Metagenome / Metatranscriptome Family F097844

Basic Information
Family ID	F097844
Family Type	Metagenome / Metatranscriptome
Number of Sequences	104
Average Sequence Length	44 residues
Representative Sequence	MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN
Number of Associated Samples	91
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	69.23 %
% of genes near scaffold ends (potentially truncated)	41.35 %
% of genes from short scaffolds (< 2000 bps)	88.46 %
Associated GOLD sequencing projects	80
AlphaFold2 3D model prediction	No

Most Common Taxonomy
Group	Bacteria (54.808 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (19.231 % of family members)
Environment Ontology (ENVO)	Unclassified (24.038 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (53.846 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 80.00% β-sheet: 0.00% Coil/Unstructured: 20.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF07369	DUF1488	9.62
PF04392	ABC_sub_bind	3.85
PF05598	DUF772	2.88
PF06718	DUF1203	1.92
PF00561	Abhydrolase_1	1.92
PF04314	PCuAC	0.96
PF13185	GAF_2	0.96
PF03466	LysR_substrate	0.96
PF02834	LigT_PEase	0.96
PF02308	MgtC	0.96
PF08734	GYD	0.96
PF13683	rve_3	0.96
PF00248	Aldo_ket_red	0.96
PF12706	Lactamase_B_2	0.96
PF00211	Guanylate_cyc	0.96
PF02826	2-Hacid_dh_C	0.96
PF07045	DUF1330	0.96
PF00135	COesterase	0.96
PF16653	Sacchrp_dh_C	0.96
PF01546	Peptidase_M20	0.96
PF13561	adh_short_C2	0.96

COG ID	Name	Functional Category	% Frequency in 104 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	3.85
COG1285	Magnesium uptake protein YhiD/SapB, involved in acid resistance	Inorganic ion transport and metabolism [P]	0.96
COG1514	RNA 2',3'-cyclic phosphodiesterase (2'-5' RNA ligase)	Translation, ribosomal structure and biogenesis [J]	0.96
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.96
COG2272	Carboxylesterase type B	Lipid transport and metabolism [I]	0.96
COG2847	Copper(I)-binding protein	Inorganic ion transport and metabolism [P]	0.96
COG3174	Membrane component of predicted Mg2+ transport system, contains DUF4010 domain	Inorganic ion transport and metabolism [P]	0.96
COG4274	Uncharacterized conserved protein, contains GYD domain	Function unknown [S]	0.96
COG5470	Uncharacterized conserved protein, DUF1330 family	Function unknown [S]	0.96

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	55.77 %
Unclassified	root	N/A	44.23 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	55.77 %
Unclassified	root	N/A	44.23 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	54.81 %
Unclassified	root	N/A	44.23 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.96 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	44.23 %
Unclassified	root	N/A	44.23 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	33.65 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.96 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	20.19 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.96 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.96 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.96 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	6.73 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.96 %
Sulfuricellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.73 %
Sulfuriferula	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula	0.96 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.96 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.73 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.96 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	0.96 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.73 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.96 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	0.96 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.73 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.96 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	0.96 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.73 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.96 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	0.96 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.73 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.96 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	0.96 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.73 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.96 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	0.96 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.73 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.96 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	0.96 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.73 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.96 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	0.96 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.73 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	0.96 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	0.96 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.73 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	0.96 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	0.96 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.73 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	0.96 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	0.96 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.73 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	0.96 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	0.96 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.73 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	0.96 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	0.96 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.73 %
