Metagenome / Metatranscriptome Family F097829

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F097829
Family Type	Metagenome / Metatranscriptome
Number of Sequences	104
Average Sequence Length	39 residues
Representative Sequence	KRRGKKIATIAIARKLLTRAWHLLAEMQATDASAPPRRP
Number of Associated Samples	86
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	93.27 %
Associated GOLD sequencing projects	83
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (59.615 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.539 % of family members)
Environment Ontology (ENVO)	Unclassified (35.577 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (49.038 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 44.78% β-sheet: 0.00% Coil/Unstructured: 55.22%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.49
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF02371	Transposase_20	1.92
PF13006	Nterm_IS4	1.92
PF01348	Intron_maturas2	1.92
PF03050	DDE_Tnp_IS66	1.92
PF07366	SnoaL	0.96
PF00884	Sulfatase	0.96
PF14765	PS-DH	0.96
PF01548	DEDD_Tnp_IS110	0.96
PF08044	DUF1707	0.96
PF00933	Glyco_hydro_3	0.96
PF12681	Glyoxalase_2	0.96
PF02594	DUF167	0.96
PF12728	HTH_17	0.96
PF04493	Endonuclease_5	0.96
PF01927	Mut7-C	0.96
PF00903	Glyoxalase	0.96
PF02922	CBM_48	0.96
PF13578	Methyltransf_24	0.96
PF00400	WD40	0.96
PF00196	GerE	0.96

COG ID	Name	Functional Category	% Frequency in 104 Family Scaffolds
COG3547	Transposase	Mobilome: prophages, transposons [X]	2.88
COG3436	Transposase	Mobilome: prophages, transposons [X]	1.92
COG1472	Periplasmic beta-glucosidase and related glycosidases	Carbohydrate transport and metabolism [G]	0.96
COG1515	Deoxyinosine 3'-endonuclease (endonuclease V)	Replication, recombination and repair [L]	0.96
COG1656	Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domain	General function prediction only [R]	0.96
COG1872	Uncharacterized conserved protein YggU, UPF0235/DUF167 family	Function unknown [S]	0.96

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.62 %
All Organisms	root	All Organisms	40.38 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.62 %
cellular organisms	root	All Organisms → cellular organisms	40.38 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.62 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	40.38 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.62 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	37.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.62 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	29.81 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.62 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	25.00 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	1.92 %
Rubrobacteria	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.62 %
Streptomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales	10.58 %
Streptosporangiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	2.88 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2.88 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.92 %
Rubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales	0.96 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.62 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	10.58 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2.88 %
Treboniaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae	1.92 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.92 %
Thermomonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae	0.96 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.96 %
Rubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.62 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	9.62 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2.88 %
Trebonia	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia	1.92 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.92 %
Actinomadura	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura	0.96 %
unclassified Rubrobacteraceae	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae	0.96 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.62 %
