDPEKATRWM |
Ga0307277_100755411 | 3300028881 | Soil | METTAETTRVEREVAIAASPETVWEFLVDPEKAVRWMGIE |
Ga0307304_102993933 | 3300028885 | Soil | MASSTETAVERTISIDASPETVWQFLVDPEKTTAWW |
Ga0311338_111141721 | 3300030007 | Palsa | MESTAEQLSVRREIEIAASPETVWQFLVDPAKAIIWWGT |
Ga0302325_111297593 | 3300031234 | Palsa | MESTTEQVSVEREIEIAAAPEIVWQFLVDPGRAVTW |
Ga0318572_102218601 | 3300031681 | Soil | MDATTETTAIVREVSIAASPETVWDLLVDPDKVTRWMGEQ |
Ga0310813_105864533 | 3300031716 | Soil | VETTTETTVERELAIDASPETVWEFLVDPEKLASWFGSQAWL |
Ga0307468_1016692921 | 3300031740 | Hardwood Forest Soil | MASVTEETAVVRELSIAARPETVWEFLVDPDKVTRWMGI |
Ga0318568_106256561 | 3300031819 | Soil | MQKTAEQIVVERELVIAASPETIWELLVDPEKQERWMGQDVTCDLR |
Ga0307413_118245452 | 3300031824 | Rhizosphere | MEASTETAVRREIAIAARPETVWEFLVQPEKATRWM |
Ga0310907_107412632 | 3300031847 | Soil | MGSVTEQTAVVRELTIAAQPETVWEFLVDPEKATRWMGIDATLEP |
Ga0310904_114244632 | 3300031854 | Soil | MGSVTEQTAVVRELTIAARPETVWEFLVDPEKATRWMGIDA |
Ga0306922_115118021 | 3300032001 | Soil | MDATTETTAIVREVSIAASPETVWDLLVDPDKVTRWMGE |
Ga0310902_107160153 | 3300032012 | Soil | MASVTETAVVRELTIAARPETVWEFLVDPEKATRWMGIEAT |
Ga0310906_101024171 | 3300032013 | Soil | MGSVTETAVVRELTIAARPETVWEFLVDPEKATRWMGIEASL |
Ga0318577_105261341 | 3300032091 | Soil | VDATTETFVVERELEIAAAPEQVWELLTDPDHVTRW |
Ga0335079_108499321 | 3300032783 | Soil | VASAVDTTTVTREIQIDASPETVWEFLVDPEKLTR |
Ga0310811_113495632 | 3300033475 | Soil | VETTTETTVERELAIDASPETVWEFLVDPEKLASWFG |
Ga0247829_114607601 | 3300033550 | Soil | MGSVTETAVVRELTIAARPETVWEFLVDPEKATRWMGIEA |
Ga0247829_118340661 | 3300033550 | Soil | MGSVTETAVVRELTIAARPETVWEFLVDPEKATRWM |
⦗Top⦘ |