| Basic Information | |
|---|---|
| Family ID | F097859 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPFLLGVVVLILLLWAANAFSKADPKQAAKLLRYIGGGAAL |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.96 % |
| % of genes near scaffold ends (potentially truncated) | 96.15 % |
| % of genes from short scaffolds (< 2000 bps) | 94.23 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.154 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.385 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.962 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.654 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 53.62% β-sheet: 0.00% Coil/Unstructured: 46.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF09140 | MipZ | 9.62 |
| PF02569 | Pantoate_ligase | 1.92 |
| PF00781 | DAGK_cat | 0.96 |
| PF00291 | PALP | 0.96 |
| PF13458 | Peripla_BP_6 | 0.96 |
| PF13519 | VWA_2 | 0.96 |
| PF01435 | Peptidase_M48 | 0.96 |
| PF03466 | LysR_substrate | 0.96 |
| PF02673 | BacA | 0.96 |
| PF00226 | DnaJ | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG1192 | ParA-like ATPase involved in chromosome/plasmid partitioning or cellulose biosynthesis protein BcsQ | Cell cycle control, cell division, chromosome partitioning [D] | 9.62 |
| COG0414 | Panthothenate synthetase | Coenzyme transport and metabolism [H] | 1.92 |
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.92 |
| COG1968 | Undecaprenyl pyrophosphate phosphatase | Lipid transport and metabolism [I] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.15 % |
| Unclassified | root | N/A | 28.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig26800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1113 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101209711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 645 | Open in IMG/M |
| 3300004635|Ga0062388_100460311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1126 | Open in IMG/M |
| 3300005332|Ga0066388_104232223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 732 | Open in IMG/M |
| 3300005347|Ga0070668_102119524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300006174|Ga0075014_100105025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1322 | Open in IMG/M |
| 3300006175|Ga0070712_101968660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300006576|Ga0074047_12038640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 629 | Open in IMG/M |
| 3300009101|Ga0105247_11422794 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300009522|Ga0116218_1113418 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300009524|Ga0116225_1238955 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300009672|Ga0116215_1154774 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300009683|Ga0116224_10560909 | Not Available | 545 | Open in IMG/M |
| 3300010343|Ga0074044_10648257 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300010362|Ga0126377_12948044 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300010362|Ga0126377_13167279 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300010373|Ga0134128_10108425 | Not Available | 3154 | Open in IMG/M |
| 3300010376|Ga0126381_100375630 | All Organisms → cellular organisms → Bacteria | 1973 | Open in IMG/M |
| 3300010376|Ga0126381_102651228 | Not Available | 717 | Open in IMG/M |
| 3300010379|Ga0136449_103700965 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300010401|Ga0134121_12098584 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300014164|Ga0181532_10138342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1477 | Open in IMG/M |
| 3300014199|Ga0181535_10248755 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300014200|Ga0181526_10105286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1803 | Open in IMG/M |
| 3300014654|Ga0181525_10695487 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300014657|Ga0181522_11018425 | Not Available | 513 | Open in IMG/M |
| 3300015371|Ga0132258_11314870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1827 | Open in IMG/M |
| 3300016341|Ga0182035_10938450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 765 | Open in IMG/M |
| 3300016445|Ga0182038_10859456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 798 | Open in IMG/M |
| 3300017823|Ga0187818_10148952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenihabitantaceae → Lichenihabitans → Lichenihabitans psoromatis | 1018 | Open in IMG/M |
| 3300017933|Ga0187801_10096177 | Not Available | 1121 | Open in IMG/M |
| 3300017943|Ga0187819_10710611 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300017955|Ga0187817_10066261 | All Organisms → cellular organisms → Bacteria | 2242 | Open in IMG/M |
| 3300017970|Ga0187783_11225798 | Not Available | 540 | Open in IMG/M |
| 3300017972|Ga0187781_10359633 | Not Available | 1037 | Open in IMG/M |
| 3300017972|Ga0187781_10963763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 623 | Open in IMG/M |
| 3300017974|Ga0187777_11446155 | Not Available | 508 | Open in IMG/M |
| 3300017975|Ga0187782_11262057 | Not Available | 579 | Open in IMG/M |
| 3300018001|Ga0187815_10293582 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300018037|Ga0187883_10253074 | Not Available | 901 | Open in IMG/M |
| 3300018060|Ga0187765_10409148 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300018060|Ga0187765_11015501 | Not Available | 570 | Open in IMG/M |
| 3300018062|Ga0187784_10067729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2895 | Open in IMG/M |
| 3300018085|Ga0187772_10648648 | Not Available | 754 | Open in IMG/M |
| 3300018090|Ga0187770_11118573 | Not Available | 636 | Open in IMG/M |
| 3300020583|Ga0210401_11038464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 678 | Open in IMG/M |
| 3300020583|Ga0210401_11532116 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300021171|Ga0210405_10910192 | Not Available | 668 | Open in IMG/M |
| 3300021384|Ga0213876_10076162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1772 | Open in IMG/M |
| 3300021401|Ga0210393_10954367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 695 | Open in IMG/M |
| 3300021403|Ga0210397_10457624 | Not Available | 961 | Open in IMG/M |
| 3300021404|Ga0210389_10104189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2186 | Open in IMG/M |
| 3300021420|Ga0210394_11668246 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300021433|Ga0210391_10897360 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300023088|Ga0224555_1125425 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300023259|Ga0224551_1044863 | Not Available | 769 | Open in IMG/M |
| 3300024225|Ga0224572_1074823 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300025633|Ga0208480_1011962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2756 | Open in IMG/M |
| 3300025903|Ga0207680_10733125 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300025916|Ga0207663_11152175 | Not Available | 624 | Open in IMG/M |
| 3300025936|Ga0207670_10489605 | Not Available | 997 | Open in IMG/M |
| 3300027080|Ga0208237_1012842 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300027432|Ga0209421_1085076 | Not Available | 643 | Open in IMG/M |
| 3300027652|Ga0209007_1173631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 531 | Open in IMG/M |
| 3300027660|Ga0209736_1154250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 21-58-4 | 609 | Open in IMG/M |
| 3300027696|Ga0208696_1254741 | Not Available | 544 | Open in IMG/M |
| 3300027795|Ga0209139_10070080 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300027825|Ga0209039_10263381 | Not Available | 685 | Open in IMG/M |
| 3300027854|Ga0209517_10696105 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300027889|Ga0209380_10463540 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300028906|Ga0308309_11570540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 561 | Open in IMG/M |
| 3300030007|Ga0311338_11629157 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300030057|Ga0302176_10302231 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300030494|Ga0310037_10211797 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300030677|Ga0302317_10369672 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300031524|Ga0302320_11232028 | Not Available | 763 | Open in IMG/M |
| 3300031544|Ga0318534_10568854 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300031708|Ga0310686_111895305 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300031715|Ga0307476_11188141 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300031724|Ga0318500_10489386 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300031744|Ga0306918_11094072 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300031771|Ga0318546_11331827 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300031781|Ga0318547_10838987 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300031833|Ga0310917_10609991 | Not Available | 741 | Open in IMG/M |
| 3300031833|Ga0310917_10653641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 713 | Open in IMG/M |
| 3300031879|Ga0306919_10716174 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300031879|Ga0306919_11185070 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300031910|Ga0306923_11954749 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300031912|Ga0306921_11584009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 713 | Open in IMG/M |
| 3300031942|Ga0310916_10805873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 791 | Open in IMG/M |
| 3300031954|Ga0306926_12589455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 554 | Open in IMG/M |
| 3300031981|Ga0318531_10361516 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300032076|Ga0306924_10649153 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300032160|Ga0311301_13005869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 507 | Open in IMG/M |
| 3300032180|Ga0307471_102693315 | Not Available | 631 | Open in IMG/M |
| 3300032261|Ga0306920_101268011 | Not Available | 1062 | Open in IMG/M |
| 3300032770|Ga0335085_12432364 | Not Available | 521 | Open in IMG/M |
| 3300032783|Ga0335079_11115743 | Not Available | 798 | Open in IMG/M |
| 3300032828|Ga0335080_10087124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3464 | Open in IMG/M |
| 3300032828|Ga0335080_11151466 | Not Available | 782 | Open in IMG/M |
| 3300032892|Ga0335081_10630490 | Not Available | 1316 | Open in IMG/M |
| 3300032893|Ga0335069_10462213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1478 | Open in IMG/M |
| 3300033407|Ga0214472_11240558 | Not Available | 648 | Open in IMG/M |
| 3300034163|Ga0370515_0161425 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.62% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 9.62% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.88% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.92% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.96% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.96% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.96% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0800.00002030 | 2166559005 | Simulated | MPALVLGVIVLILLLFAAYSFSKADPKQAVRVLRYIGGGAVLLFAVFLLFAVQSCRRFRL |
| JGIcombinedJ26739_1012097111 | 3300002245 | Forest Soil | MPALLLGVVVLILLLWAVNAFSKADPKQAVRLLRYLGGGGALMLAA |
| Ga0062388_1004603112 | 3300004635 | Bog Forest Soil | MPFILGVAILILLLWAGNAFSKADPKQAARLLRTLGGGAA |
| Ga0066388_1042322232 | 3300005332 | Tropical Forest Soil | MPALALGVIVLILLLFAAYSFSKADPKQVARVLRYIGGAVALLFAIF |
| Ga0070668_1021195242 | 3300005347 | Switchgrass Rhizosphere | MPALVLGVIVLILLLFAAYSFSKADPKNVVRVLQYIGGGA |
| Ga0075014_1001050251 | 3300006174 | Watersheds | MPFLLGVVVLVLLLWAVKAFSKADPKQAARLIRSMG |
| Ga0070712_1019686602 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPALVLGVIVLILLLFAAHSFSKADPKQAVRVLRYIGGGA |
| Ga0074047_120386402 | 3300006576 | Soil | MPFLLGVVALVLLLWAVKAFSKADPKQAARLIRSM |
| Ga0105247_114227942 | 3300009101 | Switchgrass Rhizosphere | MPALILGVIVLSLLLFAAYSFSKADPKQVVRVVRYIGGGAALLFAVFLLVRGAIVPAV |
| Ga0116218_11134181 | 3300009522 | Peatlands Soil | MPALLLGVVVLILLLFAGYSFSKADPKQAVRVLRYIGGGAALLFAV |
| Ga0116225_12389551 | 3300009524 | Peatlands Soil | MPLLLGVAVLILLLWAVNAFSKADPKQAARLIRYLG |
| Ga0116215_11547742 | 3300009672 | Peatlands Soil | MPALLLGVVVLILLLFAGYSFSKADPKQAVRVLRYIGGGAALLFAVFLLVRGAIGP |
| Ga0116224_105609092 | 3300009683 | Peatlands Soil | MPEILLGVVVLVLGLWAVNAFSKADPKQAARVLRAIGGG |
| Ga0074044_106482571 | 3300010343 | Bog Forest Soil | MPIILGVAVLILLLWAASAFSKADPKQAARLLRAIGGVGALLFAVF |
| Ga0126377_129480442 | 3300010362 | Tropical Forest Soil | MPALVLGLVVLVLLFFAAKWFSKADPKQAARALRYVGGGAALLLAVFLLARG* |
| Ga0126377_131672792 | 3300010362 | Tropical Forest Soil | MPALVLGVIVLILLLFAAYSFSKADPKQLALVLRYIGGGAALLFAIFL |
| Ga0134128_101084251 | 3300010373 | Terrestrial Soil | MPFLLGVVVLLLLLWAMKAFAKADPKQAARLVRQIGGVAALLL |
| Ga0126381_1003756301 | 3300010376 | Tropical Forest Soil | MPALFLGLVILVLLFFAAKWFSKADPKQAARVLRYLGG |
| Ga0126381_1026512281 | 3300010376 | Tropical Forest Soil | MPEILLGLVVLLLLMWAASAFSKADPKQAARVVRAIGGGAAL |
| Ga0136449_1037009652 | 3300010379 | Peatlands Soil | MPALLLGVVGLVLLFFAVKWFSKADPKQAARVLRYVGGGAALLLAGFLL |
| Ga0134121_120985841 | 3300010401 | Terrestrial Soil | MPALVLGVIVLILLLFAAYSFSKADPKQAVRVLRYIGGGAA |
| Ga0181532_101383423 | 3300014164 | Bog | MPEILLGVVVLVLGLWAVNAFSKADPKQAARVLRAIGGGAA |
| Ga0181535_102487553 | 3300014199 | Bog | MPEILLGIVVLILGLWAVNAFSKADPKQAARLLRALGGGAA |
| Ga0181526_101052863 | 3300014200 | Bog | MPFIFGVAVLILLLRAVNAFSKADPKQAARLLRVI |
| Ga0181525_106954871 | 3300014654 | Bog | MPEIILGAAVLFLGLWAVNAFSKADPKQAARVLRGI |
| Ga0181522_110184251 | 3300014657 | Bog | MPEILLGAAVLVLGLWAMNAFSKADPKRAARVVRGVGGVALVIF |
| Ga0132258_113148701 | 3300015371 | Arabidopsis Rhizosphere | MPFLLGVVVLLLLLWAIKAFAKADPKQAARLVRQIGG |
| Ga0182035_109384501 | 3300016341 | Soil | MIALILGIFVLILLLFAAKSFSSADPKQVARVLRYIGGGVTLLFAVFLLVRGQI |
| Ga0182038_108594561 | 3300016445 | Soil | MVALILGVVVLILLLFATKSFSSADPKQVARALRYIAGGVTLLFAVFLLVRGQIGPAISVGLLGLGVLGY |
| Ga0187818_101489522 | 3300017823 | Freshwater Sediment | MPTLFLGLVVLVLLFLAAKWFSKADSKQSARVLRYVGG |
| Ga0187801_100961771 | 3300017933 | Freshwater Sediment | MPALVLGVIVLILLLFAAYSFSKADPKQAVRVLRYIGGPHHILD |
| Ga0187819_107106111 | 3300017943 | Freshwater Sediment | MPALVLGVTVLILLLFAAYSFSKADPKQAVRVLRYIGG |
| Ga0187817_100662611 | 3300017955 | Freshwater Sediment | MPTLFLGLVVLVLLFLAAKWFSKADSKQSARVLRYVG |
| Ga0187783_112257981 | 3300017970 | Tropical Peatland | MPLILGVVVLILLLWAASAFAKADPKQAARLLRLIGGGAALLFAAFLAF |
| Ga0187781_103596332 | 3300017972 | Tropical Peatland | MPEILLGLVVLLLLMWAASAFSKADPKQAARILRAIG |
| Ga0187781_109637631 | 3300017972 | Tropical Peatland | MPLLLGVVVLILLLWAVNAFSKADPRQAALLLRYVGGGAALL |
| Ga0187777_114461551 | 3300017974 | Tropical Peatland | MPEILLGLVVLLLLMWAANAFSKADPKQAARILRAIGGG |
| Ga0187782_112620571 | 3300017975 | Tropical Peatland | MPLVLGAAVLILLLWAVSAFSKADPKQAARLLRALGGVGALIF |
| Ga0187815_102935821 | 3300018001 | Freshwater Sediment | MPEILLGLVVLLLLMWAANAFAKADPKQAARILRAIGGAAALVLA |
| Ga0187883_102530741 | 3300018037 | Peatland | MPEILLGVVVLVLGLWAVNSFSRADPKQAARVLRAIGGAGALIFAG |
| Ga0187765_104091482 | 3300018060 | Tropical Peatland | MPAFALGIIVLILLLFAAYSFSKADPKQLARVLRYLGGGAALLF |
| Ga0187765_110155011 | 3300018060 | Tropical Peatland | MAFLLGVAVLILLVWAASSFSKSDPKQAARLVRGAGGVGAL |
| Ga0187784_100677294 | 3300018062 | Tropical Peatland | MPFLLGVAVLILLLWAVNAFSKADPKQAARLLRAMGGGAALLFA |
| Ga0187772_106486482 | 3300018085 | Tropical Peatland | MPEILLGVVVLLLLLWAVNSFSKADPKQAARVLRMIGGG |
| Ga0187770_111185731 | 3300018090 | Tropical Peatland | MPEILLGIVVLILGLWAVNAFSKADPKQAARLLRALGGGAALLLAPEPTTASK |
| Ga0210401_110384642 | 3300020583 | Soil | MPLLLGVAVLILLLWAVNAFSKADPKQAARLIRYLGGC |
| Ga0210401_115321162 | 3300020583 | Soil | MPLLLGVAVLILLLWAAKAFSKADPKQAARLIRYMGGCGA |
| Ga0210405_109101922 | 3300021171 | Soil | MPALFLGLVVLVLLFFAAKWFSKADPKQAARVLRYIG |
| Ga0213876_100761621 | 3300021384 | Plant Roots | MPFLLGVVVLLLLLWAINAFAKADPKQAARLIRSIGG |
| Ga0210393_109543671 | 3300021401 | Soil | MPFLLGVVILLLLLWLGHSFTKADPKQVAKLIRRMGGGGALIFAAFLLLRGEIAV |
| Ga0210397_104576242 | 3300021403 | Soil | MPALALGLIVLILLLFAAYSFSKADPKQAARVLRYIGGGAALLFAIFLLIRGAIMPAGA |
| Ga0210389_101041891 | 3300021404 | Soil | MPALALGLIVLILLLFAAYSFSKADPKQAARVLRYIGGGTALLFAIFLLIRG |
| Ga0210394_116682461 | 3300021420 | Soil | MPILLGAAVLILLLWAGSAFSKADPKQAARLVRYIGGGAALIASA |
| Ga0210391_108973602 | 3300021433 | Soil | MPEIILGVVVLFLVLWGVNAFSKIDPKQAARLVRALG |
| Ga0224555_11254252 | 3300023088 | Soil | MPFLLGVVVLILLLWAANAFSKADPKQAAKLLRYIGGGAAL |
| Ga0224551_10448632 | 3300023259 | Soil | MPEILLGVVVLLLALWAVNAFSKADPKQAARMLRAIGGGAALIFAV |
| Ga0224572_10748232 | 3300024225 | Rhizosphere | MLAFALGVIVLVLLLFAAYSFSKADPKQAVRVLRYIGGGAALLFAVFLLVD |
| Ga0208480_10119625 | 3300025633 | Arctic Peat Soil | MPILLGVVVLVLLLWAGKSFSKADPKQAAKLLRTLGGGAALLFATF |
| Ga0207680_107331251 | 3300025903 | Switchgrass Rhizosphere | MPFLLGVVVLLLLLWAIKAFAKADPKQAARLVRQIGGVAALLL |
| Ga0207663_111521752 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MALLLGVAVLVLLVWAAKSFAKSDPKQAAKLMRSLGGGAALLF |
| Ga0207670_104896052 | 3300025936 | Switchgrass Rhizosphere | MPFLLGVVVLLLLLWAIKAFAKADPKQAARLVRQIGGVAALLLGA |
| Ga0208237_10128423 | 3300027080 | Forest Soil | MPEILLGVVVLVLGLWAVNSFSKADPKQAARILRAIGGAAAL |
| Ga0209421_10850761 | 3300027432 | Forest Soil | MPEILLGVVVLVLGLWAVNSFSKADPKQAARILRAIGGAAALIFA |
| Ga0209007_11736312 | 3300027652 | Forest Soil | MPEIILGVVVLFLVLWGVNAFSKIDPKQAARLVRALGGVAAVLFAG |
| Ga0209736_11542503 | 3300027660 | Forest Soil | MPAFVLGVIVLVLLLFAAYSFSKADPKQAVRVLRYMGGGAALLFALFLLVR |
| Ga0208696_12547411 | 3300027696 | Peatlands Soil | MPEILLGVVVLVLGLWAVNAFSKADPKQAARVLRAIGGGG |
| Ga0209139_100700803 | 3300027795 | Bog Forest Soil | MPIILGVAVLILLLWAASAFSKADPKQAARLLRAIGGVGALLFA |
| Ga0209039_102633812 | 3300027825 | Bog Forest Soil | MPTLVLGVIVLILLLFAAYAFSKADPKQAARVLRYIGGGAALLLAL |
| Ga0209517_106961052 | 3300027854 | Peatlands Soil | MPLLLGVAVLILLLWAANSFSKADPKQAARLLHLL |
| Ga0209380_104635401 | 3300027889 | Soil | MPALALGLIVLILLLFAAYSFSKADPKQAARVSRYIGGGAALLFAIFLLIRGAIMP |
| Ga0308309_115705402 | 3300028906 | Soil | MPEILLGVAVLILALWAVNAFSKLDPKLAARVLRGLGGGAALLFAAFLLFR |
| Ga0311338_116291572 | 3300030007 | Palsa | MPEIILGVVVLFLVLWGGNAFSKIDPKQAARLVRALGGVAAV |
| Ga0302176_103022311 | 3300030057 | Palsa | MPILLGAAVLILLLWAGSAFSKADPKQAARLVRYIGGGA |
| Ga0310037_102117971 | 3300030494 | Peatlands Soil | MPFLLGVVVLVLLLWAVKAFSKADPKQAARLIRSMGGIA |
| Ga0302317_103696721 | 3300030677 | Palsa | MPILLGAAVLILLLWAGSAFSKADPKQAARFVRYIGGGAALIASAFLLLK |
| Ga0302320_112320282 | 3300031524 | Bog | MPEILLGIVVLVLGLWAVNAFSRADPKQAARLLRALGGGAALLFAAF |
| Ga0318534_105688542 | 3300031544 | Soil | MPLLLGVVVLILLLWAAQAFSKADPKQAARLLRALGGGGAL |
| Ga0310686_1118953052 | 3300031708 | Soil | MPILLGVVVLVLLLWAGKSFSKADPKQAAKLLRTLGGG |
| Ga0307476_111881412 | 3300031715 | Hardwood Forest Soil | MPALFLGLVVLVLLFFAAKWFSKADPMQAARVLRYLPP |
| Ga0318500_104893861 | 3300031724 | Soil | MPALFLGLVIFVLLFFAAKWFSKADPKQAARVLRYLGGGAALLLA |
| Ga0306918_110940722 | 3300031744 | Soil | MVALILGVVVLILLLFATKSFSSADPKQVARALRYIAGGVTLLFAVFL |
| Ga0318546_113318272 | 3300031771 | Soil | MPALFLGLVVLVLLFFAAKWFSKADPKQAARALRYVG |
| Ga0318547_108389872 | 3300031781 | Soil | MAAFALGVIVLVLLLLAAYSFSKADPKQVARVLRYVGGGAALLFAA |
| Ga0310917_106099913 | 3300031833 | Soil | MPALVLGVIVLILLLFAAYSFSKADPKQAARVLRYIG |
| Ga0310917_106536412 | 3300031833 | Soil | MVALILGIVVLILLLFAAKSFSSADPKQVARVLRYIGGGVTLLFGVFLL |
| Ga0306919_107161742 | 3300031879 | Soil | MVALILGIVVLILLLFAAKSFSSADPKQVARVLRYIGGGVTLLF |
| Ga0306919_111850701 | 3300031879 | Soil | MPALALGILVLILLLFAAYSFSKADPQQLARVLRYIGGGVTLLFAIFLLVRGAIVPALSIGLIGLGLLG |
| Ga0306923_119547492 | 3300031910 | Soil | MPALALGVIVLILLLFAVYSFSKADPKQVARVLRYIGG |
| Ga0306921_115840092 | 3300031912 | Soil | MVALILGILVLILLLFAAKSFSSADPKQVARVLRYIGGGVTLLFGVFL |
| Ga0310916_108058731 | 3300031942 | Soil | MVALILGIVILILLLFAAKSFSGADPKQVARVLRYIGGGVTLLFGVFLLVRGQIGPAISI |
| Ga0306926_125894552 | 3300031954 | Soil | MPFLLGVAVLILLLWAADAFSKVDPKLAAPQPRVIGGILALLFAVLLLARGE |
| Ga0318531_103615162 | 3300031981 | Soil | MPALFLGLVILVLLFFAAKWFSKADPKQAARALRY |
| Ga0306924_106491531 | 3300032076 | Soil | MPALFLGLVVLVLLFFAAKWFSKADPKQAARVLRYVGG |
| Ga0311301_130058692 | 3300032160 | Peatlands Soil | MPFLLGVVVLILLLWAVNAFSKSDPKQAARLLRFMGGGAALIFAVFLL |
| Ga0307471_1026933152 | 3300032180 | Hardwood Forest Soil | MPEIILGVAALVLVLWAVNAFSKADPKQAARLLRAMGGVAALIFA |
| Ga0306920_1012680111 | 3300032261 | Soil | MVALILGIVVLILLLFAAKSFSGADPKQVARVLRY |
| Ga0335085_124323642 | 3300032770 | Soil | MPLLLGVVVLILLLWAANSFSRADPKQAAKLLRSLGGGVAVLFAVF |
| Ga0335079_111157432 | 3300032783 | Soil | MPLLLGVVVLVLLLVAVGGFSKADPKQTARLVRLLGGA |
| Ga0335080_100871241 | 3300032828 | Soil | MAFLLGVAVLILLVWAASSFSKADPRQAARLVRGAGGVAALIFAGFLL |
| Ga0335080_111514662 | 3300032828 | Soil | MPEILLGVVVLILVLWAVNAFSKIDPKIAARVLRAVGG |
| Ga0335081_106304903 | 3300032892 | Soil | MLAFVLGVIVLILLLFAAYSFSKADAKQAARVLRYVGAGTAL |
| Ga0335069_104622133 | 3300032893 | Soil | MPFLLGVVVLLLLLWLGHSFTKADPKQVAKLIRRMGGG |
| Ga0214472_112405582 | 3300033407 | Soil | MPTLLLGVLIFILLLWAIKSFSKADPKQLATVLKALGGV |
| Ga0370515_0161425_826_960 | 3300034163 | Untreated Peat Soil | MPFLLGVVVLILLLWAGNAFSKADPKQAAKLLRYIGGGAALIFAA |
| ⦗Top⦘ |