| Basic Information | |
|---|---|
| Family ID | F097882 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 44 residues |
| Representative Sequence | PDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADLPATGRAA |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.73 % |
| % of genes near scaffold ends (potentially truncated) | 92.31 % |
| % of genes from short scaffolds (< 2000 bps) | 94.23 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.115 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.192 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.885 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.269 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.30% β-sheet: 0.00% Coil/Unstructured: 50.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF12728 | HTH_17 | 54.81 |
| PF14657 | Arm-DNA-bind_4 | 20.19 |
| PF14659 | Phage_int_SAM_3 | 15.38 |
| PF05016 | ParE_toxin | 1.92 |
| PF02589 | LUD_dom | 0.96 |
| PF00589 | Phage_integrase | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.04 % |
| Unclassified | root | N/A | 0.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004152|Ga0062386_100909455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 727 | Open in IMG/M |
| 3300004635|Ga0062388_101266880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 733 | Open in IMG/M |
| 3300005435|Ga0070714_100240873 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300005436|Ga0070713_101643152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 624 | Open in IMG/M |
| 3300005439|Ga0070711_101176627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 662 | Open in IMG/M |
| 3300005471|Ga0070698_100638572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1006 | Open in IMG/M |
| 3300005548|Ga0070665_101274963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 745 | Open in IMG/M |
| 3300005577|Ga0068857_100551340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1086 | Open in IMG/M |
| 3300006028|Ga0070717_11306023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 659 | Open in IMG/M |
| 3300006028|Ga0070717_11491588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 613 | Open in IMG/M |
| 3300006046|Ga0066652_102065244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 506 | Open in IMG/M |
| 3300006102|Ga0075015_100885433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
| 3300006162|Ga0075030_101413004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
| 3300006173|Ga0070716_101270124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 594 | Open in IMG/M |
| 3300006175|Ga0070712_100336329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1232 | Open in IMG/M |
| 3300006755|Ga0079222_10476820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 903 | Open in IMG/M |
| 3300007265|Ga0099794_10344198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 775 | Open in IMG/M |
| 3300009029|Ga0066793_10487084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora | 705 | Open in IMG/M |
| 3300009088|Ga0099830_10073539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2486 | Open in IMG/M |
| 3300009098|Ga0105245_10361057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea pusilla | 1442 | Open in IMG/M |
| 3300009177|Ga0105248_10263094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1942 | Open in IMG/M |
| 3300009520|Ga0116214_1348493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 573 | Open in IMG/M |
| 3300009521|Ga0116222_1224999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 809 | Open in IMG/M |
| 3300009522|Ga0116218_1470036 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300009683|Ga0116224_10346051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 707 | Open in IMG/M |
| 3300009839|Ga0116223_10110430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → unclassified Dactylosporangium → Dactylosporangium sp. | 1733 | Open in IMG/M |
| 3300010359|Ga0126376_12619184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 553 | Open in IMG/M |
| 3300010373|Ga0134128_10829578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora pinistramenti | 1024 | Open in IMG/M |
| 3300010373|Ga0134128_11541673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora pinistramenti | 731 | Open in IMG/M |
| 3300010379|Ga0136449_101636045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 975 | Open in IMG/M |
| 3300010379|Ga0136449_102937928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 668 | Open in IMG/M |
| 3300011269|Ga0137392_10009175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6467 | Open in IMG/M |
| 3300012096|Ga0137389_10076722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2600 | Open in IMG/M |
| 3300012189|Ga0137388_11237213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
| 3300012198|Ga0137364_10115785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1905 | Open in IMG/M |
| 3300012200|Ga0137382_10500618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 863 | Open in IMG/M |
| 3300012201|Ga0137365_10109139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2081 | Open in IMG/M |
| 3300012207|Ga0137381_10257314 | All Organisms → Viruses → Predicted Viral | 1518 | Open in IMG/M |
| 3300012207|Ga0137381_11468040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
| 3300012208|Ga0137376_11348322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 604 | Open in IMG/M |
| 3300012209|Ga0137379_10832129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 828 | Open in IMG/M |
| 3300012209|Ga0137379_11139700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 686 | Open in IMG/M |
| 3300012350|Ga0137372_10247013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1405 | Open in IMG/M |
| 3300012350|Ga0137372_10295947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1256 | Open in IMG/M |
| 3300012350|Ga0137372_10815748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
| 3300012351|Ga0137386_10418767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 965 | Open in IMG/M |
| 3300012351|Ga0137386_10908936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
| 3300012351|Ga0137386_11021503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 587 | Open in IMG/M |
| 3300012499|Ga0157350_1051329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
| 3300012683|Ga0137398_10893126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
| 3300012917|Ga0137395_10562376 | Not Available | 823 | Open in IMG/M |
| 3300014156|Ga0181518_10507059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300014501|Ga0182024_12219248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300016371|Ga0182034_10704462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 859 | Open in IMG/M |
| 3300016422|Ga0182039_12038867 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300016422|Ga0182039_12087101 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300017821|Ga0187812_1210832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300017924|Ga0187820_1257326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 562 | Open in IMG/M |
| 3300017928|Ga0187806_1113302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 874 | Open in IMG/M |
| 3300017932|Ga0187814_10078968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1209 | Open in IMG/M |
| 3300017932|Ga0187814_10422898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300017942|Ga0187808_10314706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora pinistramenti | 707 | Open in IMG/M |
| 3300017942|Ga0187808_10561308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
| 3300017955|Ga0187817_10245323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1141 | Open in IMG/M |
| 3300017959|Ga0187779_10326531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 987 | Open in IMG/M |
