| Basic Information | |
|---|---|
| Family ID | F097829 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 39 residues |
| Representative Sequence | KRRGKKIATIAIARKLLTRAWHLLAEMQATDASAPPRRP |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.27 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.615 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.539 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.577 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.038 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.78% β-sheet: 0.00% Coil/Unstructured: 55.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 1.92 |
| PF13006 | Nterm_IS4 | 1.92 |
| PF01348 | Intron_maturas2 | 1.92 |
| PF03050 | DDE_Tnp_IS66 | 1.92 |
| PF07366 | SnoaL | 0.96 |
| PF00884 | Sulfatase | 0.96 |
| PF14765 | PS-DH | 0.96 |
| PF01548 | DEDD_Tnp_IS110 | 0.96 |
| PF08044 | DUF1707 | 0.96 |
| PF00933 | Glyco_hydro_3 | 0.96 |
| PF12681 | Glyoxalase_2 | 0.96 |
| PF02594 | DUF167 | 0.96 |
| PF12728 | HTH_17 | 0.96 |
| PF04493 | Endonuclease_5 | 0.96 |
| PF01927 | Mut7-C | 0.96 |
| PF00903 | Glyoxalase | 0.96 |
| PF02922 | CBM_48 | 0.96 |
| PF13578 | Methyltransf_24 | 0.96 |
| PF00400 | WD40 | 0.96 |
| PF00196 | GerE | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.88 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 1.92 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.96 |
| COG1515 | Deoxyinosine 3'-endonuclease (endonuclease V) | Replication, recombination and repair [L] | 0.96 |
| COG1656 | Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domain | General function prediction only [R] | 0.96 |
| COG1872 | Uncharacterized conserved protein YggU, UPF0235/DUF167 family | Function unknown [S] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.62 % |
| All Organisms | root | All Organisms | 40.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig105609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei | 548 | Open in IMG/M |
| 3300005162|Ga0066814_10103940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei | 535 | Open in IMG/M |
| 3300005337|Ga0070682_101438684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei | 591 | Open in IMG/M |
| 3300005338|Ga0068868_101879875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei | 567 | Open in IMG/M |
| 3300005345|Ga0070692_11333533 | Not Available | 516 | Open in IMG/M |
| 3300005564|Ga0070664_100518065 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300005564|Ga0070664_101243928 | Not Available | 703 | Open in IMG/M |
| 3300005617|Ga0068859_102602065 | Not Available | 557 | Open in IMG/M |
| 3300005764|Ga0066903_104498362 | Not Available | 744 | Open in IMG/M |
| 3300005841|Ga0068863_102199079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei | 562 | Open in IMG/M |
| 3300005921|Ga0070766_10148642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1432 | Open in IMG/M |
| 3300006028|Ga0070717_10145414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2047 | Open in IMG/M |
| 3300006046|Ga0066652_100972773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei | 807 | Open in IMG/M |
