Basic Information | |
---|---|
Family ID | F097838 |
Family Type | Metagenome |
Number of Sequences | 104 |
Average Sequence Length | 39 residues |
Representative Sequence | MRDAITGIGLVAFGTIAVLALCIGVCALADAVIRVVA |
Number of Associated Samples | 58 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 59.62 % |
% of genes near scaffold ends (potentially truncated) | 18.27 % |
% of genes from short scaffolds (< 2000 bps) | 85.58 % |
Associated GOLD sequencing projects | 54 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (84.615 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.808 % of family members) |
Environment Ontology (ENVO) | Unclassified (51.923 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (67.308 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF04966 | OprB | 1.92 |
PF00196 | GerE | 1.92 |
PF04392 | ABC_sub_bind | 1.92 |
PF10994 | DUF2817 | 1.92 |
PF13356 | Arm-DNA-bind_3 | 0.96 |
PF03457 | HA | 0.96 |
PF04226 | Transgly_assoc | 0.96 |
PF04773 | FecR | 0.96 |
PF12849 | PBP_like_2 | 0.96 |
PF05235 | CHAD | 0.96 |
PF00536 | SAM_1 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.92 |
COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.96 |
COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.96 |
COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 84.62 % |
All Organisms | root | All Organisms | 15.38 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.08% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 19.23% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 17.31% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.81% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300027010 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 64 (SPAdes) | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A1DRAFT_101674701 | 3300000597 | Forest Soil | MEAPIRDAMTGIGLIAFGTIAMLALCIGVCALADAIVRVVA |
Ga0066388_1001761492 | 3300005332 | Tropical Forest Soil | MEAPARDAVTGIGLIVFGTIAVIALCIGVCALADAVIRIVA* |
Ga0066388_1064930651 | 3300005332 | Tropical Forest Soil | MEPPMRDGIIGIGLVAFGTIAVLALCIGVCALADAIIRVVA* |
Ga0066388_1086398211 | 3300005332 | Tropical Forest Soil | MEAPMRDAITGIGLVAFGAIAVLAVCIGVCALADAVIRVVA* |
Ga0066903_1001494955 | 3300005764 | Tropical Forest Soil | MESLRDAINGIGLVAFGTIAVLALCIGVCALADAVSRIAA* |
Ga0066903_1003843525 | 3300005764 | Tropical Forest Soil | MRDAITGVGLVAFGTIAVLALCIGVCALADAIIRVVV* |
Ga0066903_1006719283 | 3300005764 | Tropical Forest Soil | MRDAITGIGLVAFGTIAVLALCIGVCALADAVIRVVA* |
Ga0066903_1009367523 | 3300005764 | Tropical Forest Soil | MRDGITGIGLVAFGTIAVLALCIGVCALTDAIIRVVA* |
Ga0066903_1011271273 | 3300005764 | Tropical Forest Soil | MRDAITGIGLVAFGTIAVLALCIGVCALTEAVIGLVA* |
Ga0066903_1013062773 | 3300005764 | Tropical Forest Soil | MEAPMRDAITGVGLVAFGTIAVLALCIGVCAVADAVIRVVA* |
Ga0066903_1017501953 | 3300005764 | Tropical Forest Soil | MKDAITGVGLVAFGTIAVLTLCIGVCALADAVIRVVA* |
Ga0066903_1027457872 | 3300005764 | Tropical Forest Soil | MRDAITGIGLVAFGTIAVLALCIGVCVLADAVVRVVT* |
Ga0066903_1031088661 | 3300005764 | Tropical Forest Soil | MEAQTRDAITGIGLVAFGAIAVIALCIGVCALADAVSRVVA* |
Ga0066903_1037346761 | 3300005764 | Tropical Forest Soil | MRDAITGIGLVALGTIAVLALCIGVCVLADVVVRIVA* |
Ga0066903_1040779031 | 3300005764 | Tropical Forest Soil | MRDEITGIGLVVFGTIAVLALCIGVCALADAVIRVVT* |
Ga0066903_1068348831 | 3300005764 | Tropical Forest Soil | VGIAIQRMETPMKDAIIGIGLVAFGAIAVLTLCIGVCALADAVI |
Ga0066903_1076033323 | 3300005764 | Tropical Forest Soil | MEAQTRDAITGIGLVAFGAIAVIALCIGICALADAVSRVVA* |
Ga0075017_1015024962 | 3300006059 | Watersheds | MRDAITGIGLVAFGTIAVLGLCIGVCALADAVIRVVA* |
Ga0075014_1007790431 | 3300006174 | Watersheds | VIEGAPMRDAISGIGLVVFGTIAVLALCIGVCALADAAIRVVA* |
Ga0079222_101235701 | 3300006755 | Agricultural Soil | MEARMRDAITGIGLVAFGTIAVLGVCIGVCALADAVIRVIT* |
Ga0126374_102597333 | 3300009792 | Tropical Forest Soil | REAITGIGLVAFGTIAVLALCIGVCALADAVIRVLA* |
Ga0126373_101410004 | 3300010048 | Tropical Forest Soil | MEAQTRDAITGIGLVAFGAIAVIALCIGICALADAVSRAVA* |
Ga0126373_103554073 | 3300010048 | Tropical Forest Soil | MREAMTGIGLVAFGTIAVLALCIGVCALADAVIRVLA* |
Ga0126373_107482163 | 3300010048 | Tropical Forest Soil | MRDAITGIGLVAFGTIAVLALCIGVCVLADAVVRLVT* |
Ga0126373_108680623 | 3300010048 | Tropical Forest Soil | MDERRSMEAPMRDAITGIGLVAFGTFAVMALCIGVCALADAVIRIVT* |
Ga0126370_118532961 | 3300010358 | Tropical Forest Soil | MRDAITGIGLVAFGTIAVLALCIGVCALAEAVIGLVA* |
Ga0126376_105398032 | 3300010359 | Tropical Forest Soil | MEAQTKDAITGIGLVAFGAIAVIALCIGICALADAVSRVVA* |
Ga0126372_108696162 | 3300010360 | Tropical Forest Soil | MREAITGIGLVAFGTIAVLAVCIGVCALADAVVRVVARQKL* |
Ga0126372_117582572 | 3300010360 | Tropical Forest Soil | MDERITGIGLFAFGTIAVPAVCIGVCALADAIIRVVA* |
Ga0126379_121476563 | 3300010366 | Tropical Forest Soil | MRDAITGIGLVAFGTIAVLALCVGVCALADAVIRVVA* |
Ga0126381_1001195995 | 3300010376 | Tropical Forest Soil | MEAQTKDAITGIGLVAFGAIAVIALCIGICALADAVSRAVA* |
Ga0126381_1035190122 | 3300010376 | Tropical Forest Soil | MDERRSMEAPMRDAITGIGLVAFGTIAVLALCIGVCALADAVIRVVT* |
Ga0126381_1038915701 | 3300010376 | Tropical Forest Soil | MEAQTRDAITGIGLVAFGAIAVVALCIGICALADAVSRVVA* |
Ga0126369_105856732 | 3300012971 | Tropical Forest Soil | MDERITGIGLFAFGTIAVLTLCIGVCALVDAIIRVVA* |
Ga0126369_115330103 | 3300012971 | Tropical Forest Soil | MRDGITGIGLVAFGTIAVLALCIGVCALADAIIRVVA* |
Ga0126369_135472501 | 3300012971 | Tropical Forest Soil | MEAQTRDAITGIDLVAFGAIAVIALCIGVCALADAVSRVVA* |
Ga0182036_105013324 | 3300016270 | Soil | MRDAITGIGLVAFGTIAVLALCIGVCALADAIIRVVA |
Ga0182036_115751252 | 3300016270 | Soil | MRDAITGIGLITFGTIAVLALCIGVCALADAVIRVVA |
Ga0182041_101072233 | 3300016294 | Soil | MRDEITGIGLVAFGTIAVLVLCIGVCALADAVIRVVA |
Ga0182033_102978201 | 3300016319 | Soil | MNERRSMETPMRDAITGIGLVAFGTIAVLALCIGVCALADAVTRVAA |
Ga0182033_105414363 | 3300016319 | Soil | MGDGIIGIGLVAFGTIAVLALCIGVCALADAIIRVVA |
Ga0182033_120472862 | 3300016319 | Soil | PMRDAITGIGLIAFGTIAVLALCIGVCALADAVVRLVA |
Ga0182032_107223651 | 3300016357 | Soil | MRDAITGICLVAFGAIAVLAVCIGVCALADAVIRVVA |
Ga0182034_106965003 | 3300016371 | Soil | PMREAITGIGLVAFGTIAVLALCIGVCALADAIVRVVA |
Ga0182040_102708763 | 3300016387 | Soil | MRDAIIGIGLIAFGTIAVLALCIGVCALADAVVRVVA |
Ga0182039_108086191 | 3300016422 | Soil | MRDAITGIGLVVFGTIAVLGLCIGVCALADVVIRVVA |
Ga0182039_122435252 | 3300016422 | Soil | MEAPMRDAITGIGLVAFGAIAVLALCIGVCALADAVIRVV |
Ga0182038_114638961 | 3300016445 | Soil | RMRDAITGIGLVAFGMIAVLGLCIGVCALADVVIRVVA |
Ga0187809_103309921 | 3300017937 | Freshwater Sediment | MKDAITGIGLVAFGTIAVLGLCIGACALADAIIRAAA |
Ga0187779_107446571 | 3300017959 | Tropical Peatland | LRTLAPMRDAITGIGLVAFGTIAVLALCIGVCTLADAVVRVVA |
Ga0187780_103295984 | 3300017973 | Tropical Peatland | MRDAITGIGLVAFGTIAVLALCIGVCALADAVVRVVA |
Ga0187777_105858142 | 3300017974 | Tropical Peatland | MRDAITGIGLVAFGTIAVLALCIGVCTLADAVVRVVA |
Ga0187766_100484331 | 3300018058 | Tropical Peatland | MRDAITGIGLVAFGTIAVLALCIGVCTLAEAVVRVVA |
Ga0187765_100039514 | 3300018060 | Tropical Peatland | MRDAMTGIGLVAFGTIAVLALCIGVCALADAVVRVVA |
Ga0210385_111193571 | 3300021402 | Soil | MEATIRDAITGIGLVAFGTIAVLALCIGVCALADAVIRVMA |
Ga0126371_101772024 | 3300021560 | Tropical Forest Soil | MRDAITGVGLVAFGTIAVLALCIGVCALADAIIRVVV |
Ga0126371_101848294 | 3300021560 | Tropical Forest Soil | VQNEEAPMREAMTGIGLVAFGTIAVLALCIGVCALADAVIRVLA |
Ga0126371_101987552 | 3300021560 | Tropical Forest Soil | MRDAITGIGLVAFGTIAVLALCIGVCALTEAVIGLVA |
Ga0126371_107852493 | 3300021560 | Tropical Forest Soil | MEAQTRDAITGIGLVAFGAIAVIALCIGVCALADAVSRVVA |
Ga0207839_10091852 | 3300027010 | Tropical Forest Soil | MRDALTGIGLVTFGTIAVVALCIGVCALADVVIRVVA |
Ga0207826_10213673 | 3300027680 | Tropical Forest Soil | METSIRDAITGIGLVAFGTIAVLALCIGVCALADVVIRVVA |
Ga0318516_105619951 | 3300031543 | Soil | MRDEITGIGLVAFGTIAVLVLCIGVCALANAVIRVVA |
Ga0318541_102208602 | 3300031545 | Soil | MREAITGIGLVAFGTIAVLALSIGVCALADAVIRVLA |
Ga0318541_105146681 | 3300031545 | Soil | ETPMRDAITGIGLVAFGTIAVLALCIGVCALADAVTRVVA |
Ga0318538_101365063 | 3300031546 | Soil | MREAITGIGLVAFGTIAVLALCIGVCALADAVIRVLA |
Ga0318573_108050991 | 3300031564 | Soil | MRDAITGIGLVAFGTIAVLALCIGVCALADAIVRVVA |
Ga0310915_101060652 | 3300031573 | Soil | MRDAITGIGLVAFGMIAVLGLCIGVCALADVVIRVVA |
Ga0310915_104802872 | 3300031573 | Soil | MRDAITGIGLIAFGTIAVLALCIGICALADAVVRVVA |
Ga0310915_106369621 | 3300031573 | Soil | RDAITGIGLVAFGAIAVLAVCIGVCALADAVIRVVA |
Ga0310915_108002172 | 3300031573 | Soil | MDERSSMEVPVRDAITGIGLMAFGAIAVLALCIGVCALADAVIRVVA |
Ga0310915_108284701 | 3300031573 | Soil | MRDAITGIGLVAIGTIAVSALCIGVCALADAVVRVVA |
Ga0310915_111841601 | 3300031573 | Soil | MRDAITGISLVTFGTIAVLALCIGVCAADVVVRVMA |
Ga0318572_108020932 | 3300031681 | Soil | VRNEEAPMREAITGIGLVAFGTIAVLALCIGVCALADAVIRVLA |
Ga0318501_105942953 | 3300031736 | Soil | VQNEEAPMREAITGIGLVAFGTIAVLALSIGVCALADAVIRVLA |
Ga0307477_110903522 | 3300031753 | Hardwood Forest Soil | MRDAIKGIGLVAFGTIAVLALCIGVCALADAVIRVVT |
Ga0318523_105081222 | 3300031798 | Soil | VQNEEAPMREAITGIGLVAFGTIAVLALCIGVCALADAVIRVVA |
Ga0318567_108751262 | 3300031821 | Soil | VQNEEAPMREAITGIGLVAFGTIAVLALCIGVCALADAVIRVLA |
Ga0310917_100335805 | 3300031833 | Soil | MEARMRDAITGIGLVAFGTIAVLGLCIGVCALADVVIRVVA |
Ga0306919_103512103 | 3300031879 | Soil | MEARMRDAITGIGLVAFGMIAVLGLCIGVCALADVVIRVVA |
Ga0318520_102298463 | 3300031897 | Soil | VQNEEAPLREAITGIGLVAFGTIAVLALCIGVCALADAVIRVLA |
Ga0306923_1002168211 | 3300031910 | Soil | MRDAITGIGLVAFGTIAVLALCIGVCALADAVIRVVA |
Ga0306923_101170515 | 3300031910 | Soil | MRDAITGIGLVAFGTIAVLALCIGVCVLAEAVMRVVA |
Ga0306921_108178173 | 3300031912 | Soil | MEAPMRDAITGIGLVAFGAIAVLALCIGVCALADAVIRVVA |
Ga0306921_118560551 | 3300031912 | Soil | MDERSSMEVPMRDAITGIGLMAFGAIAVLALCIGVCALADAVIRVVA |
Ga0310912_114292701 | 3300031941 | Soil | MREAITGIGLVAFGTIAVLALCIGVCVLADAIIRVVT |
Ga0310916_105897331 | 3300031942 | Soil | MRDAITGISLVTFGTIAVLALCIGVCALADVVIRVMA |
Ga0310913_108174433 | 3300031945 | Soil | VPVRDAITGIGLMAFGAIAVLALCIGVCALADAVIRVVA |
Ga0310913_108382252 | 3300031945 | Soil | MREAPMREAPMREAITGIGLVAFGTIAVLALCFGVCVLADAIIRVVT |
Ga0310910_110144012 | 3300031946 | Soil | MEAPMRDAITGIGLVAFGAIAVLALCIGVCALADAVMRVVA |
Ga0318530_104882591 | 3300031959 | Soil | MREAITGIGLVAFGTIAVLALCIGVCALADAVVRVVA |
Ga0310911_102225611 | 3300032035 | Soil | STDRGKPMRDAIIGIGLIAFGTIAVLALCIGVCALADAVVRVVA |
Ga0310911_103105431 | 3300032035 | Soil | MEVPMRDAITGIGLMAFGAIAVLALCIGVCALADAVIRVVA |
Ga0310911_103658891 | 3300032035 | Soil | SMRDAITGIGLVAFGTIAVLALCIGVCALADAVIRVVA |
Ga0318549_103110822 | 3300032041 | Soil | MREAITGIGLVAFGTIAVLALSIGVCALADAVIRV |
Ga0318533_102639583 | 3300032059 | Soil | MRDAITGIGLVAFGTIAVLALCIGVCALADAVIRVV |
Ga0318533_106775682 | 3300032059 | Soil | MRDAITGIGLVAFGTIAVLALCIGVCALADAVTRVAA |
Ga0306924_103613225 | 3300032076 | Soil | MEVPVRDAITGIGLMAFGAIAVLALCIGVCALADAVIRVVA |
Ga0318577_102956732 | 3300032091 | Soil | MRDAITGIGLVAFGTIAVLALCIGVCALADAATRVVA |
Ga0306920_1000170865 | 3300032261 | Soil | MRDAITGIGRLRHDCRAGTCIGVCALADAVVRVVA |
Ga0306920_1008834261 | 3300032261 | Soil | MGDGIIGIGPVAFGTIAVLALCIGVCALADAIIRVVA |
Ga0306920_1009055202 | 3300032261 | Soil | LRYGAPMRDAITGIGLVAFGTIAVLALCIGVCALADAVIRVVA |
Ga0306920_1009957824 | 3300032261 | Soil | MREAPMREAITGIGLVAFGTIAVLALCIGVCVLADAIIRVVT |
Ga0306920_1020182372 | 3300032261 | Soil | MRDAITGIGLVAFGTIAVLALCIGVCALADAVTRVVA |
Ga0306920_1024619541 | 3300032261 | Soil | MRDAITGIGLVALGTIAVLALCIGVCALADAIVRVVA |
⦗Top⦘ |