| 3300017959|Ga0187779_11338436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
| 3300018085|Ga0187772_10385377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 973 | Open in IMG/M |
| 3300018086|Ga0187769_10737421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 745 | Open in IMG/M |
| 3300018090|Ga0187770_11617748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 528 | Open in IMG/M |
| 3300018468|Ga0066662_11069628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 804 | Open in IMG/M |
| 3300020580|Ga0210403_11215989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea solani | 580 | Open in IMG/M |
| 3300021088|Ga0210404_10314469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
| 3300021401|Ga0210393_10621789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 882 | Open in IMG/M |
| 3300021407|Ga0210383_11336203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 598 | Open in IMG/M |
| 3300025928|Ga0207700_11954920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 513 | Open in IMG/M |
| 3300026142|Ga0207698_11291936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora pinistramenti | 744 | Open in IMG/M |
| 3300026294|Ga0209839_10101884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 980 | Open in IMG/M |
| 3300027432|Ga0209421_1080505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 660 | Open in IMG/M |
| 3300027570|Ga0208043_1178746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → unclassified Dactylosporangium → Dactylosporangium sp. | 543 | Open in IMG/M |
| 3300027570|Ga0208043_1197895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300027662|Ga0208565_1157684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 659 | Open in IMG/M |
| 3300027884|Ga0209275_10935249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 500 | Open in IMG/M |
| 3300027895|Ga0209624_10329613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1017 | Open in IMG/M |
| 3300027895|Ga0209624_10616318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 719 | Open in IMG/M |
| 3300027905|Ga0209415_10310148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1351 | Open in IMG/M |
| 3300027905|Ga0209415_10581683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 836 | Open in IMG/M |
| 3300027905|Ga0209415_10831344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 638 | Open in IMG/M |
| 3300027905|Ga0209415_10951437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
| 3300030013|Ga0302178_10269331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
| 3300030707|Ga0310038_10225523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 880 | Open in IMG/M |
| 3300031546|Ga0318538_10278983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora pinistramenti | 899 | Open in IMG/M |
| 3300031708|Ga0310686_116953777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
| 3300031781|Ga0318547_10744366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
| 3300031805|Ga0318497_10305364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 887 | Open in IMG/M |
| 3300031819|Ga0318568_10291920 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
| 3300032010|Ga0318569_10087432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1396 | Open in IMG/M |
| 3300032055|Ga0318575_10582835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300032076|Ga0306924_12641106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300032160|Ga0311301_11243979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium | 948 | Open in IMG/M |
| 3300032174|Ga0307470_10028119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2639 | Open in IMG/M |
| 3300032954|Ga0335083_10351121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1277 | Open in IMG/M |
| 3300033134|Ga0335073_11088232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 816 | Open in IMG/M |