genistoids sensu lato	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato	0.96 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	0.96 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.73 %
core genistoids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids	0.96 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	0.96 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.73 %
Genisteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae	0.96 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	0.96 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.73 %
Lupinus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus	0.96 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	0.96 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.73 %
Lupinus albus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	0.96 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	0.96 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2140918025\|NODE_281067_length_959_cov_17.157455	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1009	Open in IMG/M
2166559005\|cont_contig81377	Not Available	680	Open in IMG/M
2170459005\|F1BAP7Q02I0TM9	Not Available	518	Open in IMG/M
2170459010\|GIO7OMY02GM18Y	Not Available	503	Open in IMG/M
2228664021\|ICCgaii200_c0613660	Not Available	554	Open in IMG/M
3300000363\|ICChiseqgaiiFebDRAFT_11105351	Not Available	596	Open in IMG/M
3300000675\|JGI12335J11872_100318	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	923	Open in IMG/M
3300000687\|JGI12487J11892_100189	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1197	Open in IMG/M
3300000690\|JGI12582J11924_101325	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	700	Open in IMG/M
3300000787\|JGI11643J11755_11793624	Not Available	895	Open in IMG/M
3300000890\|JGI11643J12802_11512759	Not Available	1286	Open in IMG/M
3300000890\|JGI11643J12802_11641577	Not Available	509	Open in IMG/M
3300001383\|JGI20194J14741_1014609	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	691	Open in IMG/M
3300003911\|JGI25405J52794_10140376	Not Available	549	Open in IMG/M
3300005093\|Ga0062594_100377301	Not Available	1131	Open in IMG/M
3300005332\|Ga0066388_105326835	Not Available	652	Open in IMG/M
3300005437\|Ga0070710_10916943	Not Available	633	Open in IMG/M
3300005439\|Ga0070711_101293202	Not Available	633	Open in IMG/M
3300005713\|Ga0066905_102313910	Not Available	502	Open in IMG/M
3300005764\|Ga0066903_100411709	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2232	Open in IMG/M
3300005764\|Ga0066903_100933683	Not Available	1575	Open in IMG/M
3300005937\|Ga0081455_10611277	Not Available	709	Open in IMG/M
3300005938\|Ga0066795_10205784	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	585	Open in IMG/M
3300005947\|Ga0066794_10211460	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	582	Open in IMG/M
3300006049\|Ga0075417_10368045	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	707	Open in IMG/M
3300006049\|Ga0075417_10458265	Not Available	637	Open in IMG/M
3300006057\|Ga0075026_100923293	Not Available	538	Open in IMG/M
3300006059\|Ga0075017_101205996	Not Available	593	Open in IMG/M
3300006102\|Ga0075015_100523457	Not Available	686	Open in IMG/M
3300006174\|Ga0075014_100507548	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	676	Open in IMG/M
3300006174\|Ga0075014_100958143	Not Available	516	Open in IMG/M
3300006844\|Ga0075428_100489953	All Organisms → cellular organisms → Bacteria → Proteobacteria	1315	Open in IMG/M
3300006854\|Ga0075425_100125986	Not Available	2925	Open in IMG/M
3300006854\|Ga0075425_100394684	All Organisms → cellular organisms → Bacteria	1594	Open in IMG/M
3300006914\|Ga0075436_100172943	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1525	Open in IMG/M
3300006969\|Ga0075419_10000001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	144792	Open in IMG/M
3300009545\|Ga0105237_10548365	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1163	Open in IMG/M
3300009634\|Ga0116124_1140070	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	677	Open in IMG/M
3300009762\|Ga0116130_1197862	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	636	Open in IMG/M
3300010047\|Ga0126382_11052270	Not Available	717	Open in IMG/M
3300010358\|Ga0126370_11134410	Not Available	723	Open in IMG/M