| 3300006050|Ga0075028_100916417 | Not Available | 541 | Open in IMG/M |
| 3300006059|Ga0075017_101305091 | Not Available | 570 | Open in IMG/M |
| 3300006102|Ga0075015_100555266 | Not Available | 668 | Open in IMG/M |
| 3300006175|Ga0070712_100093219 | Not Available | 2210 | Open in IMG/M |
| 3300006175|Ga0070712_100358329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1195 | Open in IMG/M |
| 3300006175|Ga0070712_100816871 | Not Available | 800 | Open in IMG/M |
| 3300006175|Ga0070712_100866427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 777 | Open in IMG/M |
| 3300006237|Ga0097621_100535543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1065 | Open in IMG/M |
| 3300006358|Ga0068871_102035765 | Not Available | 547 | Open in IMG/M |
| 3300006791|Ga0066653_10303516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 805 | Open in IMG/M |
| 3300006804|Ga0079221_10781508 | Not Available | 680 | Open in IMG/M |
| 3300006804|Ga0079221_10808048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei | 673 | Open in IMG/M |
| 3300006804|Ga0079221_11395598 | Not Available | 557 | Open in IMG/M |
| 3300006806|Ga0079220_11527606 | Not Available | 574 | Open in IMG/M |
| 3300006854|Ga0075425_100586279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1283 | Open in IMG/M |
| 3300006954|Ga0079219_10397476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 912 | Open in IMG/M |
| 3300009012|Ga0066710_103121493 | Not Available | 640 | Open in IMG/M |
| 3300009101|Ga0105247_10373375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1009 | Open in IMG/M |
| 3300009174|Ga0105241_12277485 | Not Available | 539 | Open in IMG/M |
| 3300009177|Ga0105248_10325160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1732 | Open in IMG/M |
| 3300010046|Ga0126384_11413541 | Not Available | 649 | Open in IMG/M |
| 3300010048|Ga0126373_10866398 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300010154|Ga0127503_10729681 | Not Available | 500 | Open in IMG/M |
| 3300010322|Ga0134084_10471519 | Not Available | 504 | Open in IMG/M |
| 3300010361|Ga0126378_11281113 | Not Available | 828 | Open in IMG/M |
| 3300010371|Ga0134125_11840255 | Not Available | 658 | Open in IMG/M |
| 3300010375|Ga0105239_10187648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2314 | Open in IMG/M |
| 3300010375|Ga0105239_12965717 | Not Available | 553 | Open in IMG/M |
| 3300010403|Ga0134123_10204236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1684 | Open in IMG/M |
| 3300010876|Ga0126361_10983273 | Not Available | 600 | Open in IMG/M |
| 3300011271|Ga0137393_11218808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 639 | Open in IMG/M |
| 3300012199|Ga0137383_10170752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura latina | 1593 | Open in IMG/M |
| 3300012199|Ga0137383_10212889 | Not Available | 1416 | Open in IMG/M |
| 3300012210|Ga0137378_10856709 | Not Available | 821 | Open in IMG/M |
| 3300012211|Ga0137377_11159561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 702 | Open in IMG/M |
| 3300012211|Ga0137377_11241139 | Not Available | 675 | Open in IMG/M |
| 3300012351|Ga0137386_10153014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1650 | Open in IMG/M |
| 3300012351|Ga0137386_10669221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 746 | Open in IMG/M |
| 3300012357|Ga0137384_10169055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1830 | Open in IMG/M |
| 3300012507|Ga0157342_1034076 | Not Available | 655 | Open in IMG/M |
| 3300012508|Ga0157315_1038248 | Not Available | 596 | Open in IMG/M |
| 3300012922|Ga0137394_11452204 | Not Available | 546 | Open in IMG/M |
| 3300012988|Ga0164306_11638685 | Not Available | 556 | Open in IMG/M |
| 3300013105|Ga0157369_10919885 | Not Available | 897 | Open in IMG/M |
| 3300013307|Ga0157372_10881396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1039 | Open in IMG/M |
| 3300013307|Ga0157372_11352945 | Not Available | 821 | Open in IMG/M |
| 3300013307|Ga0157372_12662059 | Not Available | 574 | Open in IMG/M |
| 3300013308|Ga0157375_12586986 | Not Available | 606 | Open in IMG/M |
| 3300014969|Ga0157376_11414180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 727 | Open in IMG/M |
| 3300015264|Ga0137403_10964372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 700 | Open in IMG/M |
| 3300016422|Ga0182039_12120046 | Not Available | 518 | Open in IMG/M |
| 3300016445|Ga0182038_10338955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1242 | Open in IMG/M |
| 3300017823|Ga0187818_10459424 | Not Available | 569 | Open in IMG/M |
| 3300017926|Ga0187807_1156257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 730 | Open in IMG/M |
| 3300017932|Ga0187814_10002380 | Not Available | 7457 | Open in IMG/M |
| 3300017932|Ga0187814_10247746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 675 | Open in IMG/M |
| 3300017932|Ga0187814_10263490 | Not Available | 655 | Open in IMG/M |
| 3300018006|Ga0187804_10259338 | Not Available | 751 | Open in IMG/M |
| 3300018042|Ga0187871_10031953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3285 | Open in IMG/M |
| 3300018086|Ga0187769_10227587 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300018433|Ga0066667_11691133 | Not Available | 567 | Open in IMG/M |
| 3300018433|Ga0066667_11695636 | Not Available | 567 | Open in IMG/M |
| 3300020581|Ga0210399_10047249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 3455 | Open in IMG/M |
| 3300021407|Ga0210383_11377091 | Not Available | 587 | Open in IMG/M |
| 3300021474|Ga0210390_11345559 | Not Available | 571 | Open in IMG/M |
| 3300021478|Ga0210402_10719700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 922 | Open in IMG/M |
| 3300021560|Ga0126371_12000530 | Not Available | 697 | Open in IMG/M |
| 3300024347|Ga0179591_1193627 | Not Available | 1912 | Open in IMG/M |
| 3300025914|Ga0207671_11290762 | Not Available | 569 | Open in IMG/M |
| 3300025915|Ga0207693_10489547 | Not Available | 960 | Open in IMG/M |
| 3300025915|Ga0207693_10646975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces yunnanensis | 821 | Open in IMG/M |
| 3300025915|Ga0207693_11089347 | Not Available | 607 | Open in IMG/M |
| 3300025916|Ga0207663_10993009 | Not Available | 673 | Open in IMG/M |
| 3300025917|Ga0207660_11254116 | Not Available | 602 | Open in IMG/M |
| 3300025928|Ga0207700_10798361 | Not Available | 844 | Open in IMG/M |
| 3300025944|Ga0207661_10901966 | Not Available | 814 | Open in IMG/M |
| 3300025945|Ga0207679_11444627 | Not Available | 631 | Open in IMG/M |
| 3300025960|Ga0207651_12018622 | Not Available | 518 | Open in IMG/M |
| 3300026118|Ga0207675_101567576 | Not Available | 679 | Open in IMG/M |
| 3300027855|Ga0209693_10417487 | Not Available | 647 | Open in IMG/M |
| 3300028047|Ga0209526_10828594 | Not Available | 570 | Open in IMG/M |
| 3300028709|Ga0307279_10072521 | Not Available | 601 | Open in IMG/M |
| 3300030054|Ga0302182_10372642 | Not Available | 599 | Open in IMG/M |
| 3300030659|Ga0316363_10313525 | Not Available | 625 | Open in IMG/M |
| 3300031090|Ga0265760_10247071 | Not Available | 617 | Open in IMG/M |
| 3300031719|Ga0306917_11060703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 632 | Open in IMG/M |
| 3300031753|Ga0307477_11127005 | Not Available | 511 | Open in IMG/M |
| 3300031797|Ga0318550_10075431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1558 | Open in IMG/M |
| 3300031797|Ga0318550_10246667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 866 | Open in IMG/M |
| 3300031954|Ga0306926_10243167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2231 | Open in IMG/M |
| 3300032261|Ga0306920_101260341 | Not Available | 1065 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.58% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.88% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.96% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.96% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.96% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0608.00005960 | 2166559005 | Simulated | IAKRRGNKIATTAISRKLLTRAYHLLADMQATDTTTPLLRP |
| Ga0066814_101039401 | 3300005162 | Soil | IAKRRGKKIATIAIARKLLTRAWHLLDQMQPAEASTPPRRP* |
| Ga0070682_1014386841 | 3300005337 | Corn Rhizosphere | AIAKRRGKKIATIAIARKLLTRAWHLLDQMQPAEAGTPPRRP* |
| Ga0068868_1018798751 | 3300005338 | Miscanthus Rhizosphere | KRRGKKIATIAIARKLLTRAWHLLNDLQAASADEPLRRP* |
| Ga0070692_113335333 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | IAKRRGKKIATIAVARKLLTRAWHLLNEMQATDTNAPLRRP* |
| Ga0070664_1005180651 | 3300005564 | Corn Rhizosphere | RGKKIATIAVARKLLTRAWHLLNEMQATDTNAPLRRP* |
| Ga0070664_1012439281 | 3300005564 | Corn Rhizosphere | RGKKIATIAIARKLLTRAWHLLDQMQPAEAGTPPRRP* |
| Ga0068859_1026020652 | 3300005617 | Switchgrass Rhizosphere | KIATIAIARKLLTRAWHLLAELQAAEASTPPRRP* |
| Ga0066903_1044983622 | 3300005764 | Tropical Forest Soil | RRGKKIATIAISRKLLTRAWHLLSQPEPAEASTPPRRP* |
| Ga0068863_1021990791 | 3300005841 | Switchgrass Rhizosphere | GKKIATIAISRKLLTRAWHLLDQMQPAGASTPLRRP* |
| Ga0070766_101486421 | 3300005921 | Soil | AQRRGKKIATIAIARKLLTRAYHLLAGLQATSTNEPPRRP* |
| Ga0070717_101454143 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IAKRRGKKIATIAIARKLLTRAWHLLNDLQAASADEPLRRP* |
| Ga0066652_1009727731 | 3300006046 | Soil | KKIATIAIARKLLTRAWHLLAGMQATSTNEPPRRP* |
| Ga0075028_1009164171 | 3300006050 | Watersheds | KKIATIAISRKLLTRAYHLLADMQATDASAPLQRP* |
| Ga0075017_1013050912 | 3300006059 | Watersheds | RRGKKIATIAISRKLLTRAYHLLADMQATDTTTPLWRP* |
| Ga0075015_1005552661 | 3300006102 | Watersheds | KRRGKKIATIAIARKLLTRAWHLLAEMQATDASAPPRRP* |
| Ga0070712_1000932191 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RGKKIATIAIARKLLTRAYHLLAEMQAAEETTPPRRM* |
| Ga0070712_1003583292 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RRGKKIATIAISRKLLTRAWHLLNQMQATAAATPPRP* |
| Ga0070712_1008168712 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RRGKKIATIAIARKLLTRAWHLLADMQAASMNEPPRRP* |
| Ga0070712_1008664272 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RRGKKIATIAIARKLLTRAYHLLAETPAPGATTPLQRP* |
| Ga0097621_1005355431 | 3300006237 | Miscanthus Rhizosphere | KKIATIAIARKLLTRAWHLLSDMQAAGPATPPRP* |
| Ga0068871_1020357652 | 3300006358 | Miscanthus Rhizosphere | RRGKKIATIAISRKLLTRAWHLLADMQATSTNEPPRRP* |
| Ga0066653_103035161 | 3300006791 | Soil | RRGKKIATIAISCKLLTRAWHLLAEIQAADASTPPRRP* |
| Ga0079221_107815081 | 3300006804 | Agricultural Soil | RRGKKIATIAVARKLLTRAWHLLTEMQAADGTPPRRP* |
| Ga0079221_108080481 | 3300006804 | Agricultural Soil | RGKKIATIAISRKLLTRAWHLLNDLQATNAATPPRRP* |
| Ga0079221_113955982 | 3300006804 | Agricultural Soil | RGKKIATIAIARKLLTRAWHLLADMQATGPATPPRP* |
| Ga0079220_115276061 | 3300006806 | Agricultural Soil | RRGKKIATIAIARKLLTRAWHLLAEMPATGTTTPPRRP* |
| Ga0075425_1005862793 | 3300006854 | Populus Rhizosphere | IAKRRGKKIATIAISRKLLTRAWHLLSEMQDTDTTTTPPRRP* |
| Ga0079219_103974761 | 3300006954 | Agricultural Soil | IARRRGKKIATIAISRKLLTRAWHLLAGMQATGPAAPPRP* |
| Ga0066710_1031214932 | 3300009012 | Grasslands Soil | QKIATIAIARKLLTRAWHLLDQMERADAGTPPERP |
| Ga0105247_103733751 | 3300009101 | Switchgrass Rhizosphere | RRGKKIATIAISRKLLTRAWHLLAGMQATSTNEPPRRP* |
| Ga0105241_122774851 | 3300009174 | Corn Rhizosphere | KRRGKKIATIAISRKLLTRAYHLLAEMQATRTNAPPQRP* |
| Ga0105248_103251601 | 3300009177 | Switchgrass Rhizosphere | IAQRRGKKIATIAVARKLLTRAWHLLNEMQATDTNAPLRRP* |
| Ga0126384_114135411 | 3300010046 | Tropical Forest Soil | KKIATIAIARKLLTRAWHLLAGLQAAAGPDAPPRP* |
| Ga0126373_108663981 | 3300010048 | Tropical Forest Soil | KRRGKKIATIAISRKLLTRAWHLLAGMQDIDATTPPRRS* |
| Ga0127503_107296811 | 3300010154 | Soil | KIATIAVARKLLTRAWHLLAELQAADASTPPRRP* |
| Ga0134084_104715191 | 3300010322 | Grasslands Soil | AKRRGKKIATIAVSRKLLTRAWHLLSEMQAADASTPPRRP* |
| Ga0126378_112811131 | 3300010361 | Tropical Forest Soil | GKKIATIAIARKLLTRAWHLLSEMPAAEASTPPGRP* |
| Ga0134125_118402551 | 3300010371 | Terrestrial Soil | KKIATIAISRKLLTRAWHLLNQMQATSTNEPPQRP* |
| Ga0105239_101876483 | 3300010375 | Corn Rhizosphere | AIAKRRGKKIATIAISRKLLTRAWHLLAGMQATSTNEPPRRP* |
| Ga0105239_129657171 | 3300010375 | Corn Rhizosphere | GKKIATIAIARKLLTRAWHLLAEMPATDATTPPRRP* |
| Ga0134123_102042361 | 3300010403 | Terrestrial Soil | KKIATIAISRKLLTRAWHLLNDLQATDAATPPRRP* |
| Ga0126361_109832732 | 3300010876 | Boreal Forest Soil | AKRRGKKIATIAISRKLLTRAYHLLADMQAADANAPLWRP* |
| Ga0137393_112188081 | 3300011271 | Vadose Zone Soil | RRGKKIATIAIARKLLTRAWHLLAELQAADASTPPRRP* |
| Ga0137383_101707521 | 3300012199 | Vadose Zone Soil | RRGKKIATIAIARKLLTRAWHLLNEMQATNASTQLRRP* |
| Ga0137383_102128892 | 3300012199 | Vadose Zone Soil | RRGKKIATIAIARKLLTRAWHLLSDMQATGPATPPRP* |
| Ga0137378_108567091 | 3300012210 | Vadose Zone Soil | GKKIATIAIARKLLTRAWHLLSDMQATGPATPPRP* |
| Ga0137377_111595611 | 3300012211 | Vadose Zone Soil | KKIATIAISRKLLTRAYHLLADLQATSTNEPLRRP* |
| Ga0137377_112411391 | 3300012211 | Vadose Zone Soil | RGKKIATIAIARKLLTRAWHLLNEMQATNASTQLRRP* |
| Ga0137386_101530141 | 3300012351 | Vadose Zone Soil | KIATITISRKLLTRAWPLLAEMQPAGTSTPPRRP* |
| Ga0137386_106692211 | 3300012351 | Vadose Zone Soil | RRGKKIATIAIARKLLTRAWHLLNEMQATGPATPPRRP* |
| Ga0137384_101690552 | 3300012357 | Vadose Zone Soil | AAIAKRRGKKIATIAIARKLLTRAWHLLSDMQATGPATPPRP* |
| Ga0157342_10340761 | 3300012507 | Arabidopsis Rhizosphere | KKIATIAIARKLLTRAWHLLNDLQAADAATPPRRP* |
| Ga0157315_10382482 | 3300012508 | Arabidopsis Rhizosphere | AAISKRRGKKIATIAIARKLLTRAWHLLDQMQPAEAGTPPRRP* |
| Ga0137394_114522041 | 3300012922 | Vadose Zone Soil | SAIAKRRGKKIATIAISRKLLTRAWHLLADMQATNTNEPPRRP* |
| Ga0164306_116386851 | 3300012988 | Soil | GKKIATIAISRKLLTRAWHLLSEMQAAEAGTPPRRP* |
| Ga0157369_109198851 | 3300013105 | Corn Rhizosphere | RGKKIATIAIARKLLTRAWHLLSEMQAADASTPLRRP* |
| Ga0157372_108813961 | 3300013307 | Corn Rhizosphere | KRRGKKIATIAVARKLLTRAWHLLSEMQDTDTTTTPPRRP* |
| Ga0157372_113529451 | 3300013307 | Corn Rhizosphere | KRRGKKIATIAISRKLLTRAWHLLDQMQPAGASTPLRRP* |
| Ga0157372_126620591 | 3300013307 | Corn Rhizosphere | RGKKIATIAIARKLLTRAWHLLAEMPATDATTPPRRP* |
| Ga0157375_125869861 | 3300013308 | Miscanthus Rhizosphere | RGKKIATIAIARKLLTRAWHLLSDMQAAGPATPPRP* |
| Ga0157376_114141801 | 3300014969 | Miscanthus Rhizosphere | AIAGRRGKKIATIAIARKLLTRGWHLLNDMQAADAATPLRRP* |
| Ga0137403_109643721 | 3300015264 | Vadose Zone Soil | AAIAKRRGKKIATIAISRKLLTRAYHLLADLQATSTNEPLRRP* |
| Ga0182039_121200461 | 3300016422 | Soil | KKIATIAIARKLLTRAWHLLSEMEPADASTPLRRP |
| Ga0182038_103389553 | 3300016445 | Soil | ATIAQRRGKKIATIAISRKLLTRAWHLLSQLEPADASTPPRRP |
| Ga0187818_104594241 | 3300017823 | Freshwater Sediment | KRRGKKIATIAIARKLVTRAWHLLSEMEPGEASAPLRRP |
| Ga0187807_11562571 | 3300017926 | Freshwater Sediment | NIAKRRGKKIATIAIARKLLTRAYHLLADMQATGTTTPLRRP |
| Ga0187814_100023801 | 3300017932 | Freshwater Sediment | GKKIATIAISRKLLTRAWHLLSEMQAAEAGMPPRRP |
| Ga0187814_102477462 | 3300017932 | Freshwater Sediment | YSSIAKRRGKKIATIAIARKLLTRACHLLAGMPATGTTTPPRRP |
| Ga0187814_102634901 | 3300017932 | Freshwater Sediment | KRRGKKIATIAIARKLLTRAWHLLAEMETAEASTPLRRP |
| Ga0187804_102593381 | 3300018006 | Freshwater Sediment | RRGKKIATIAIARKLLTRAWHLLAEMETAEASTPLRRP |
| Ga0187871_100319534 | 3300018042 | Peatland | RGKKIATIAIARKLLTRAYHLLADMQATGTTTPLQQP |
| Ga0187769_102275873 | 3300018086 | Tropical Peatland | AIAKRRGKKIATIAVARKLLTRAWHLLSDMQATGPATPPRP |
| Ga0066667_116911331 | 3300018433 | Grasslands Soil | RGKKIATIAISRKLLTRAYHLLADMQATDTTTPLRRP |
| Ga0066667_116956361 | 3300018433 | Grasslands Soil | IAKRRGKKIATIAIARKLLTRAWHLLHDLQAAGASAPPPRP |
| Ga0210399_100472497 | 3300020581 | Soil | KKIAAIAIARKLLTRAWHLLADMQATDTTTPLLRP |
| Ga0210383_113770912 | 3300021407 | Soil | HRQRRGQKIATIAIARKLLTRAWHLLSEMQAADASAAPRRP |
| Ga0210390_113455591 | 3300021474 | Soil | KRRGKKIATIAVSRKLLTRAWHLLSEMQAADASAPPRQP |
| Ga0210402_107197002 | 3300021478 | Soil | GNKIATIAISRKLLTRAWHLLAEMQATSANDPPRP |
| Ga0126371_120005302 | 3300021560 | Tropical Forest Soil | RAAIAKRRGKKIATIAIAGELMTRAWHLLAEPADASTLSRRP |
| Ga0179591_11936271 | 3300024347 | Vadose Zone Soil | GKKIATIAISRKLLTRSWHLLADMQATSTNEPPRRP |
| Ga0207671_112907621 | 3300025914 | Corn Rhizosphere | RRGKKIATIAVARKLLTRAWHLLNEMQATDTNAPLRRP |
| Ga0207693_104895471 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | HIAKRRGTKIATIAISRKLLTRAWHLLSEMQAADASTPSRRP |
| Ga0207693_106469751 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RGKKIATIAIARKLLTRAYHLLAEMQAAEETTPPRRM |
| Ga0207693_110893472 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | YAAISKRRGKKIATIAIARKLLTRAWHLLDQMQPAEAGTPPRRP |
| Ga0207663_109930091 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RRGRKIATIAIARKLLTRAWHLLASMQADGTATPPQRP |
| Ga0207660_112541161 | 3300025917 | Corn Rhizosphere | SGIAKRRGKKIATIAISRKLLTRAWHLLSEMQAAGADEPPRRS |
| Ga0207700_107983613 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RRGKKIATIAIARKLLTRGWHLLNDMQAADAATPLRRP |
| Ga0207661_109019661 | 3300025944 | Corn Rhizosphere | AAIAKRRGKKIATIAVARKLLTRAWHLLNEMQATDTNAPLRRP |
| Ga0207679_114446272 | 3300025945 | Corn Rhizosphere | RRGKKIATIAIARKLLTRAWHLLDQMQPAEAGTPPRRP |
| Ga0207651_120186221 | 3300025960 | Switchgrass Rhizosphere | KRRGKKIATIAISRKLLARAWHLLSEMQAAGADEPPRRS |
| Ga0207675_1015675761 | 3300026118 | Switchgrass Rhizosphere | IAKRRGKKIATIAVARKLLTRAWHLLNEMQATDTNAPLRRP |
| Ga0209693_104174871 | 3300027855 | Soil | RGKKIATIAIARKLLTRAWHLLSEMQAADASAAPRRP |
| Ga0209526_108285941 | 3300028047 | Forest Soil | IAKRRGKKIATIAISRKLLTRAYHLLADMQATGTTTPLRRP |
| Ga0307279_100725211 | 3300028709 | Soil | YSAIAKRRGKKIATIAISRKLLTRAWHLLADMQATSTNEPPRRP |
| Ga0302182_103726422 | 3300030054 | Palsa | RGKKIATIAISRKLLTRAWHLLAGMQATTGTATPPQRRP |
| Ga0316363_103135251 | 3300030659 | Peatlands Soil | IAKRRGKKIATIAIARKLLTRAWHLLADMQATDASAPLRRP |
| Ga0265760_102470711 | 3300031090 | Soil | RRGKKIATIAISRKLLTRAWHLLSEIQAADASTPPRRP |
| Ga0306917_110607031 | 3300031719 | Soil | GQPGERRRLARRRGKKIATIAIARKLVTRAWHLLSEMEPPEASTPLRRP |
| Ga0307477_111270052 | 3300031753 | Hardwood Forest Soil | KKIATIAIARKLLTRAWHLLSEMETAEASAPPRRP |
| Ga0318550_100754311 | 3300031797 | Soil | KKIATIAISRKLLTRAWHLLSQLEPAEASTPPRRP |
| Ga0318550_102466672 | 3300031797 | Soil | YAAIAKRRGKKIATIAVARKLLTRAWHLLDQMQAADAGAPPRP |
| Ga0306926_102431671 | 3300031954 | Soil | AKRRGKKIATIAIARKLLTRAWHLLNEMQAAGASTPPRRP |
| Ga0306920_1012603411 | 3300032261 | Soil | AAIANRRGKKIATIAIARKLVTRAWHLLSEMQAADVGAPSRRP |
| ⦗Top⦘ |