| 3300033134|Ga0335073_11831535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 565 | Open in IMG/M |
| 3300034124|Ga0370483_0002492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4993 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.19% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 15.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.62% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.92% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.92% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.96% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.96% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.96% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.96% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062386_1009094553 | 3300004152 | Bog Forest Soil | DHMPNGQRLLHVVADRITWKQALDEARRRADGHSPPDLPATGRAA* |
| Ga0062388_1012668801 | 3300004635 | Bog Forest Soil | WEPVKPGDPDHMPPGQRLLHVVADRIQWQTALKQARRAAEADRPATRRAA* |
| Ga0070714_1002408731 | 3300005435 | Agricultural Soil | GDPDHMPNGQRLLHVVADRIQWQTALELARRKAAMPPDSDHPVAGRAT* |
| Ga0070713_1016431521 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PGDPDHMPNGQRLLHVVADRIQWQTALELARRRAAESDLSATGRAA* |
| Ga0070711_1011766273 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | DHMPNGQRLLHVVADRIQWQTALDLARRRAAEADPSATGRAA* |
| Ga0070698_1006385721 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | PGDPDHMPNGQRLLHVVADRIQWQNALDLARRRAAEADLPATGRAA* |
| Ga0070665_1012749631 | 3300005548 | Switchgrass Rhizosphere | GDPDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADPSATGRAA* |
| Ga0068857_1005513403 | 3300005577 | Corn Rhizosphere | RLLHVVADRIQWQTALELARRRAAETDLPATERAA* |
| Ga0070717_113060231 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QRLLHVVADRIQWQTALELARRRAAEADLSATGSAA* |
| Ga0070717_114915881 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PGDDDHMPNGQRLLHVVADRQRWHTALAEARRRAAMPPDGDHPVTGRAA* |
| Ga0066652_1020652441 | 3300006046 | Soil | LLHVVADRIQWQTALDLARRRAGEADLPATGQAA* |
| Ga0075015_1008854333 | 3300006102 | Watersheds | PDHMPNGQRLLHVVADRIQWQTALEQARRRAATADLPATGRAA* |
| Ga0075030_1014130041 | 3300006162 | Watersheds | VKPGDPDHMPNGQRLLHVVADRIQWQTALELARRRAEGGDDRVSATGRAA* |
| Ga0070716_1012701241 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ARYTWEPVKPGDHDHMPNGQRLLHVVADRIQWQAALAEARQRAAMPPNDDRSAVGRAA* |
| Ga0070712_1003363291 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNGQRLLHVVADRIQWQTALELARRRAAEADLPATGQAA* |
| Ga0079222_104768201 | 3300006755 | Agricultural Soil | PGDHDHMPNGQRLLHVVADRIQWQTALELARRRAAEAELPANGMAA* |
| Ga0099794_103441982 | 3300007265 | Vadose Zone Soil | MPNGQRLLHVVADRIQWQTALDLARRRAAEVDLPAIGRAA* |
| Ga0066793_104870841 | 3300009029 | Prmafrost Soil | TWEPVSPGDFDHMPPARRLLHVVADRITWKQALDEARRKAAGLGPPDLPATGRAA* |
| Ga0099830_100735391 | 3300009088 | Vadose Zone Soil | LLHVVADRITWEQTLDEARRRAAGPSPPDLPATGRAA* |
| Ga0105245_103610573 | 3300009098 | Miscanthus Rhizosphere | QRLLHVVADRIQWQTALELARRRAAETDLPATERAA* |
| Ga0105248_102630941 | 3300009177 | Switchgrass Rhizosphere | PDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADLPATGSAA* |
| Ga0116214_13484931 | 3300009520 | Peatlands Soil | TPVKPGDPDHMPPAQRLLHVVADRQRWHTALTEARRRATEPAILSATGTAA* |
| Ga0116222_12249991 | 3300009521 | Peatlands Soil | PNGQRLLHVVADRIQWQTALEQARRRAAEADLSATGQAA* |
| Ga0116218_14700361 | 3300009522 | Peatlands Soil | DPDHMPNGQRLLHVVADRIQWQTALEQARRRAAEADLPATGRAA* |
| Ga0116224_103460512 | 3300009683 | Peatlands Soil | GQRLLHVVADRIQWQTALEQARRRAAMPTTPELSATGTAA* |
| Ga0116223_101104301 | 3300009839 | Peatlands Soil | MPNGQRLLHVVADRIQWQTALEQARRRAAEADLSATGQAA* |
| Ga0126376_126191843 | 3300010359 | Tropical Forest Soil | LHVVADRITWQQALDEARRRAAGNDPPDLSATESAA* |
| Ga0134128_108295783 | 3300010373 | Terrestrial Soil | GDPDHMPNGQRLLHVVADRIQWQTALELARRRAAEADLSATGRAA* |
| Ga0134128_115416733 | 3300010373 | Terrestrial Soil | DPDHMPNGQRLLHVVADRIQWQTALELARRRAAEADLSATGRAA* |
| Ga0136449_1016360451 | 3300010379 | Peatlands Soil | NGQRLLHVVADRIQWQTALEQARRRAADADLPATSRAA* |
| Ga0136449_1029379281 | 3300010379 | Peatlands Soil | PSDEDHMPTAQRLLHVVADRVRWQQALEQARRRAQGLPPGELSATGAAA* |
| Ga0137392_1000917510 | 3300011269 | Vadose Zone Soil | MPNGQRLLHVVADRIQWQTALEQARRRAAEAGLPATGRAA* |
| Ga0137389_100767223 | 3300012096 | Vadose Zone Soil | MRAVVRPREPVKPGDPDHMPNGQRLLHVVADRIQWQTALEQARRRAAEAGLPATGRAA* |
| Ga0137388_112372133 | 3300012189 | Vadose Zone Soil | LLHVVADRIQWQTALEQARRRAAMSIAPELSETGTAA* |
| Ga0137364_101157854 | 3300012198 | Vadose Zone Soil | PNGQRLLHVVADRIQWQTALDLARRRAGEADLPATGQAA* |
| Ga0137382_105006181 | 3300012200 | Vadose Zone Soil | NGQRLLHVVADRIQWQTALDLARRRAAEADLSATGRAA* |
| Ga0137365_101091392 | 3300012201 | Vadose Zone Soil | MPNGQRLLHVVADRIQWQTALELARRRAAEADPSATGRAA* |
| Ga0137381_102573141 | 3300012207 | Vadose Zone Soil | GDPDHMPNGQRLLHVVADRIQWQTALDLARRREAEADLPATGSAA* |
| Ga0137381_114680402 | 3300012207 | Vadose Zone Soil | GDPDHMPNGQRLLHVVADRIQWQTALDLARRREAEADLPATGRAA* |
| Ga0137376_113483223 | 3300012208 | Vadose Zone Soil | ESVKPGDPDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADLPATGSAA* |
| Ga0137379_108321293 | 3300012209 | Vadose Zone Soil | YTWEAVKPGDPDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADHPATGRAA* |
| Ga0137379_111397001 | 3300012209 | Vadose Zone Soil | PGDPDHMPNGQRLLHVVADRIQWQTALEQARRRAAEADLPATGSAA* |
| Ga0137372_102470131 | 3300012350 | Vadose Zone Soil | PDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADLPATGRAA* |
| Ga0137372_102959471 | 3300012350 | Vadose Zone Soil | NGQRLLHVVADRIQWQTALELARRRAAESDLSATGRAA* |
| Ga0137372_108157481 | 3300012350 | Vadose Zone Soil | RLLHVVADRIQWQTALELARRRAAEADLPATGQAA* |
| Ga0137386_104187671 | 3300012351 | Vadose Zone Soil | LLHVVADRIQWQTALELARRRAAEADLPATGQAA* |
| Ga0137386_109089361 | 3300012351 | Vadose Zone Soil | RLLHVVADRIQWQTALDLARRRTSEADLSATGRVA* |
| Ga0137386_110215031 | 3300012351 | Vadose Zone Soil | GDPDHMPNGQRLLHVVADRIRWQTALDQARRRAATPITPEISATGTAA* |
| Ga0157350_10513291 | 3300012499 | Unplanted Soil | LLHVVADRIQWQTALDLARRRAAEADLPATGRAA* |
| Ga0137398_108931261 | 3300012683 | Vadose Zone Soil | MPNGQRLLHVVADRIQWQTALDLARRRTNEADLSATGRVA* |
| Ga0137395_105623762 | 3300012917 | Vadose Zone Soil | MPNGQRLMHVVADRIQWQTALEQARRRAAEAGLSATSRAA* |
| Ga0181518_105070591 | 3300014156 | Bog | KPGDPDHMLNGQRLLHVVADRIQWQTALELARRRAAEADLSATGSAA* |
| Ga0182024_122192483 | 3300014501 | Permafrost | HVVADRIRWKQALDEARRRAEGLPPNDISATGRPT* |
| Ga0182034_107044623 | 3300016371 | Soil | YSSEPVEPGDRDFMPGAQRLLHVVADRMRWLQALDQARRRAQGLPDDLPATMEAA |
| Ga0182039_120388671 | 3300016422 | Soil | VRPSDPDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADPSATGRAA |
| Ga0182039_120871011 | 3300016422 | Soil | VRPSDPDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADLSATGRAA |
| Ga0187812_12108321 | 3300017821 | Freshwater Sediment | SDPDHMPTGQRLLHVVADRIQWHTALELARRRAAESDLPATGSAA |
| Ga0187820_12573261 | 3300017924 | Freshwater Sediment | RLLHVVADRIQWQTALDQARRRAAEAGPPPSGQAA |
| Ga0187806_11133023 | 3300017928 | Freshwater Sediment | PNGQRLLHIVADRLLWQTALAEARYRAAIALDADQSAAGRAA |
| Ga0187814_100789681 | 3300017932 | Freshwater Sediment | KPGDPDHMPNGQRLLHVVADRIQWQTALEQARRRAAEAGLPATGRAA |
| Ga0187814_104228982 | 3300017932 | Freshwater Sediment | MPTGQRLLHVVADRMNWLQALDQARRRAQGPPDDLSATGRAA |
| Ga0187808_103147063 | 3300017942 | Freshwater Sediment | EPVKPGDPDHMPNGQRLLHVVADRIQWQTALELARRRAAEADLSATGRAA |
| Ga0187808_105613081 | 3300017942 | Freshwater Sediment | VRPGDPDHMPTGQRLLHIGADRIQWQTALEQARRRAAEDELPASGRAA |
| Ga0187817_102453231 | 3300017955 | Freshwater Sediment | QRLLHVVADRIQWQTALEQARRRAAEAGPPANGQAG |
| Ga0187779_103265311 | 3300017959 | Tropical Peatland | RLLHVVADRIQWQTAIDQARRRAAEAGLSATGRAA |
| Ga0187779_113384361 | 3300017959 | Tropical Peatland | HMPNGQRLLHVVADRIRWQTALELARRRAAETDLPATGRAA |
| Ga0187772_103853771 | 3300018085 | Tropical Peatland | DHMPTARRLLHVAADRMRWLAALDQARRRATGGTDPDLSATGRAA |
| Ga0187769_107374211 | 3300018086 | Tropical Peatland | KPGDLDHMPNGQRLLHVVADRLRWQTALAEARHRAAIALDADQSAAGRAA |
| Ga0187770_116177481 | 3300018090 | Tropical Peatland | EAVKPGDPDHMPNGQRLLHVVADRIQWQTALEMARRRAAEADLSATGSAA |
| Ga0066662_110696283 | 3300018468 | Grasslands Soil | PNGQRLLHVVADRIQWQTALELARRRAAEADLPATERAA |
| Ga0210403_112159891 | 3300020580 | Soil | DPDHMPNGQRLLHVVADRIQWQTALELARRRAAEADLPATEQAA |
| Ga0210404_103144691 | 3300021088 | Soil | DPDHMPNGQRLLHVVADRIQWQTALDLARRRAAEANPSATGRAA |
| Ga0210393_106217893 | 3300021401 | Soil | VEPGDRDHMPTGQRLLHVVADRMHWLQALDQARRRAQGPPDDLSATGRAA |
| Ga0210383_113362031 | 3300021407 | Soil | YTWEPVTPSDHDHMPGPQRLLHVVADRIRWQQALDEARRRAQGQPPDDFPATGRAAA |
| Ga0207700_119549201 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PVKPGDPDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADPSATGRAA |
| Ga0207698_112919361 | 3300026142 | Corn Rhizosphere | PVKPGDPDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADLPATGSAA |
| Ga0209839_101018843 | 3300026294 | Soil | HMPPGQRLLHLVADRIQWQTALDQARRRAAGADLPATGRAA |
| Ga0209421_10805052 | 3300027432 | Forest Soil | MPGDPDYMPHARRLLHVVADRIAWKQALDEARRRAAGQPDPDLSATEREAA |
| Ga0208043_11787461 | 3300027570 | Peatlands Soil | PNGQRLLHVVADRIQWQTALEQARRRAAEADLSATGQAA |
| Ga0208043_11978951 | 3300027570 | Peatlands Soil | GDPDHMPTGQRLLHVVADRIQWQTALELARRRAAESELPATGRAA |
| Ga0208565_11576843 | 3300027662 | Peatlands Soil | MPNGQRLLHVVADRVQWQTALEQARRRAAEADLPATGRAA |
| Ga0209275_109352493 | 3300027884 | Soil | TWELVTPADQDHMPNGRRLLHVVADRMRWHTALDQARRRAAELSATGQAA |
| Ga0209624_103296133 | 3300027895 | Forest Soil | VNPGDHDHMPVARRLLHVVADRIRWQHALDQARRRAQGLPPDEISATGQAA |
| Ga0209624_106163181 | 3300027895 | Forest Soil | QDHMPTGQRLLHVVADRMQWLQALDQARRRAQGSPDDLSATGRAA |
| Ga0209415_103101483 | 3300027905 | Peatlands Soil | PDHMPNGQRLLHVVADRIQWQTALEQARRRAAETELPAKGRAA |
| Ga0209415_105816831 | 3300027905 | Peatlands Soil | PGDPDHMPTGQRLLHVVADRIQWQTALEQARRRAAEDGPPANGQAA |
| Ga0209415_108313443 | 3300027905 | Peatlands Soil | HMPTGQRLLHVVADRIQWQTALDQARRRAAEADLPANGRAA |
| Ga0209415_109514372 | 3300027905 | Peatlands Soil | LHVVADRIRWQTALEQARRRAAMPTTPELSATGTAA |
| Ga0302178_102693311 | 3300030013 | Palsa | DPDHMPTGQRLLHVVADRIQWQTALEMARRRAAMNDLSATGSAA |
| Ga0310038_102255233 | 3300030707 | Peatlands Soil | YMPNGQRLLHVVAERVQWQTALEQARRRAAEPDLPATGRAA |
| Ga0318538_102789833 | 3300031546 | Soil | YSWEPVEPGDRDFMPGAQRLLHVVADRMRWLQALDQARRRAEGLQSDDPSANGRAA |
| Ga0310686_1169537773 | 3300031708 | Soil | PGDQDHMPTARRLLHVVADRIRWQQALDQARRRAQGLPPQDLSATGAAA |
| Ga0318547_107443663 | 3300031781 | Soil | MPNGQRLLHVVADRIQWQTALDLARRRAAEADPSATGRAA |
| Ga0318497_103053641 | 3300031805 | Soil | RPSDPDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADPSATGRAA |
| Ga0318568_102919201 | 3300031819 | Soil | EPGDRDFMPGAQRLLHVVADRMRWLQALDQARRRAEGLQSDDPSANGRAA |
| Ga0318569_100874321 | 3300032010 | Soil | YMPTGQRLLHVVADRMRWLQALDQARRRAEGLRSDDLPATGRAA |
| Ga0318575_105828351 | 3300032055 | Soil | RLLHVVADRIQWQTALELARRRAAEADLSATGRAA |
| Ga0306924_126411061 | 3300032076 | Soil | LDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADLSATGRAA |
| Ga0311301_112439793 | 3300032160 | Peatlands Soil | GDPDHMPNGQRLLHVVADRIQWQTALEQARRRAGETDLPATGRAA |
| Ga0307470_100281196 | 3300032174 | Hardwood Forest Soil | WEPVKPGDDDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADLPATGRAA |
| Ga0335083_103511214 | 3300032954 | Soil | PGDPDHMPNGQRLLHVIADRIQWHTALEMARRRAAEADLPQPGRPHDEPT |
| Ga0335073_110882321 | 3300033134 | Soil | PNGQRLLHVVADRIQWQTALELARRRAAEADLPATGRAA |
| Ga0335073_118315351 | 3300033134 | Soil | TWELVAPGDQDHMPTGQRLLHVVADRMHWLQALDQARRRAQGLIDDLSATGEAA |
| Ga0370483_0002492_3_119 | 3300034124 | Untreated Peat Soil | PSQRLLHVVADRIQWQTALDQARRRAAGPDLPATGRAA |
| ⦗Top⦘ |