3300010362\|Ga0126377_10311749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1555	Open in IMG/M
3300010379\|Ga0136449_104165652	Not Available	537	Open in IMG/M
3300012019\|Ga0120139_1003655	All Organisms → cellular organisms → Bacteria	3913	Open in IMG/M
3300012957\|Ga0164303_11545712	Not Available	503	Open in IMG/M
3300013307\|Ga0157372_13283410	Not Available	515	Open in IMG/M
3300013770\|Ga0120123_1018840	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1380	Open in IMG/M
3300014056\|Ga0120125_1071914	Not Available	781	Open in IMG/M
3300014165\|Ga0181523_10086455	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1894	Open in IMG/M
3300014489\|Ga0182018_10548830	Not Available	609	Open in IMG/M
3300015374\|Ga0132255_105692603	Not Available	527	Open in IMG/M
3300016270\|Ga0182036_11312476	Not Available	604	Open in IMG/M
3300016341\|Ga0182035_11717812	Not Available	567	Open in IMG/M
3300016422\|Ga0182039_10149485	All Organisms → cellular organisms → Bacteria	1806	Open in IMG/M
3300017940\|Ga0187853_10135213	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1190	Open in IMG/M
3300018043\|Ga0187887_10441109	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	768	Open in IMG/M
3300022694\|Ga0222623_10164694	Not Available	863	Open in IMG/M
3300025457\|Ga0208850_1013340	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1531	Open in IMG/M
3300025627\|Ga0208220_1163852	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	560	Open in IMG/M
3300025862\|Ga0209483_1125358	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1094	Open in IMG/M
3300025903\|Ga0207680_10526466	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	843	Open in IMG/M
3300025916\|Ga0207663_11443081	Not Available	554	Open in IMG/M
3300025941\|Ga0207711_11499682	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	617	Open in IMG/M
3300026692\|Ga0207725_103355	All Organisms → cellular organisms → Bacteria → Proteobacteria	792	Open in IMG/M
3300026804\|Ga0207737_105860	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	865	Open in IMG/M
3300026804\|Ga0207737_110735	All Organisms → cellular organisms → Bacteria → Proteobacteria	629	Open in IMG/M
3300026809\|Ga0207820_102747	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1681	Open in IMG/M
3300026817\|Ga0207775_100382	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4984	Open in IMG/M
3300026833\|Ga0207728_102448	All Organisms → cellular organisms → Bacteria	2021	Open in IMG/M
3300026849\|Ga0207804_119272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	608	Open in IMG/M
3300026872\|Ga0207785_1014507	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	697	Open in IMG/M
3300026928\|Ga0207779_1006077	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1758	Open in IMG/M
3300026941\|Ga0207741_1009891	All Organisms → cellular organisms → Bacteria → Proteobacteria	1115	Open in IMG/M
3300026945\|Ga0207743_1006250	All Organisms → cellular organisms → Bacteria → Proteobacteria	1363	Open in IMG/M
3300026982\|Ga0207854_1003660	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2159	Open in IMG/M
3300027023\|Ga0207736_103860	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	999	Open in IMG/M
3300027090\|Ga0208604_1015328	Not Available	728	Open in IMG/M
3300027854\|Ga0209517_10509387	All Organisms → cellular organisms → Bacteria	654	Open in IMG/M
3300027873\|Ga0209814_10000151	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	19630	Open in IMG/M
3300027873\|Ga0209814_10498437	Not Available	539	Open in IMG/M
3300027880\|Ga0209481_10265849	All Organisms → cellular organisms → Bacteria → Proteobacteria	866	Open in IMG/M
3300027915\|Ga0209069_10055281	All Organisms → cellular organisms → Bacteria	1870	Open in IMG/M
3300028711\|Ga0307293_10147442	Not Available	749	Open in IMG/M
3300028791\|Ga0307290_10082730	Not Available	1168	Open in IMG/M
3300028799\|Ga0307284_10071551	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1257	Open in IMG/M
3300028807\|Ga0307305_10121587	All Organisms → cellular organisms → Bacteria	1207	Open in IMG/M
3300028807\|Ga0307305_10154427	Not Available	1059	Open in IMG/M
3300028824\|Ga0307310_10487326	Not Available	620	Open in IMG/M
3300030945\|Ga0075373_11579473	Not Available	522	Open in IMG/M
3300031128\|Ga0170823_12907047	Not Available	562	Open in IMG/M
3300031170\|Ga0307498_10000016	All Organisms → cellular organisms → Bacteria → Proteobacteria	16138	Open in IMG/M
3300031170\|Ga0307498_10020164	All Organisms → cellular organisms → Bacteria	1507	Open in IMG/M
3300031226\|Ga0307497_10094886	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1151	Open in IMG/M
3300031226\|Ga0307497_10176083	All Organisms → cellular organisms → Bacteria	909	Open in IMG/M
3300031231\|Ga0170824_107196660	Not Available	728	Open in IMG/M
3300031231\|Ga0170824_115010405	All Organisms → cellular organisms → Bacteria	866	Open in IMG/M
3300031231\|Ga0170824_125286468	Not Available	896	Open in IMG/M