Streptomyces scabiei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei	6.73 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2.88 %
Trebonia kvetii	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii	1.92 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.92 %
Rubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium	0.96 %
Actinomadura latina	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura latina	0.96 %
Streptomyces yunnanensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces yunnanensis	0.96 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2166559005\|cont_contig105609	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei	548	Open in IMG/M
3300005162\|Ga0066814_10103940	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei	535	Open in IMG/M
3300005337\|Ga0070682_101438684	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei	591	Open in IMG/M
3300005338\|Ga0068868_101879875	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei	567	Open in IMG/M
3300005345\|Ga0070692_11333533	Not Available	516	Open in IMG/M
3300005564\|Ga0070664_100518065	All Organisms → cellular organisms → Bacteria	1100	Open in IMG/M
3300005564\|Ga0070664_101243928	Not Available	703	Open in IMG/M
3300005617\|Ga0068859_102602065	Not Available	557	Open in IMG/M
3300005764\|Ga0066903_104498362	Not Available	744	Open in IMG/M
3300005841\|Ga0068863_102199079	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei	562	Open in IMG/M
3300005921\|Ga0070766_10148642	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	1432	Open in IMG/M
3300006028\|Ga0070717_10145414	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2047	Open in IMG/M
3300006046\|Ga0066652_100972773	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei	807	Open in IMG/M
3300006050\|Ga0075028_100916417	Not Available	541	Open in IMG/M
3300006059\|Ga0075017_101305091	Not Available	570	Open in IMG/M
3300006102\|Ga0075015_100555266	Not Available	668	Open in IMG/M
3300006175\|Ga0070712_100093219	Not Available	2210	Open in IMG/M
3300006175\|Ga0070712_100358329	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1195	Open in IMG/M
3300006175\|Ga0070712_100816871	Not Available	800	Open in IMG/M
3300006175\|Ga0070712_100866427	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	777	Open in IMG/M
3300006237\|Ga0097621_100535543	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1065	Open in IMG/M
3300006358\|Ga0068871_102035765	Not Available	547	Open in IMG/M
3300006791\|Ga0066653_10303516	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	805	Open in IMG/M
3300006804\|Ga0079221_10781508	Not Available	680	Open in IMG/M
3300006804\|Ga0079221_10808048	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei	673	Open in IMG/M
3300006804\|Ga0079221_11395598	Not Available	557	Open in IMG/M
3300006806\|Ga0079220_11527606	Not Available	574	Open in IMG/M
3300006854\|Ga0075425_100586279	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1283	Open in IMG/M
3300006954\|Ga0079219_10397476	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	912	Open in IMG/M
3300009012\|Ga0066710_103121493	Not Available	640	Open in IMG/M
3300009101\|Ga0105247_10373375	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1009	Open in IMG/M
3300009174\|Ga0105241_12277485	Not Available	539	Open in IMG/M
3300009177\|Ga0105248_10325160	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1732	Open in IMG/M
3300010046\|Ga0126384_11413541	Not Available	649	Open in IMG/M
3300010048\|Ga0126373_10866398	All Organisms → cellular organisms → Bacteria	967	Open in IMG/M
3300010154\|Ga0127503_10729681	Not Available	500	Open in IMG/M
3300010322\|Ga0134084_10471519	Not Available	504	Open in IMG/M
3300010361\|Ga0126378_11281113	Not Available	828	Open in IMG/M
3300010371\|Ga0134125_11840255	Not Available	658	Open in IMG/M
3300010375\|Ga0105239_10187648	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2314	Open in IMG/M
3300010375\|Ga0105239_12965717	Not Available	553	Open in IMG/M
3300010403\|Ga0134123_10204236	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1684	Open in IMG/M
3300010876\|Ga0126361_10983273	Not Available	600	Open in IMG/M
3300011271\|Ga0137393_11218808	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	639	Open in IMG/M
3300012199\|Ga0137383_10170752	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura latina	1593	Open in IMG/M
3300012199\|Ga0137383_10212889	Not Available	1416	Open in IMG/M
3300012210\|Ga0137378_10856709	Not Available	821	Open in IMG/M
3300012211\|Ga0137377_11159561	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	702	Open in IMG/M
3300012211\|Ga0137377_11241139	Not Available	675	Open in IMG/M
3300012351\|Ga0137386_10153014	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1650	Open in IMG/M
3300012351\|Ga0137386_10669221	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii	746	Open in IMG/M
3300012357\|Ga0137384_10169055	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1830	Open in IMG/M
3300012507\|Ga0157342_1034076	Not Available	655	Open in IMG/M
3300012508\|Ga0157315_1038248	Not Available	596	Open in IMG/M
3300012922\|Ga0137394_11452204	Not Available	546	Open in IMG/M
3300012988\|Ga0164306_11638685	Not Available	556	Open in IMG/M
3300013105\|Ga0157369_10919885	Not Available	897	Open in IMG/M
3300013307\|Ga0157372_10881396	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	1039	Open in IMG/M
3300013307\|Ga0157372_11352945	Not Available	821	Open in IMG/M
3300013307\|Ga0157372_12662059	Not Available	574	Open in IMG/M
3300013308\|Ga0157375_12586986	Not Available	606	Open in IMG/M
3300014969\|Ga0157376_11414180	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii	727	Open in IMG/M
3300015264\|Ga0137403_10964372	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	700	Open in IMG/M
3300016422\|Ga0182039_12120046	Not Available	518	Open in IMG/M
3300016445\|Ga0182038_10338955	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1242	Open in IMG/M
3300017823\|Ga0187818_10459424	Not Available	569	Open in IMG/M
3300017926\|Ga0187807_1156257	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	730	Open in IMG/M
3300017932\|Ga0187814_10002380	Not Available	7457	Open in IMG/M
3300017932\|Ga0187814_10247746	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	675	Open in IMG/M
3300017932\|Ga0187814_10263490	Not Available	655	Open in IMG/M
3300018006\|Ga0187804_10259338	Not Available	751	Open in IMG/M
3300018042\|Ga0187871_10031953	All Organisms → cellular organisms → Bacteria → Terrabacteria group	3285	Open in IMG/M
3300018086\|Ga0187769_10227587	All Organisms → cellular organisms → Bacteria	1384	Open in IMG/M
3300018433\|Ga0066667_11691133	Not Available	567	Open in IMG/M
3300018433\|Ga0066667_11695636	Not Available	567	Open in IMG/M
3300020581\|Ga0210399_10047249	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium	3455	Open in IMG/M
3300021407\|Ga0210383_11377091	Not Available	587	Open in IMG/M
3300021474\|Ga0210390_11345559	Not Available	571	Open in IMG/M
3300021478\|Ga0210402_10719700	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	922	Open in IMG/M
3300021560\|Ga0126371_12000530	Not Available	697	Open in IMG/M
3300024347\|Ga0179591_1193627	Not Available	1912	Open in IMG/M
3300025914\|Ga0207671_11290762	Not Available	569	Open in IMG/M
3300025915\|Ga0207693_10489547	Not Available	960	Open in IMG/M
3300025915\|Ga0207693_10646975	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces yunnanensis	821	Open in IMG/M
3300025915\|Ga0207693_11089347	Not Available	607	Open in IMG/M
3300025916\|Ga0207663_10993009	Not Available	673	Open in IMG/M
3300025917\|Ga0207660_11254116	Not Available	602	Open in IMG/M
3300025928\|Ga0207700_10798361	Not Available	844	Open in IMG/M
3300025944\|Ga0207661_10901966	Not Available	814	Open in IMG/M
3300025945\|Ga0207679_11444627	Not Available	631	Open in IMG/M
3300025960\|Ga0207651_12018622	Not Available	518	Open in IMG/M
3300026118\|Ga0207675_101567576	Not Available	679	Open in IMG/M
3300027855\|Ga0209693_10417487	Not Available	647	Open in IMG/M
3300028047\|Ga0209526_10828594	Not Available	570	Open in IMG/M
3300028709\|Ga0307279_10072521	Not Available	601	Open in IMG/M
3300030054\|Ga0302182_10372642	Not Available	599	Open in IMG/M
3300030659\|Ga0316363_10313525	Not Available	625	Open in IMG/M
3300031090\|Ga0265760_10247071	Not Available	617	Open in IMG/M
3300031719\|Ga0306917_11060703	All Organisms → cellular organisms → Bacteria → Terrabacteria group	632	Open in IMG/M
3300031753\|Ga0307477_11127005	Not Available	511	Open in IMG/M
3300031797\|Ga0318550_10075431	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1558	Open in IMG/M
3300031797\|Ga0318550_10246667	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	866	Open in IMG/M
3300031954\|Ga0306926_10243167	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2231	Open in IMG/M
3300032261\|Ga0306920_101260341	Not Available	1065	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	75.00%
Host-Associated	Host-Associated	24.04%
Engineered	Engineered	0.96%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	64.42%
Plants	Host-Associated → Plants	24.04%
Aquatic	Environmental → Aquatic	10.58%
Modeled	Engineered → Modeled	0.96%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	63.46%
Rhizosphere	Host-Associated → Plants → Rhizosphere	16.35%
Freshwater	Environmental → Aquatic → Freshwater	7.69%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.77%
Sediment	Environmental → Aquatic → Sediment	2.88%
Roots	Host-Associated → Plants → Roots	1.92%
Peat	Environmental → Terrestrial → Peat	0.96%
Simulated Communities (Sequence Read Mixture)	Engineered → Modeled → Simulated Communities (Sequence Read Mixture)	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	45.19%
Loam	Environmental → Terrestrial → Soil → Loam	17.31%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	12.50%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	6.73%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.77%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.85%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.88%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.92%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.96%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.96%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.96%
Unclassified	Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	24.04%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	13.46%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	12.50%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	11.54%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	5.77%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.77%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.81%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.81%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.85%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.88%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.92%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.96%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.96%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.96%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.96%
Unclassified	Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	11.54%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	10.58%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	5.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.77%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	4.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.81%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	3.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	3.85%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	2.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.88%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.88%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.88%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.88%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.88%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.92%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.92%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	1.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.92%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.92%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.96%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.96%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.96%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	0.96%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.96%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.96%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.96%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.96%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.96%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.96%
Simulated	Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated	0.96%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.96%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2166559005	Simulated microbial communities from Lyon, France	Engineered	Open in IMG/M
3300005162	Soil and rhizosphere microbial communities from Laval, Canada - mgLAB	Environmental	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005921	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6	Environmental	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental	Open in IMG/M
3300006102	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010154	Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300010876	Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012507	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610	Host-Associated	Open in IMG/M
3300012508	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510	Host-Associated	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015264	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300017823	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3	Environmental	Open in IMG/M
3300017926	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2	Environmental	Open in IMG/M
3300017932	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4	Environmental	Open in IMG/M
3300018006	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4	Environmental	Open in IMG/M
3300018042	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10	Environmental	Open in IMG/M
3300018086	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental	Open in IMG/M
3300021407	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O	Environmental	Open in IMG/M
3300021474	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300024347	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027855	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)	Environmental	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300028709	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118	Environmental	Open in IMG/M
3300030054	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1	Environmental	Open in IMG/M
3300030659	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)	Environmental	Open in IMG/M
3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental	Open in IMG/M
3300031753	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515	Environmental	Open in IMG/M
3300031797	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
cont_0608.00005960	2166559005	Simulated	IAKRRGNKIATTAISRKLLTRAYHLLADMQATDTTTPLLRP
Ga0066814_101039401	3300005162	Soil	IAKRRGKKIATIAIARKLLTRAWHLLDQMQPAEASTPPRRP*
Ga0070682_1014386841	3300005337	Corn Rhizosphere	AIAKRRGKKIATIAIARKLLTRAWHLLDQMQPAEAGTPPRRP*
Ga0068868_1018798751	3300005338	Miscanthus Rhizosphere	KRRGKKIATIAIARKLLTRAWHLLNDLQAASADEPLRRP*
Ga0070692_113335333	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	IAKRRGKKIATIAVARKLLTRAWHLLNEMQATDTNAPLRRP*
Ga0070664_1005180651	3300005564	Corn Rhizosphere	RGKKIATIAVARKLLTRAWHLLNEMQATDTNAPLRRP*
Ga0070664_1012439281	3300005564	Corn Rhizosphere	RGKKIATIAIARKLLTRAWHLLDQMQPAEAGTPPRRP*
Ga0068859_1026020652	3300005617	Switchgrass Rhizosphere	KIATIAIARKLLTRAWHLLAELQAAEASTPPRRP*
Ga0066903_1044983622	3300005764	Tropical Forest Soil	RRGKKIATIAISRKLLTRAWHLLSQPEPAEASTPPRRP*
Ga0068863_1021990791	3300005841	Switchgrass Rhizosphere	GKKIATIAISRKLLTRAWHLLDQMQPAGASTPLRRP*
Ga0070766_101486421	3300005921	Soil	AQRRGKKIATIAIARKLLTRAYHLLAGLQATSTNEPPRRP*
Ga0070717_101454143	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	IAKRRGKKIATIAIARKLLTRAWHLLNDLQAASADEPLRRP*
Ga0066652_1009727731	3300006046	Soil	KKIATIAIARKLLTRAWHLLAGMQATSTNEPPRRP*
Ga0075028_1009164171	3300006050	Watersheds	KKIATIAISRKLLTRAYHLLADMQATDASAPLQRP*
Ga0075017_1013050912	3300006059	Watersheds	RRGKKIATIAISRKLLTRAYHLLADMQATDTTTPLWRP*
Ga0075015_1005552661	3300006102	Watersheds	KRRGKKIATIAIARKLLTRAWHLLAEMQATDASAPPRRP*
Ga0070712_1000932191	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	RGKKIATIAIARKLLTRAYHLLAEMQAAEETTPPRRM*
Ga0070712_1003583292	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	RRGKKIATIAISRKLLTRAWHLLNQMQATAAATPPRP*
Ga0070712_1008168712	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	RRGKKIATIAIARKLLTRAWHLLADMQAASMNEPPRRP*
Ga0070712_1008664272	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	RRGKKIATIAIARKLLTRAYHLLAETPAPGATTPLQRP*
Ga0097621_1005355431	3300006237	Miscanthus Rhizosphere	KKIATIAIARKLLTRAWHLLSDMQAAGPATPPRP*
Ga0068871_1020357652	3300006358	Miscanthus Rhizosphere	RRGKKIATIAISRKLLTRAWHLLADMQATSTNEPPRRP*
Ga0066653_103035161	3300006791	Soil	RRGKKIATIAISCKLLTRAWHLLAEIQAADASTPPRRP*
Ga0079221_107815081	3300006804	Agricultural Soil	RRGKKIATIAVARKLLTRAWHLLTEMQAADGTPPRRP*
Ga0079221_108080481	3300006804	Agricultural Soil	RGKKIATIAISRKLLTRAWHLLNDLQATNAATPPRRP*
Ga0079221_113955982	3300006804	Agricultural Soil	RGKKIATIAIARKLLTRAWHLLADMQATGPATPPRP*
Ga0079220_115276061	3300006806	Agricultural Soil	RRGKKIATIAIARKLLTRAWHLLAEMPATGTTTPPRRP*
Ga0075425_1005862793	3300006854	Populus Rhizosphere	IAKRRGKKIATIAISRKLLTRAWHLLSEMQDTDTTTTPPRRP*
Ga0079219_103974761	3300006954	Agricultural Soil	IARRRGKKIATIAISRKLLTRAWHLLAGMQATGPAAPPRP*
Ga0066710_1031214932	3300009012	Grasslands Soil	QKIATIAIARKLLTRAWHLLDQMERADAGTPPERP
Ga0105247_103733751	3300009101	Switchgrass Rhizosphere	RRGKKIATIAISRKLLTRAWHLLAGMQATSTNEPPRRP*
Ga0105241_122774851	3300009174	Corn Rhizosphere	KRRGKKIATIAISRKLLTRAYHLLAEMQATRTNAPPQRP*
Ga0105248_103251601	3300009177	Switchgrass Rhizosphere	IAQRRGKKIATIAVARKLLTRAWHLLNEMQATDTNAPLRRP*
Ga0126384_114135411	3300010046	Tropical Forest Soil	KKIATIAIARKLLTRAWHLLAGLQAAAGPDAPPRP*
Ga0126373_108663981	3300010048	Tropical Forest Soil	KRRGKKIATIAISRKLLTRAWHLLAGMQDIDATTPPRRS*
Ga0127503_107296811	3300010154	Soil	KIATIAVARKLLTRAWHLLAELQAADASTPPRRP*
Ga0134084_104715191	3300010322	Grasslands Soil	AKRRGKKIATIAVSRKLLTRAWHLLSEMQAADASTPPRRP*
Ga0126378_112811131	3300010361	Tropical Forest Soil	GKKIATIAIARKLLTRAWHLLSEMPAAEASTPPGRP*
Ga0134125_118402551	3300010371	Terrestrial Soil	KKIATIAISRKLLTRAWHLLNQMQATSTNEPPQRP*
Ga0105239_101876483	3300010375	Corn Rhizosphere	AIAKRRGKKIATIAISRKLLTRAWHLLAGMQATSTNEPPRRP*
Ga0105239_129657171	3300010375	Corn Rhizosphere	GKKIATIAIARKLLTRAWHLLAEMPATDATTPPRRP*
Ga0134123_102042361	3300010403	Terrestrial Soil	KKIATIAISRKLLTRAWHLLNDLQATDAATPPRRP*
Ga0126361_109832732	3300010876	Boreal Forest Soil	AKRRGKKIATIAISRKLLTRAYHLLADMQAADANAPLWRP*
Ga0137393_112188081	3300011271	Vadose Zone Soil	RRGKKIATIAIARKLLTRAWHLLAELQAADASTPPRRP*
Ga0137383_101707521	3300012199	Vadose Zone Soil	RRGKKIATIAIARKLLTRAWHLLNEMQATNASTQLRRP*
Ga0137383_102128892	3300012199	Vadose Zone Soil	RRGKKIATIAIARKLLTRAWHLLSDMQATGPATPPRP*
Ga0137378_108567091	3300012210	Vadose Zone Soil	GKKIATIAIARKLLTRAWHLLSDMQATGPATPPRP*
Ga0137377_111595611	3300012211	Vadose Zone Soil	KKIATIAISRKLLTRAYHLLADLQATSTNEPLRRP*
Ga0137377_112411391	3300012211	Vadose Zone Soil	RGKKIATIAIARKLLTRAWHLLNEMQATNASTQLRRP*
Ga0137386_101530141	3300012351	Vadose Zone Soil	KIATITISRKLLTRAWPLLAEMQPAGTSTPPRRP*
Ga0137386_106692211	3300012351	Vadose Zone Soil	RRGKKIATIAIARKLLTRAWHLLNEMQATGPATPPRRP*
Ga0137384_101690552	3300012357	Vadose Zone Soil	AAIAKRRGKKIATIAIARKLLTRAWHLLSDMQATGPATPPRP*
Ga0157342_10340761	3300012507	Arabidopsis Rhizosphere	KKIATIAIARKLLTRAWHLLNDLQAADAATPPRRP*
Ga0157315_10382482	3300012508	Arabidopsis Rhizosphere	AAISKRRGKKIATIAIARKLLTRAWHLLDQMQPAEAGTPPRRP*
Ga0137394_114522041	3300012922	Vadose Zone Soil	SAIAKRRGKKIATIAISRKLLTRAWHLLADMQATNTNEPPRRP*
Ga0164306_116386851	3300012988	Soil	GKKIATIAISRKLLTRAWHLLSEMQAAEAGTPPRRP*
Ga0157369_109198851	3300013105	Corn Rhizosphere	RGKKIATIAIARKLLTRAWHLLSEMQAADASTPLRRP*
Ga0157372_108813961	3300013307	Corn Rhizosphere	KRRGKKIATIAVARKLLTRAWHLLSEMQDTDTTTTPPRRP*
Ga0157372_113529451	3300013307	Corn Rhizosphere	KRRGKKIATIAISRKLLTRAWHLLDQMQPAGASTPLRRP*
Ga0157372_126620591	3300013307	Corn Rhizosphere	RGKKIATIAIARKLLTRAWHLLAEMPATDATTPPRRP*
Ga0157375_125869861	3300013308	Miscanthus Rhizosphere	RGKKIATIAIARKLLTRAWHLLSDMQAAGPATPPRP*
Ga0157376_114141801	3300014969	Miscanthus Rhizosphere	AIAGRRGKKIATIAIARKLLTRGWHLLNDMQAADAATPLRRP*
Ga0137403_109643721	3300015264	Vadose Zone Soil	AAIAKRRGKKIATIAISRKLLTRAYHLLADLQATSTNEPLRRP*
Ga0182039_121200461	3300016422	Soil	KKIATIAIARKLLTRAWHLLSEMEPADASTPLRRP
Ga0182038_103389553	3300016445	Soil	ATIAQRRGKKIATIAISRKLLTRAWHLLSQLEPADASTPPRRP
Ga0187818_104594241	3300017823	Freshwater Sediment	KRRGKKIATIAIARKLVTRAWHLLSEMEPGEASAPLRRP
Ga0187807_11562571	3300017926	Freshwater Sediment	NIAKRRGKKIATIAIARKLLTRAYHLLADMQATGTTTPLRRP
Ga0187814_100023801	3300017932	Freshwater Sediment	GKKIATIAISRKLLTRAWHLLSEMQAAEAGMPPRRP
Ga0187814_102477462	3300017932	Freshwater Sediment	YSSIAKRRGKKIATIAIARKLLTRACHLLAGMPATGTTTPPRRP
Ga0187814_102634901	3300017932	Freshwater Sediment	KRRGKKIATIAIARKLLTRAWHLLAEMETAEASTPLRRP
Ga0187804_102593381	3300018006	Freshwater Sediment	RRGKKIATIAIARKLLTRAWHLLAEMETAEASTPLRRP
Ga0187871_100319534	3300018042	Peatland	RGKKIATIAIARKLLTRAYHLLADMQATGTTTPLQQP
Ga0187769_102275873	3300018086	Tropical Peatland	AIAKRRGKKIATIAVARKLLTRAWHLLSDMQATGPATPPRP
Ga0066667_116911331	3300018433	Grasslands Soil	RGKKIATIAISRKLLTRAYHLLADMQATDTTTPLRRP
Ga0066667_116956361	3300018433	Grasslands Soil	IAKRRGKKIATIAIARKLLTRAWHLLHDLQAAGASAPPPRP
Ga0210399_100472497	3300020581	Soil	KKIAAIAIARKLLTRAWHLLADMQATDTTTPLLRP
Ga0210383_113770912	3300021407	Soil	HRQRRGQKIATIAIARKLLTRAWHLLSEMQAADASAAPRRP
Ga0210390_113455591	3300021474	Soil	KRRGKKIATIAVSRKLLTRAWHLLSEMQAADASAPPRQP
Ga0210402_107197002	3300021478	Soil	GNKIATIAISRKLLTRAWHLLAEMQATSANDPPRP
Ga0126371_120005302	3300021560	Tropical Forest Soil	RAAIAKRRGKKIATIAIAGELMTRAWHLLAEPADASTLSRRP
Ga0179591_11936271	3300024347	Vadose Zone Soil	GKKIATIAISRKLLTRSWHLLADMQATSTNEPPRRP
Ga0207671_112907621	3300025914	Corn Rhizosphere	RRGKKIATIAVARKLLTRAWHLLNEMQATDTNAPLRRP
Ga0207693_104895471	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	HIAKRRGTKIATIAISRKLLTRAWHLLSEMQAADASTPSRRP
Ga0207693_106469751	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	RGKKIATIAIARKLLTRAYHLLAEMQAAEETTPPRRM
Ga0207693_110893472	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	YAAISKRRGKKIATIAIARKLLTRAWHLLDQMQPAEAGTPPRRP
Ga0207663_109930091	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	RRGRKIATIAIARKLLTRAWHLLASMQADGTATPPQRP
Ga0207660_112541161	3300025917	Corn Rhizosphere	SGIAKRRGKKIATIAISRKLLTRAWHLLSEMQAAGADEPPRRS
Ga0207700_107983613	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	RRGKKIATIAIARKLLTRGWHLLNDMQAADAATPLRRP
Ga0207661_109019661	3300025944	Corn Rhizosphere	AAIAKRRGKKIATIAVARKLLTRAWHLLNEMQATDTNAPLRRP
Ga0207679_114446272	3300025945	Corn Rhizosphere	RRGKKIATIAIARKLLTRAWHLLDQMQPAEAGTPPRRP
Ga0207651_120186221	3300025960	Switchgrass Rhizosphere	KRRGKKIATIAISRKLLARAWHLLSEMQAAGADEPPRRS
Ga0207675_1015675761	3300026118	Switchgrass Rhizosphere	IAKRRGKKIATIAVARKLLTRAWHLLNEMQATDTNAPLRRP
Ga0209693_104174871	3300027855	Soil	RGKKIATIAIARKLLTRAWHLLSEMQAADASAAPRRP
Ga0209526_108285941	3300028047	Forest Soil	IAKRRGKKIATIAISRKLLTRAYHLLADMQATGTTTPLRRP
Ga0307279_100725211	3300028709	Soil	YSAIAKRRGKKIATIAISRKLLTRAWHLLADMQATSTNEPPRRP
Ga0302182_103726422	3300030054	Palsa	RGKKIATIAISRKLLTRAWHLLAGMQATTGTATPPQRRP
Ga0316363_103135251	3300030659	Peatlands Soil	IAKRRGKKIATIAIARKLLTRAWHLLADMQATDASAPLRRP
Ga0265760_102470711	3300031090	Soil	RRGKKIATIAISRKLLTRAWHLLSEIQAADASTPPRRP
Ga0306917_110607031	3300031719	Soil	GQPGERRRLARRRGKKIATIAIARKLVTRAWHLLSEMEPPEASTPLRRP
Ga0307477_111270052	3300031753	Hardwood Forest Soil	KKIATIAIARKLLTRAWHLLSEMETAEASAPPRRP
Ga0318550_100754311	3300031797	Soil	KKIATIAISRKLLTRAWHLLSQLEPAEASTPPRRP
Ga0318550_102466672	3300031797	Soil	YAAIAKRRGKKIATIAVARKLLTRAWHLLDQMQAADAGAPPRP
Ga0306926_102431671	3300031954	Soil	AKRRGKKIATIAIARKLLTRAWHLLNEMQAAGASTPPRRP
Ga0306920_1012603411	3300032261	Soil	AAIANRRGKKIATIAIARKLVTRAWHLLSEMQAADVGAPSRRP

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F097829

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences