Basic Information | |
---|---|
Family ID | F097826 |
Family Type | Metagenome |
Number of Sequences | 104 |
Average Sequence Length | 41 residues |
Representative Sequence | MNQEMLDRIVAVTTAEGTLAHRMGIKILSASGSEVVATMPV |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 97.12 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 94.23 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (65.385 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.961 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.038 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.231 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.19% β-sheet: 13.04% Coil/Unstructured: 63.77% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF01263 | Aldose_epim | 64.42 |
PF02739 | 5_3_exonuc_N | 9.62 |
PF00575 | S1 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 64.42 |
COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 64.42 |
COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 9.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 65.38 % |
All Organisms | root | All Organisms | 34.62 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003505|JGIcombinedJ51221_10144626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 959 | Open in IMG/M |
3300004092|Ga0062389_101021019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1012 | Open in IMG/M |
3300005367|Ga0070667_100342254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1353 | Open in IMG/M |
3300005434|Ga0070709_10175617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1500 | Open in IMG/M |
3300005436|Ga0070713_100427017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1241 | Open in IMG/M |
3300005445|Ga0070708_102085029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
3300005544|Ga0070686_100682397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 817 | Open in IMG/M |
3300005564|Ga0070664_101143506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 734 | Open in IMG/M |
3300005764|Ga0066903_108327586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 530 | Open in IMG/M |
3300005983|Ga0081540_1224732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
3300006175|Ga0070712_100124676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1943 | Open in IMG/M |
3300006804|Ga0079221_10621183 | Not Available | 734 | Open in IMG/M |
3300009520|Ga0116214_1178716 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300009521|Ga0116222_1228951 | Not Available | 801 | Open in IMG/M |
3300009521|Ga0116222_1318828 | Not Available | 672 | Open in IMG/M |
3300009524|Ga0116225_1417921 | Not Available | 596 | Open in IMG/M |
3300009700|Ga0116217_10135726 | Not Available | 1654 | Open in IMG/M |
3300010359|Ga0126376_12285848 | Not Available | 586 | Open in IMG/M |
3300010376|Ga0126381_101341931 | Not Available | 1034 | Open in IMG/M |
3300010379|Ga0136449_101397665 | Not Available | 1081 | Open in IMG/M |
3300010397|Ga0134124_10179264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1910 | Open in IMG/M |
3300010398|Ga0126383_13022630 | Not Available | 549 | Open in IMG/M |
3300010399|Ga0134127_11129597 | Not Available | 848 | Open in IMG/M |
3300012207|Ga0137381_11262267 | Not Available | 632 | Open in IMG/M |
3300012209|Ga0137379_10818029 | Not Available | 836 | Open in IMG/M |
3300012211|Ga0137377_10150028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2233 | Open in IMG/M |
3300012349|Ga0137387_10154128 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
3300012357|Ga0137384_10735559 | Not Available | 800 | Open in IMG/M |
3300012924|Ga0137413_10728648 | Not Available | 755 | Open in IMG/M |
3300012957|Ga0164303_10040788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1988 | Open in IMG/M |
3300012984|Ga0164309_10400988 | Not Available | 1023 | Open in IMG/M |
3300013100|Ga0157373_10969478 | Not Available | 633 | Open in IMG/M |
3300013307|Ga0157372_11408901 | Not Available | 803 | Open in IMG/M |
3300013308|Ga0157375_10921808 | Not Available | 1017 | Open in IMG/M |
3300016294|Ga0182041_11428897 | Not Available | 635 | Open in IMG/M |
3300016422|Ga0182039_10130223 | Not Available | 1914 | Open in IMG/M |
3300016445|Ga0182038_10370509 | Not Available | 1192 | Open in IMG/M |
3300017657|Ga0134074_1331028 | Not Available | 559 | Open in IMG/M |
3300017821|Ga0187812_1132005 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300017822|Ga0187802_10136503 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300017932|Ga0187814_10399981 | Not Available | 535 | Open in IMG/M |
3300017948|Ga0187847_10690540 | Not Available | 574 | Open in IMG/M |
3300017959|Ga0187779_11306460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
3300017973|Ga0187780_10304426 | Not Available | 1121 | Open in IMG/M |
3300017999|Ga0187767_10214901 | Not Available | 615 | Open in IMG/M |
3300019890|Ga0193728_1140137 | Not Available | 1075 | Open in IMG/M |
3300020582|Ga0210395_10533889 | Not Available | 882 | Open in IMG/M |
3300021402|Ga0210385_11175326 | Not Available | 589 | Open in IMG/M |
3300021405|Ga0210387_11061134 | Not Available | 708 | Open in IMG/M |
3300021478|Ga0210402_10281982 | Not Available | 1536 | Open in IMG/M |
3300021559|Ga0210409_10476600 | Not Available | 1110 | Open in IMG/M |
3300024331|Ga0247668_1039040 | Not Available | 971 | Open in IMG/M |
3300025898|Ga0207692_10644112 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300025915|Ga0207693_10485270 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
3300025915|Ga0207693_10509558 | Not Available | 939 | Open in IMG/M |
3300025928|Ga0207700_10182712 | Not Available | 1757 | Open in IMG/M |
3300025934|Ga0207686_10587290 | Not Available | 875 | Open in IMG/M |
3300025934|Ga0207686_10692822 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300026067|Ga0207678_10012285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 7519 | Open in IMG/M |
3300026088|Ga0207641_10152088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2096 | Open in IMG/M |
3300026088|Ga0207641_10448498 | Not Available | 1246 | Open in IMG/M |
3300026095|Ga0207676_10608351 | Not Available | 1050 | Open in IMG/M |
3300026489|Ga0257160_1083050 | Not Available | 572 | Open in IMG/M |
3300027070|Ga0208365_1035215 | Not Available | 663 | Open in IMG/M |
3300027401|Ga0208637_1035933 | Not Available | 574 | Open in IMG/M |
3300027680|Ga0207826_1003752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 4178 | Open in IMG/M |
3300027826|Ga0209060_10323096 | Not Available | 704 | Open in IMG/M |
3300027829|Ga0209773_10160699 | Not Available | 936 | Open in IMG/M |
3300027855|Ga0209693_10124484 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1275 | Open in IMG/M |
3300027884|Ga0209275_10825976 | Not Available | 534 | Open in IMG/M |
3300028379|Ga0268266_10389728 | Not Available | 1315 | Open in IMG/M |
3300029882|Ga0311368_10183722 | Not Available | 1673 | Open in IMG/M |
3300030494|Ga0310037_10020883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3163 | Open in IMG/M |
3300030706|Ga0310039_10123606 | Not Available | 1064 | Open in IMG/M |
3300030707|Ga0310038_10160895 | Not Available | 1106 | Open in IMG/M |
3300031543|Ga0318516_10443267 | Not Available | 747 | Open in IMG/M |
3300031545|Ga0318541_10263866 | Not Available | 958 | Open in IMG/M |
3300031561|Ga0318528_10219440 | Not Available | 1019 | Open in IMG/M |
3300031679|Ga0318561_10527317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura citrea | 650 | Open in IMG/M |
3300031680|Ga0318574_10932566 | Not Available | 509 | Open in IMG/M |
3300031708|Ga0310686_113828523 | Not Available | 567 | Open in IMG/M |
3300031751|Ga0318494_10649837 | Not Available | 617 | Open in IMG/M |
3300031769|Ga0318526_10178306 | Not Available | 867 | Open in IMG/M |
3300031769|Ga0318526_10315144 | Not Available | 640 | Open in IMG/M |
3300031770|Ga0318521_10437055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura citrea | 782 | Open in IMG/M |
3300031770|Ga0318521_10861926 | Not Available | 553 | Open in IMG/M |
3300031792|Ga0318529_10267714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura citrea | 795 | Open in IMG/M |
3300031792|Ga0318529_10334430 | Not Available | 705 | Open in IMG/M |
3300031797|Ga0318550_10276494 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300031835|Ga0318517_10197145 | Not Available | 907 | Open in IMG/M |
3300031845|Ga0318511_10238128 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300031860|Ga0318495_10210359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura citrea | 875 | Open in IMG/M |
3300031942|Ga0310916_10421754 | Not Available | 1136 | Open in IMG/M |
3300031981|Ga0318531_10338578 | Not Available | 680 | Open in IMG/M |
3300032001|Ga0306922_10956437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura citrea | 886 | Open in IMG/M |
3300032059|Ga0318533_11442076 | Not Available | 503 | Open in IMG/M |
3300032089|Ga0318525_10365464 | Not Available | 740 | Open in IMG/M |
3300032160|Ga0311301_10455644 | Not Available | 1923 | Open in IMG/M |
3300032160|Ga0311301_10608695 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
3300032783|Ga0335079_10538505 | Not Available | 1240 | Open in IMG/M |
3300032805|Ga0335078_11177140 | Not Available | 888 | Open in IMG/M |
3300032805|Ga0335078_12043967 | Not Available | 611 | Open in IMG/M |
3300032954|Ga0335083_10127913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2441 | Open in IMG/M |
3300033134|Ga0335073_10741375 | Not Available | 1065 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.96% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.58% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.69% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.77% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.85% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.88% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.88% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.92% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.92% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.96% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.96% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ51221_101446261 | 3300003505 | Forest Soil | MDQEILDRIVAFTVAEGTLADRMGIKIRSASASQVVGTMPV |
Ga0062389_1010210191 | 3300004092 | Bog Forest Soil | MNQEILDKMMATTVADGTLAWRMGVKILSASATEVVATMPVAGNIQPY |
Ga0070667_1003422541 | 3300005367 | Switchgrass Rhizosphere | MNQEMLDRIAAVTTAEGTLAHRMGIKILSASASEVVATMPVAG |
Ga0070709_101756171 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQEMLDRIAAVTTAEGTLAHRMGIKILSASASEVVATMPVA |
Ga0070713_1004270171 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MDQHLLDRVMAATTAEGTLAHRMGITIVSASGTEVVATMPVAG |
Ga0070708_1020850291 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQEMLDRIVAVTTAEGTLAHRMGIKVQSASGSEVVATMPVAG |
Ga0070686_1006823972 | 3300005544 | Switchgrass Rhizosphere | MNQEMLDRIAAVTTAEGTLAHRMGIKILSASASEVVATMP |
Ga0070664_1011435062 | 3300005564 | Corn Rhizosphere | MDQDLLDRAMAATTAEGTLAHRMGITIVSASGTEVVATMPVAGNTQ |
Ga0066903_1083275862 | 3300005764 | Tropical Forest Soil | MDQEMLDRVVAVTTAEGTLAHRMGIRILSASGSEVVATMPVA |
Ga0081540_12247321 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MNQEMLDRIVAVTTVEGTLAHRMGIRILSASGSEVVATMPVAGN |
Ga0070712_1001246761 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQEMLDRIAAVTTAEGTLAHRMGIKILSASASEVVATM |
Ga0079221_106211831 | 3300006804 | Agricultural Soil | MDQEMLDRVVAVTTAEGTLAHRMGIRILSASASEVV |
Ga0116214_11787161 | 3300009520 | Peatlands Soil | MDQEMLDRIIAVTTAEGTLAHSMGIKILSASGTEVVAT |
Ga0116222_12289512 | 3300009521 | Peatlands Soil | MDQEMLDRIIAVTIAEGTLAHSMGIKILSASGTEVVATMPVAGN |
Ga0116222_13188282 | 3300009521 | Peatlands Soil | MDQEMLDRIIAVTTAEGTLANRMGIKILSASGTEVVATMPVAGN |
Ga0116225_14179211 | 3300009524 | Peatlands Soil | MDQEMLDRIIAVTTAEGTLAHSMGIKILSASGAEVVATMP |
Ga0116217_101357261 | 3300009700 | Peatlands Soil | MDQEMLDRVIAVTIAEGTLAHSMGIKILSASGTEVMAT |
Ga0126376_122858481 | 3300010359 | Tropical Forest Soil | MDQEMLDRIVAVTTAEGTLAHRMGIKILSASGAEVTATMPV |
Ga0126381_1013419311 | 3300010376 | Tropical Forest Soil | MDQEMLDRVVAVTTAEGTLAQAMGIKVLSASGSEVVATMPVAGNVQPF |
Ga0136449_1013976651 | 3300010379 | Peatlands Soil | MDQEMLDRIIAVTTAEGTLAHSMGIKILSASGTEVVATMPVAG |
Ga0134124_101792643 | 3300010397 | Terrestrial Soil | MNQEMLDRIAAVTTAEGTLAHRMGIKILSASASEVVA |
Ga0126383_130226301 | 3300010398 | Tropical Forest Soil | MEQEILDRVVAVTTAEGTLAHRMGIKIRSASGSEVVATMPV |
Ga0134127_111295972 | 3300010399 | Terrestrial Soil | MNQEMLDRVVAITTAEDTLAHRMGIKILSASGSEV |
Ga0137381_112622672 | 3300012207 | Vadose Zone Soil | MNQEMLDRIVAVTTAEGTLAHRMGIKIQSASGSEVVAT |
Ga0137379_108180291 | 3300012209 | Vadose Zone Soil | MNQEMLDRIVAVTTAEGTLAHRMGIKILSASGAEVVATMPV |
Ga0137377_101500281 | 3300012211 | Vadose Zone Soil | MNQEMLDRIVAVTTAEGTLAHRMGIKILSASGSEVVATMPV |
Ga0137387_101541282 | 3300012349 | Vadose Zone Soil | MNQEMLDRIVAVTTAEGTLAHSMGIKIVSASASGSEVVATMPVAGNIQP |
Ga0137384_107355591 | 3300012357 | Vadose Zone Soil | MLREVRMNQEMLDRIVAVTTAEGTLAHRMGIKVQSASGSEVV |
Ga0137413_107286482 | 3300012924 | Vadose Zone Soil | MDQEMLDRVVAVTTAEGTLAHRMGIKILSASGSEVVARMPVAG |
Ga0164303_100407883 | 3300012957 | Soil | MLDRIVAVTTAEGTLAHSMGIKVLSASASGSEVVATMPVAG |
Ga0164309_104009882 | 3300012984 | Soil | MNQEMLDRIAAVTTAEGTLAHSMGIKVLSASASGSEVVATMPVTGN |
Ga0157373_109694782 | 3300013100 | Corn Rhizosphere | MDQDLLDRVMAATTAEGTLAHRMGITIVSASGTEV |
Ga0157372_114089012 | 3300013307 | Corn Rhizosphere | MEEVRMNQEMLDMIVAVTTAEGTLAHRMGIKIISASGAE |
Ga0157375_109218082 | 3300013308 | Miscanthus Rhizosphere | MNQEMLDRIAAVTTAEGTLAHRMGIKIQSASGSEVVATMPVA |
Ga0182041_114288971 | 3300016294 | Soil | MDQEMLDRAIAVTTAEGTLAHTMGIKILSASGTEVVATMP |
Ga0182039_101302232 | 3300016422 | Soil | MEQKVLDRIVAVTTAEGTLARRMGIKILSASGSEVVATMPVA |
Ga0182038_103705091 | 3300016445 | Soil | MDQEMLDRVVALTTAEGTLAHRMGIRIVSASGSRV |
Ga0134074_13310281 | 3300017657 | Grasslands Soil | MNQEMLDRIVAVTIAEGTLAHRMGITIQSASGSEVVATMPVAGNTQPF |
Ga0187812_11320052 | 3300017821 | Freshwater Sediment | MDQETLGKITAVTVADDTLAGRIGIKIVSASASRVVAT |
Ga0187802_101365031 | 3300017822 | Freshwater Sediment | MDQEMLDKIAAVTVAGNTLAGRMGIKIQSASASRVVATM |
Ga0187814_103999812 | 3300017932 | Freshwater Sediment | MDQETLGKITAVTVADDTLAGRMGIKIVSASASRVVATMPVAGNI |
Ga0187847_106905402 | 3300017948 | Peatland | MDQETLDTMVAMTIAEGTLADTMGISIVSASAAEVVATMPVAGNV |
Ga0187779_113064602 | 3300017959 | Tropical Peatland | MDQETLDKITAMTVAEGTLPGRMGIKIVSASASQVVATMPAEGNIQP |
Ga0187780_103044261 | 3300017973 | Tropical Peatland | MEQETLGTIAAVTVADGTLAGRMGIKVVSASASRVVATMPVDGNIQ |
Ga0187767_102149012 | 3300017999 | Tropical Peatland | MNQEMLDRIVAVTTAEDTLAYRMGIKILSASGSEVVATMPVAG |
Ga0193728_11401371 | 3300019890 | Soil | MNQEMLDRIVAITTAEDTLAHRMGIKILSASGSEVVATMPV |
Ga0210395_105338891 | 3300020582 | Soil | MNQEMLDRVVAVTTAEGTLAHRMGIKILSASGSEVVATMPVAGN |
Ga0210385_111753262 | 3300021402 | Soil | MDREMLDTIMARTVAEGTLAGRMGITIVSASASRV |
Ga0210387_110611342 | 3300021405 | Soil | MNQEMLDRIVAVTTAEGTLAHRMGIKILSASGAEV |
Ga0210402_102819821 | 3300021478 | Soil | MEEVRMKQEMLDRIVAVTTAEGTLAHRMGIKILSASGAEVVATMPVTGNTQP |
Ga0210409_104766001 | 3300021559 | Soil | MDREMLDTIMARTVADGTLAGRMGITIVSASASRVVATM |
Ga0247668_10390401 | 3300024331 | Soil | MNQEMLDRIAAVTTAEGTLAHRMGIKILSASASEVVATMPV |
Ga0207692_106441121 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MNREMLDRIAAVTTAEGTLAHRMGIKILSASASEVVATMPVA |
Ga0207693_104852701 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MDQDLLDRVMAATTAEGTLAHRMGITIVSASGTEVVATMPV |
Ga0207693_105095582 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MDQDLLDRAMAATTAEGTLAHRMGITIVSASGTEVVATMPV |
Ga0207700_101827121 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQEMLDRIVAVTTAEGTLAHRMGIKILSASGAEVVATMPVAG |
Ga0207686_105872902 | 3300025934 | Miscanthus Rhizosphere | MNQEMLDRIAAVTTAEGTLAHRMGIKILSASASEVV |
Ga0207686_106928221 | 3300025934 | Miscanthus Rhizosphere | MNQEMLDRIAAVTTAEGTLAHRMGIKILSASASEV |
Ga0207678_100122856 | 3300026067 | Corn Rhizosphere | MNREMLDRIAAVTTAEGTLAHRMGIKILSASASEV |
Ga0207641_101520883 | 3300026088 | Switchgrass Rhizosphere | MNREMLDRIAAVTTAEGTLAHRMGIKILSASASEVVATMPVAG |
Ga0207641_104484981 | 3300026088 | Switchgrass Rhizosphere | MNQEMLDRIAAVTTAEGTLAHRMGIKILSASASEVVAT |
Ga0207676_106083512 | 3300026095 | Switchgrass Rhizosphere | MNREMLDRIAAVTTAEGTLAHRMGIKILSASASEVVATMPVAGNT |
Ga0257160_10830501 | 3300026489 | Soil | MDQETLDTIMAVTVAEDTLPGRMGIKIVSASASRVVA |
Ga0208365_10352151 | 3300027070 | Forest Soil | MNQEMLDRIVAVTTAEGTLAHRMGIKILSASGAEVVAT |
Ga0208637_10359332 | 3300027401 | Soil | MNQEMLDRIVAVTIAEGTLAHRMGIKIQSASGSEVVATMPVAGNTQP |
Ga0207826_10037521 | 3300027680 | Tropical Forest Soil | MDQEMLDAIRSMTVADDTLPGRMGMKILSASSISWS |
Ga0209060_103230962 | 3300027826 | Surface Soil | MDQEMLDAIMARTVAEGTLAGRMGITIVSASASQVVATMP |
Ga0209773_101606991 | 3300027829 | Bog Forest Soil | MDQETLEKITARTVAEGTLAGRMGITIVSASASRVVATMPVEG |
Ga0209693_101244842 | 3300027855 | Soil | MDQEILDKIVAFTVAQGTLADRMGIKILSASASQVVG |
Ga0209275_108259762 | 3300027884 | Soil | MDQEMLDTIMARTVAEGTLAGRMGITIVSASASRVVATMPVE |
Ga0268266_103897282 | 3300028379 | Switchgrass Rhizosphere | MNREMLDRIAAVTTAEGTLAHRMGIKILSASASEVVATMPVAGN |
Ga0311368_101837221 | 3300029882 | Palsa | MDRETLDTMVAMTIAEGTLADTMGITIVSASAAEVVATMPVAGN |
Ga0310037_100208831 | 3300030494 | Peatlands Soil | MDQEMLDRIIAVTTAEGTLAHSMGIKILSASGAEVV |
Ga0310039_101236061 | 3300030706 | Peatlands Soil | MDQEMLDRIIAVTTAEGTLAHSMGIKILSASGTEVVATMPVAGNV |
Ga0310038_101608951 | 3300030707 | Peatlands Soil | MDQEMLDRVIAVTIAEGTLAHSMGIKILSASGTEVMA |
Ga0318516_104432671 | 3300031543 | Soil | MDQEMLDRVVALTTAEGTLAHRMGIRIVSASGSRVVATMPV |
Ga0318541_102638661 | 3300031545 | Soil | MEQKVLDRIVAVTTAEGTLARRMGIKILSASGSEVVATMPVAGN |
Ga0318528_102194402 | 3300031561 | Soil | MEQKVLDRIVAVTTAEGTLARRMGIKILSASGSEV |
Ga0318561_105273172 | 3300031679 | Soil | MDQEMLDEIMAMTVADGTLAGRMGIEILSASASRVVATM |
Ga0318574_109325662 | 3300031680 | Soil | MDQELLERIMAVTTAEGTLAHRTGIKILSASGTEVTGTMPA |
Ga0310686_1138285232 | 3300031708 | Soil | MDQEILDTIMARTVAEGTLAGRMGITIVSASASRVVATMPVE |
Ga0318494_106498371 | 3300031751 | Soil | MLDTIMATTVAEGTLPGRMGIKILSASASRVVATMPAEGN |
Ga0318526_101783061 | 3300031769 | Soil | MDQETLERIMATTVAEGTLPGRMGIKILSASASRVVATMPA |
Ga0318526_103151442 | 3300031769 | Soil | MDQATLDKIMAVTVAEDTLPGRMGIKIVSASASRVVATMPAEGNIQAH |
Ga0318521_104370551 | 3300031770 | Soil | MDQEMLDEIMAMTVADGTLAGRMGIEILSASDSQVV |
Ga0318521_108619261 | 3300031770 | Soil | MDQEMLDRAIAVTTAEGTLAHTMGIKILSASGTEVVATMPVAG |
Ga0318529_102677141 | 3300031792 | Soil | MDRQTLDKITAMTVAEGTLPGRMGIKIRSASAARVVATMPAEGN |
Ga0318529_103344301 | 3300031792 | Soil | MDQETLERIMATTVAEGTLPGRMGIKILSASASRVVATMPAEGNI |
Ga0318550_102764941 | 3300031797 | Soil | MDQEMLDRIMAVTTAEGTLAHTMGIKILSASGTEVVA |
Ga0318517_101971452 | 3300031835 | Soil | MEQKVLDRIVAVTTAEGTLARRMGIKILSASGSEVVATMPVAGNIQP |
Ga0318511_102381281 | 3300031845 | Soil | MDQEILDRAVAVTTGEGTLAGRMGIKILSASGSEVVATMPVAGN |
Ga0318495_102103591 | 3300031860 | Soil | MDEETLDNITAMTVAEGTLPGRMGIKIVSASASQVVATMPAEGNIQPH |
Ga0310916_104217542 | 3300031942 | Soil | MDQEILDRAVAVTTGEGTLAGRMGIKILSASGSEVVATMPV |
Ga0318531_103385782 | 3300031981 | Soil | MDQEILDRAVAVTTGEGTLAGRMGIKILSASGSEVVATM |
Ga0306922_109564372 | 3300032001 | Soil | MDQDTLDKITAMTVAEGTLPGRMGIKIVSASASQVVATMPA |
Ga0318533_114420761 | 3300032059 | Soil | MNQEMLDRVIAVTTAEGTLAHRMGIKIVSASGSQVVATMPVAGNI |
Ga0318525_103654641 | 3300032089 | Soil | MDQETLERIMATTVAEGTLPGRMGIKILSASASRVV |
Ga0311301_104556442 | 3300032160 | Peatlands Soil | MDQEMLDRIIAVTTAEGTLAHSMGIKILSASGTEVVATMPVAGNVQPY |
Ga0311301_106086952 | 3300032160 | Peatlands Soil | MDQEMLDRIIAVTTAEGTLAHSMGIKILSASGTEVVATMPVAGN |
Ga0335079_105385051 | 3300032783 | Soil | MDQEMLDRVVAVTTAEGTLAHRMGIRIVSASGSEVVATMPVAGN |
Ga0335078_111771402 | 3300032805 | Soil | MDQEMLDRVVAVTTAEGTLAHRMGIKILSASGAEVVATMPVAGNT |
Ga0335078_120439671 | 3300032805 | Soil | MDRETLDKITAVTVAGDTLAGRMGIKIQSASASRVVATM |
Ga0335083_101279131 | 3300032954 | Soil | MDQEMLGRVVAVTTAEGTLARRMGIRILSASGSEVVATMPVAGNI |
Ga0335073_107413751 | 3300033134 | Soil | MNQEMLDKIAAVTTAEGTLAHRMGIKILSASASEVVAT |
⦗Top⦘ |