3300031446\|Ga0170820_13588686	All Organisms → cellular organisms → Bacteria	862	Open in IMG/M
3300031446\|Ga0170820_16579288	All Organisms → cellular organisms → Bacteria → Proteobacteria	2172	Open in IMG/M
3300031474\|Ga0170818_101979475	Not Available	799	Open in IMG/M
3300031708\|Ga0310686_110754818	Not Available	785	Open in IMG/M
3300032012\|Ga0310902_10824335	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	634	Open in IMG/M
3300033887\|Ga0334790_004379	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	9344	Open in IMG/M
3300033888\|Ga0334792_015023	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	2901	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	82.69%
Host-Associated	Host-Associated	16.35%
Engineered	Engineered	0.96%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	71.15%
Plants	Host-Associated → Plants	16.35%
Aquatic	Environmental → Aquatic	11.54%
Modeled	Engineered → Modeled	0.96%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	69.23%
Rhizosphere	Host-Associated → Plants → Rhizosphere	13.46%
Sediment	Environmental → Aquatic → Sediment	6.73%
Freshwater	Environmental → Aquatic → Freshwater	4.81%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.88%
Peat	Environmental → Terrestrial → Peat	1.92%
Simulated Communities (Sequence Read Mixture)	Engineered → Modeled → Simulated Communities (Sequence Read Mixture)	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	43.27%
Loam	Environmental → Terrestrial → Soil → Loam	23.08%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	12.50%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	6.73%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	4.81%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.88%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.92%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.96%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.96%
Unclassified	Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	20.19%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	16.35%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	12.50%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	10.58%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	7.69%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	6.73%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.73%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	2.88%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	2.88%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.88%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.92%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.92%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.96%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.96%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.96%
Unclassified	Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	19.23%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	11.54%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	9.62%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	6.73%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	5.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.81%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	3.85%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	2.88%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	2.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.88%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.88%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	1.92%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	1.92%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.92%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	1.92%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	1.92%
Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil	1.92%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.92%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	0.96%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.96%
Palsa	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa	0.96%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.96%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.96%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.96%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.96%
Simulated	Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated	0.96%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2140918025	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3	Environmental	Open in IMG/M
2166559005	Simulated microbial communities from Lyon, France	Engineered	Open in IMG/M
2170459005	Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm	Environmental	Open in IMG/M
2170459010	Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)	Environmental	Open in IMG/M
2228664021	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000363	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000675	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54	Environmental	Open in IMG/M
3300000687	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50	Environmental	Open in IMG/M
3300000690	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 75	Environmental	Open in IMG/M
3300000787	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300001383	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012	Environmental	Open in IMG/M
3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005938	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191	Environmental	Open in IMG/M
3300005947	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental	Open in IMG/M
3300006102	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013	Environmental	Open in IMG/M
3300006174	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009634	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150	Environmental	Open in IMG/M
3300009762	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300012019	Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013770	Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M	Environmental	Open in IMG/M
3300014056	Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M	Environmental	Open in IMG/M
3300014165	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG	Environmental	Open in IMG/M
3300014489	Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG	Environmental	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300017940	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100	Environmental	Open in IMG/M
3300018043	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10	Environmental	Open in IMG/M
3300022694	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex	Environmental	Open in IMG/M
3300025457	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes)	Environmental	Open in IMG/M
3300025627	Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes)	Environmental	Open in IMG/M
3300025862	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)	Environmental	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026692	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 38 (SPAdes)	Environmental	Open in IMG/M
3300026804	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 2 (SPAdes)	Environmental	Open in IMG/M
3300026809	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 47 (SPAdes)	Environmental	Open in IMG/M
3300026817	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 17 (SPAdes)	Environmental	Open in IMG/M
3300026833	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 (SPAdes)	Environmental	Open in IMG/M
3300026849	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 46 (SPAdes)	Environmental	Open in IMG/M
3300026872	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 74 (SPAdes)	Environmental	Open in IMG/M
3300026928	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes)	Environmental	Open in IMG/M
3300026941	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 39 (SPAdes)	Environmental	Open in IMG/M
3300026945	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 55 (SPAdes)	Environmental	Open in IMG/M
3300026982	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 7 (SPAdes)	Environmental	Open in IMG/M
3300027023	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 1 (SPAdes)	Environmental	Open in IMG/M
3300027090	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes)	Environmental	Open in IMG/M
3300027854	Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental	Open in IMG/M
3300028711	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150	Environmental	Open in IMG/M
3300028791	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144	Environmental	Open in IMG/M
3300028799	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123	Environmental	Open in IMG/M
3300028807	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186	Environmental	Open in IMG/M
3300028824	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197	Environmental	Open in IMG/M
3300030945	Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031128	Oak Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031170	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300032012	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3	Environmental	Open in IMG/M
3300033887	Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1	Environmental	Open in IMG/M
3300033888	Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F097844

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
b3_nosca_v_01992570	2140918025	Soil	MSSPLDLLNKIIGAVIAYGPRNKTKKARKARKAAHRKKIAAIKRD
cont_0377.00005430	2166559005	Simulated	MRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN
E41_06892840	2170459005	Grass Soil	MRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRF
F62_02273760	2170459010	Grass Soil	DLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN
ICCgaii200_06136602	2228664021	Soil	MRTPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKIAAMKRD
ICChiseqgaiiFebDRAFT_111053511	3300000363	Soil	IGAIIAYGPKNKTKKATMARKVARRKKLAPMKPN*
JGI12335J11872_1003181	3300000675	Tropical Forest Soil	RSQTMINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKRFAAMKRH*
JGI12487J11892_1001891	3300000687	Tropical Forest Soil	LNKFISAIIAYGPKNKTKKARMARKAARRKRFAAMKRH*
JGI12582J11924_1013251	3300000690	Tropical Forest Soil	RSQTMINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKKLAAIKRH*
JGI11643J11755_117936242	3300000787	Soil	MSNPLDLLNKFIGAIIAXGPKNKTKKAXMARXXARRKKXAAMKRX*
JGI11643J12802_115127594	3300000890	Soil	MSNPLDLLNKFIGAIIAYGPKNKTKKATMARKVARRKKLAAMKRN*
JGI11643J12802_116415772	3300000890	Soil	MRTPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKIAAMKRD*
JGI20194J14741_10146091	3300001383	Arctic Peat Soil	VRSPLDLLNKIIGAVIAYGPKNKTMKARKARKAARRKKVAER
JGI25405J52794_101403761	3300003911	Tabebuia Heterophylla Rhizosphere	MTNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN*
Ga0062594_1003773012	3300005093	Soil	MRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN*
Ga0066388_1053268352	3300005332	Tropical Forest Soil	MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN*
Ga0070710_109169432	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN*
Ga0070711_1012932021	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKFAAMKRH*
Ga0066905_1023139101	3300005713	Tropical Forest Soil	MSNLLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRD*
Ga0066903_1004117094	3300005764	Tropical Forest Soil	MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKR
Ga0066903_1009336831	3300005764	Tropical Forest Soil	MRNPLDLLNKFIGAIIAHGPKNKTKKARMARKAARRKKLAAMKRN*
Ga0081455_106112772	3300005937	Tabebuia Heterophylla Rhizosphere	MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRD*
Ga0066795_102057841	3300005938	Soil	MGSPLDLLNKIIGALIAYGPRNKTKKARKARKAAHRKKIAAIKRD*
Ga0066794_102114602	3300005947	Soil	MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKNFVAMKRD*
Ga0075417_103680452	3300006049	Populus Rhizosphere	MTNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKR
Ga0075417_104582652	3300006049	Populus Rhizosphere	MSNLLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN*
Ga0075026_1009232932	3300006057	Watersheds	GAARTRRSQTMSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRD*
Ga0075017_1012059961	3300006059	Watersheds	MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN*
Ga0075015_1005234571	3300006102	Watersheds	MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRD*
Ga0075014_1005075483	3300006174	Watersheds	LNKFIGAIIAYGPKNKTKKARMARKTARRKKLAAMKRD*
Ga0075014_1009581431	3300006174	Watersheds	MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKTARRKKLAAMKRD*
Ga0075428_1004899532	3300006844	Populus Rhizosphere	MTNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRD*
Ga0075425_1001259861	3300006854	Populus Rhizosphere	MRYPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRD*
Ga0075425_1003946843	3300006854	Populus Rhizosphere	MTNPLDFLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN*
Ga0075436_1001729434	3300006914	Populus Rhizosphere	MTNPLNLLNKFIGAIIAYGPKNKTKKARMARKAARRK
Ga0075419_10000001162	3300006969	Populus Rhizosphere	MTNPLDLLNKFIGSIIAYGPKNKTKKARMARKAARRKKLAAMKRN*
Ga0105237_105483652	3300009545	Corn Rhizosphere	MRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRNRFAAMKRN*
Ga0116124_11400701	3300009634	Peatland	MSGPLDLLNKFIGAVIAYGPKNKTKKARKARKAARRKTIAAIKRD*
Ga0116130_11978621	3300009762	Peatland	DLLNKFIGAVIAYGPKNKTKKARKARKAARRKTIAAIKRD*
Ga0126382_110522703	3300010047	Tropical Forest Soil	FIGAVIAYGPKDKTKKARMARKAARRKKLAAMKRD*
Ga0126370_111344101	3300010358	Tropical Forest Soil	MTNLLDILNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN*
Ga0126377_103117492	3300010362	Tropical Forest Soil	MRNPLDLLKKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN*
Ga0136449_1041656521	3300010379	Peatlands Soil	MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKVAAMQRD*
Ga0120139_10036554	3300012019	Permafrost	MTNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARHKKFAAKIRE*
Ga0164303_115457121	3300012957	Soil	MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAALKRN*
Ga0157372_132834101	3300013307	Corn Rhizosphere	RRMRSSQTMRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN*
Ga0120123_10188402	3300013770	Permafrost	MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARHKKYTAKRLAK*
Ga0120125_10719141	3300014056	Permafrost	MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARHKKYTAKRLAK*
Ga0181523_100864552	3300014165	Bog	MGRPLDLLNKIIGAVIAYGPRNKTKKARKARKAARRKTLAAIKRD*
Ga0182018_105488302	3300014489	Palsa	MGSPLDLLNKTIGAVIAYGPRNKTKKARKARKVARRKKLAAIKRD*
Ga0132255_1056926032	3300015374	Arabidopsis Rhizosphere	FIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRD*
Ga0182036_113124761	3300016270	Soil	MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN
Ga0182035_117178121	3300016341	Soil	MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARSKKLAAMKRN
Ga0182039_101494851	3300016422	Soil	QTMINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKRFAAMKRH
Ga0187853_101352132	3300017940	Peatland	MSGPLDLLNKFIGAVIAYGPKNKTKKARKARKAARRKTIAAIKRD
Ga0187887_104411092	3300018043	Peatland	MGSPLDLLNKTIGAVIAYGPRNKTKKARKARKVARRKKLAAIKRD
Ga0222623_101646942	3300022694	Groundwater Sediment	MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN
Ga0208850_10133404	3300025457	Arctic Peat Soil	VRSPLDLLNKIIGAVIAYGPKNKTMKARKARKAARRKK
Ga0208220_11638522	3300025627	Arctic Peat Soil	MGSPLDLLNKIIGAVIAYGPRNKTKKARKATKAARRKKLAALKRD
Ga0209483_11253581	3300025862	Arctic Peat Soil	GSPLDLLNKIIGAVIAYGPRNKTKKARKATKAARRKKLAALKRD
Ga0207680_105264663	3300025903	Switchgrass Rhizosphere	MRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMK
Ga0207663_114430811	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKFAAMKRH
Ga0207711_114996821	3300025941	Switchgrass Rhizosphere	MRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKR
Ga0207725_1033551	3300026692	Tropical Forest Soil	MINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKKLAAIKRH
Ga0207737_1058602	3300026804	Tropical Forest Soil	MINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKRFAAMKRH
Ga0207737_1107351	3300026804	Tropical Forest Soil	LDLLNKFISAIIAYGPKNKTKKARMARKAARRKKLAAIKRH
Ga0207820_1027474	3300026809	Tropical Forest Soil	DLLNKFISAIIAYGPKNKTKKARMARKAARRKRFAAMKRH
Ga0207775_1003821	3300026817	Tropical Forest Soil	RTRRSQTMINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKKLAAIKRH
Ga0207728_1024481	3300026833	Tropical Forest Soil	ERARSQTMINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKRFAAMKRH
Ga0207804_1192721	3300026849	Tropical Forest Soil	SQTMINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKKLAAIKRH
Ga0207785_10145071	3300026872	Tropical Forest Soil	ARTRRSQTMINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKKLAAIKRH
Ga0207779_10060771	3300026928	Tropical Forest Soil	SQTMINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKRFAAMKRH
Ga0207741_10098911	3300026941	Tropical Forest Soil	TRRSQTMINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKKLAAIKRH
Ga0207743_10062504	3300026945	Tropical Forest Soil	LNKFISAIIAYGPKNKTKKARMARKAARRKKLAAIKRH
Ga0207854_10036601	3300026982	Tropical Forest Soil	NPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKRFAAMKRH
Ga0207736_1038603	3300027023	Tropical Forest Soil	DLLNKFISAIIAYGPKNKTKKARMARKAARRKKLAAIKRH
Ga0208604_10153281	3300027090	Forest Soil	MTNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKFAAMKRH
Ga0209517_105093872	3300027854	Peatlands Soil	MSNPLDLLNKFISAIIAYGPKNKTKKARMARKATRRKKFAAMKRD
Ga0209814_1000015123	3300027873	Populus Rhizosphere	MTNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN
Ga0209814_104984371	3300027873	Populus Rhizosphere	MSNLLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN
Ga0209481_102658491	3300027880	Populus Rhizosphere	MTNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRD
Ga0209069_100552811	3300027915	Watersheds	MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKFAPMKRH
Ga0307293_101474421	3300028711	Soil	LLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN
Ga0307290_100827301	3300028791	Soil	MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN
Ga0307284_100715511	3300028799	Soil	KFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN
Ga0307305_101215871	3300028807	Soil	MSNLLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRYAAMKRN
Ga0307305_101544272	3300028807	Soil	MRDPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN
Ga0307310_104873262	3300028824	Soil	EPVNPIDLLNKFIGAIIAYGPKNKTKKSRMARKATRRKRFAAMKRN
Ga0075373_115794732	3300030945	Soil	LEPVNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN
Ga0170823_129070471	3300031128	Forest Soil	LLNKIIGAIIAYGPKNKTKKARMARKAARRKKFAAMKRH
Ga0307498_100000166	3300031170	Soil	MHNPLDLLNKFIGAIIAHGPKNKTKKARMARKAARRKKLAAMKRD
Ga0307498_100201641	3300031170	Soil	MRNLLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRD
Ga0307497_100948861	3300031226	Soil	MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAM
Ga0307497_101760832	3300031226	Soil	MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAALKRN
Ga0170824_1071966602	3300031231	Forest Soil	MRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKR
Ga0170824_1150104051	3300031231	Forest Soil	LEPVNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRK
Ga0170824_1252864681	3300031231	Forest Soil	QTMRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN
Ga0170820_135886861	3300031446	Forest Soil	LEPVNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKR
Ga0170820_165792884	3300031446	Forest Soil	MRNPIDLLNKFIGAIIAYGPKNKTKKARMERKAARRKRFAAMKRN
Ga0170818_1019794751	3300031474	Forest Soil	NKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN
Ga0310686_1107548181	3300031708	Soil	MSPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKFAPMKRH
Ga0310902_108243352	3300032012	Soil	MRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN
Ga0334790_004379_7396_7533	3300033887	Soil	MGSPLDLLNKIIGAVIAYGPRNKTKKARKARKVARRKKLAAIKRD
Ga0334792_015023_2774_2899	3300033888	Soil	MGSPLDLLNKIIGAVIAYGPRNKTKKARKARKVARRKKLAAI

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign