| Basic Information | |
|---|---|
| Family ID | F097807 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MSDATSVSSAQDRRWLILGVIGLAQLMVVLDLTVM |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.96 % |
| % of genes from short scaffolds (< 2000 bps) | 1.92 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.038 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.654 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.115 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.154 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.79% β-sheet: 0.00% Coil/Unstructured: 49.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00440 | TetR_N | 28.85 |
| PF00857 | Isochorismatase | 10.58 |
| PF00196 | GerE | 5.77 |
| PF03807 | F420_oxidored | 3.85 |
| PF00106 | adh_short | 1.92 |
| PF00226 | DnaJ | 0.96 |
| PF07366 | SnoaL | 0.96 |
| PF02597 | ThiS | 0.96 |
| PF02589 | LUD_dom | 0.96 |
| PF00171 | Aldedh | 0.96 |
| PF07690 | MFS_1 | 0.96 |
| PF02738 | MoCoBD_1 | 0.96 |
| PF00753 | Lactamase_B | 0.96 |
| PF01872 | RibD_C | 0.96 |
| PF02875 | Mur_ligase_C | 0.96 |
| PF00248 | Aldo_ket_red | 0.96 |
| PF03446 | NAD_binding_2 | 0.96 |
| PF13191 | AAA_16 | 0.96 |
| PF02604 | PhdYeFM_antitox | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 10.58 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 10.58 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.96 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.96 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.96 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.96 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.96 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.96 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.96 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.96 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.04 % |
| All Organisms | root | All Organisms | 0.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300010876|Ga0126361_11222700 | Not Available | 664 | Open in IMG/M |
| 3300017821|Ga0187812_1028655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1906 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 12.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.92% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.92% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.96% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.96% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1100520172 | 3300000956 | Soil | MSTTSADVGSRLRWLILAIIGVAQLMVVLDATIVN |
| Ga0062389_1025846841 | 3300004092 | Bog Forest Soil | MSIPNPAEMSDATLVSSGLGRRRWLILGVIGLAQLMVVLDLTVMN |
| Ga0062389_1028698851 | 3300004092 | Bog Forest Soil | VVSLMSDATTVSGGLGRRRWIILGVIGLAQLMVVLDLTVM |
| Ga0066823_100338151 | 3300005163 | Soil | LVKLMSDVNSIDRAGPGDRRRWLILGVIGLAQLMVVLDVTV |
| Ga0070714_1006507271 | 3300005435 | Agricultural Soil | VVSLMSDATTVSGGPGRRRWLILGVIGLGQVMVIMSLTVMNIALLSAQ |
| Ga0070714_1009958131 | 3300005435 | Agricultural Soil | VVVMAEATVSGGGQDRRRWVLLWVIGLAQLMVVLDLTVMNI |
| Ga0070710_113554921 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VVVMAEATVSGGGQDRRRWVLLWVIGLAQLMVVLDLTVMN |
| Ga0070730_100863191 | 3300005537 | Surface Soil | MSDVTSISGARDRRWLILGVIGVAQVMVIMSLTVMNIALL |
| Ga0070764_101785763 | 3300005712 | Soil | MAEATVGTGGLDRRRWLLLWVIGLAQLMVVLDLTVMNI |
| Ga0070717_103995831 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDAISIDSARDRRWAVLGVIGLAQVMVIMSLTVMNIAL |
| Ga0070717_104346071 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDVTSISSAQDRRWPILGVIGLGQVMVIMSLTVM |
| Ga0070717_115143721 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDVNSTGRDGPAPVDPAERRRWLILGVIGLAQLMVVLD |
| Ga0070717_115215422 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LVRLMSDVNAGASDGDRRRCLILGVIGLAQLMVVL |
| Ga0070717_120546592 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLMSDATSISSAPDRRWLILGVIGLAQVMVIMSLTVMNIAL |
| Ga0066656_110764971 | 3300006034 | Soil | MAEATVAGGGQDRRRWVLLWVIGLAQLMVVLDLTV |
| Ga0070712_1005397771 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VVSLMSDATTVSSGPDRQRWLILGVIGLGQVMVIMSLTVMNIALLSA |
| Ga0070712_1016526522 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEATVSGGGQDRRRWVLLWVIGLAQLMVVLDLTVMN |
| Ga0070765_1008612632 | 3300006176 | Soil | LVKLMTDVNTASSAPDRRWLILGVIAIAQLMVILDL |
| Ga0066653_105261041 | 3300006791 | Soil | MSDAISGDGAPDRRWLILGVIGLAQLMVVLDLTVM |
| Ga0079221_111816033 | 3300006804 | Agricultural Soil | VNLMSDATSINSVWDRRRRFTLGVIGIAQLMIVLDVTVM |
| Ga0079220_120337442 | 3300006806 | Agricultural Soil | VNLVSSATSTDSAWNRRRWLILGVIGLAQLMVVLDLTVMN |
| Ga0068865_1005702412 | 3300006881 | Miscanthus Rhizosphere | MSDATTAGGWDRRRWLILGVIGLAQLMVVLDLTVM |
| Ga0075435_1017544171 | 3300007076 | Populus Rhizosphere | MSDARSIGSVRDRRWLILGVIGLAQLMVVLDITVM |
| Ga0099829_105371413 | 3300009038 | Vadose Zone Soil | MSDATSINSVWDRRRWLTLGVIGIAQLMIVLDVTVM |
| Ga0099829_112535182 | 3300009038 | Vadose Zone Soil | LVKIMSDVNPISSAPVGSDRDRRRWLVLGVIGIAQLMVVLD |
| Ga0126372_107528541 | 3300010360 | Tropical Forest Soil | MSDVSTISGDGGRRRWLILGVIGIAQLMVVLDATI |
| Ga0134128_116121731 | 3300010373 | Terrestrial Soil | MKRSVIVMAESTVAGGGQDRRRWVLLWVIGLAQLMVVLDLTV |
| Ga0134126_129281191 | 3300010396 | Terrestrial Soil | MSDVNSVASVAAERRRWLILGVIALAQLMVVLDATI |
| Ga0126361_112227002 | 3300010876 | Boreal Forest Soil | VIVMAEAAVAGGGPDRRRWVLLWVIGLAQLMVVLDSTANSQ* |
| Ga0137374_111252531 | 3300012204 | Vadose Zone Soil | MSDATSVRGAQDRRWLVLGVIGLAQLMVVLDITVMNI |
| Ga0137379_107911781 | 3300012209 | Vadose Zone Soil | MSDVNSIGSAGPENRRRWLILGVIGLAQLMVVLDV |
| Ga0137384_100919474 | 3300012357 | Vadose Zone Soil | MSDVTAISSTRDRRWLILGVIGLGQVIVIMSLTVTNIALLSAQRA |
| Ga0157336_10252741 | 3300012477 | Arabidopsis Rhizosphere | MAEATVAGGGLVRRRWLLLVALGLAQLMVVLDLTVLNIA |
| Ga0164309_114904651 | 3300012984 | Soil | MAEATVAGGGLVRQRWVLLSVIGLAQLMVVLDLTSLIPSGS* |
| Ga0164304_104812942 | 3300012986 | Soil | MSDATSISSAPDRRWLVLGVIGLAQLMVILDLTVMN |
| Ga0173483_109778071 | 3300015077 | Soil | MSDVNSIDRAGPGDRRRWLILGVIGLAQLMVVLDVTV |
| Ga0182036_118974922 | 3300016270 | Soil | MSDASSTDSARDRRWLILGVIGPAQLMVILDLTVMNI |
| Ga0182033_109135842 | 3300016319 | Soil | MSDVNTASTAADRRWLILGVIGLAQLMVVLDATIMN |
| Ga0182033_120460952 | 3300016319 | Soil | MSDVNTISSDGDQRRWLILGVIGLAQLMVVLDATI |
| Ga0182040_103899873 | 3300016387 | Soil | MSDGTTADGAWDRRRWLILGVIGLAQLMVVLAATIM |
| Ga0187812_10286551 | 3300017821 | Freshwater Sediment | MSDVNAGTSSGEDRRRWFILGVIGLAQLMVVLDVTVMN |
| Ga0187820_11931512 | 3300017924 | Freshwater Sediment | LVRLMSDVNAGTSSGEDRRRWFILGVIGLAQLMVVLDVTVM |
| Ga0187809_103407922 | 3300017937 | Freshwater Sediment | MSDATSINGTVDPRRWLILGVIGLAQLMVVLDLTIMN |
| Ga0210407_111749661 | 3300020579 | Soil | VVNLMSSATSTDGAWDRRRWLILGVIGLAQLMVVL |
| Ga0210395_101813191 | 3300020582 | Soil | LVKLMTDVNTASSAPDRRWLILGVIAIAQLMVILDLTV |
| Ga0210395_105606262 | 3300020582 | Soil | VVNLMSGATSPDGAWDRRRWLILGVIGLAQLMVVLD |
| Ga0210396_103720861 | 3300021180 | Soil | MSDASAVGGGWDRRRWLILGVIGLAQLMVVLDLTIM |
| Ga0210385_100671834 | 3300021402 | Soil | MSDANPISGAADPRRWLILGVIGIAQLMVVLDVTVM |
| Ga0210389_102431724 | 3300021404 | Soil | MSDVTPISSAPDRRWLILGVIGLAQVMVIMSLTVMNI |
| Ga0210387_112560152 | 3300021405 | Soil | MSDAISISSAPDRRWLILGVIGLGQVMVIMSLTVMNIALLSAQ |
| Ga0210387_114686972 | 3300021405 | Soil | VVNLMSGATSTDGVWDRRRWLILGVIGLAQLMVVLD |
| Ga0210387_116109181 | 3300021405 | Soil | MSDATSTDSAWDRRRWLILGVIALAQLMVVLDLTV |
| Ga0210386_116408371 | 3300021406 | Soil | VVILMSDATSSSSGLGRRRWLILGVIALAQLMVVLD |
| Ga0210383_115647442 | 3300021407 | Soil | MSDATSVNGTLDRRRWLILGVIGLAQLMVVLDLTIM |
| Ga0210394_102039582 | 3300021420 | Soil | VVIVMSDATTAGGGWDRRQWLILGVIGLAQLMVVLDLTVM |
| Ga0210394_115764931 | 3300021420 | Soil | VNLMSDVTPVSSAPDRRWLILGVIGLAQVMVINTGTF |
| Ga0210392_111711702 | 3300021475 | Soil | MPEATIRSARDRRWLILGVIGLAQLMVILDLTVMNI |
| Ga0210402_119349102 | 3300021478 | Soil | VVNLMSSATSTDGAWDRRRWLILGVIGLAQLMVVLD |
| Ga0210409_107852422 | 3300021559 | Soil | MSSATSTGSGWDRRRWLILGVIGLAQLMVVLDLTVM |
| Ga0224549_10162051 | 3300022840 | Soil | VSSATFTDSPWDRRRWLILCVIGLAQLMVVLDLTVMN |
| Ga0208219_10784652 | 3300025625 | Arctic Peat Soil | MAEASVAGGGLDRRRWVLLWVIGLAQLMVVLDLTVMN |
| Ga0208219_11123252 | 3300025625 | Arctic Peat Soil | MAEATVAGGGLDRRRWVLLWVIGLAQLMVVLDLTVMN |
| Ga0207692_101554951 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLMSDATSVNSVWDRRRWLTLGVIGIAQLMIVLDVTV |
| Ga0207692_106789772 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLMSDATSINSVWDRRRWLTLGVIGIAQLMIVLDVTV |
| Ga0207693_111100531 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDAISTDSTRDRRWLILGVIGLAQVMVIMSLTVM |
| Ga0207663_110650852 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDAGTVNSARDRSWLILGVIGLAQLMVVLDITVM |
| Ga0207663_116587472 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDVTSISSAPDRRWVILGVIGLAQVMVIMSLTVMNIAL |
| Ga0207652_115748361 | 3300025921 | Corn Rhizosphere | MSDVNSIDRAGPGDRRRWLILGVIGLAQLMVVLDVT |
| Ga0207644_105651671 | 3300025931 | Switchgrass Rhizosphere | VMSDAISGDSARDRRWLILGVIGLAQLMVVLDLTV |
| Ga0207709_111815412 | 3300025935 | Miscanthus Rhizosphere | VMSDAISGDSAPDRRWLVLGVIGLAQLMVVLDITV |
| Ga0209839_100223851 | 3300026294 | Soil | MAEAAVAGGGLDRRRWVLLWVIGLAQLMVVLDLTVMN |
| Ga0209647_11774982 | 3300026319 | Grasslands Soil | VNLMSDATSIDSVWDRRRWLTLGVIGIAQLMIVLDVTVM |
| Ga0209588_12654351 | 3300027671 | Vadose Zone Soil | MSGVNPGSTEDRRRWLILGVIGIAQLMVVLDVTVM |
| Ga0209178_10681211 | 3300027725 | Agricultural Soil | MSDVNSTGRDGPAPAGPTERRRWLILGVIGLAQLMVVLDV |
| Ga0209274_104370602 | 3300027853 | Soil | VTTLEEVVTLISDAASVSSGLGRRRWLVLGVIGIAQLMVILD |
| Ga0209169_102732952 | 3300027879 | Soil | MSDATSVRSAQDRRWLILGVIGLAQLMVVLDLTVMNIA |
| Ga0311369_105668712 | 3300029910 | Palsa | MSDATSVSSAQDRRWLILGVIGLAQLMVVLDLTVM |
| Ga0247826_111244091 | 3300030336 | Soil | MPDAISINSTRDRRWLILGVIGLAQLIVVLDITVM |
| Ga0311357_104563151 | 3300030524 | Palsa | MSDGTVASGGLGGRRWLILGVIGLAQLMVVLDLTVMNI |
| Ga0318560_104572331 | 3300031682 | Soil | MAEATVAGGGLVRRRWVLLWALGLAQLMVVLDLTVLNIAL |
| Ga0307474_100992053 | 3300031718 | Hardwood Forest Soil | MAEAMVAGGGLVRRRWVLLWVIGLAQLMVVLDLTVMN |
| Ga0307469_115636002 | 3300031720 | Hardwood Forest Soil | LVKLMSDVNSIDTAGPGDRRRWLILGVIGLAQLMVVLDVT |
| Ga0318500_105319221 | 3300031724 | Soil | MAEATVAGGGLVRRRWVLLWALGLAQLMVVLDLTVLNI |
| Ga0318502_103566002 | 3300031747 | Soil | MSDISTSGVGGRRRWLILGVIGIAQLMVVLDVTVM |
| Ga0318502_107206681 | 3300031747 | Soil | MRDATSINSTRDRRWLILGVIGLAQLMVILDLTVMN |
| Ga0318492_103874671 | 3300031748 | Soil | MTDVDAISGATAQRRWLILGVIGLAQLMVILDATVMN |
| Ga0318494_102674612 | 3300031751 | Soil | MSDVSTSGVGGRRRWLILGVIGIAQLMVVLDVTVMN |
| Ga0307475_115602111 | 3300031754 | Hardwood Forest Soil | VVSLMSDTTSISSSPDRRRWLILGVIGLGQVMVIMSLT |
| Ga0318498_103026153 | 3300031778 | Soil | LVKRMSDVRTISGDGGRRRWLILGVIGLAQLMVVL |
| Ga0318547_103748891 | 3300031781 | Soil | MSDATSITSTRDRRWLILGVIGLAQLMVILDLTVMN |
| Ga0318547_104985922 | 3300031781 | Soil | MAEATVAGGGLVRRRWVLLWALGLAQLMVVLDLTVLN |
| Ga0318576_105469751 | 3300031796 | Soil | LVKRMSDVNTISSDGDRRRWLILGVIGLAQLMVVLDATIM |
| Ga0318497_103370081 | 3300031805 | Soil | VKLMSDISTSGVGGRRRWLILGVIGIAQLMVVLDVTVMN |
| Ga0318564_101689631 | 3300031831 | Soil | MSLTSDATSTESARDGRWLILGVIGLAQLRVILDLTVMN |
| Ga0318511_106105551 | 3300031845 | Soil | MAEATVAGGGLDRRRWVLLWVIGLAQLMVVLDLTVM |
| Ga0318495_100182445 | 3300031860 | Soil | MSDVNTASTAGDRRWLILGVIGIAQLMVVLDATIMN |
| Ga0310912_108827882 | 3300031941 | Soil | MADATSSNSAPDRRWLILGVIGLAQLMVVLDLTVMN |
| Ga0318531_103319472 | 3300031981 | Soil | MSDATTVSGGPSQRRWLILGVIGLGQVMVIMSLTVMN |
| Ga0310906_107740611 | 3300032013 | Soil | MAEATVSGGGQDRRRWVLLWVIGLAQLMVVLDLTIMN |
| Ga0318556_100976513 | 3300032043 | Soil | MSDATTADGAWDRRRWLILGVIGLAQLMVVLDVTV |
| Ga0318533_105137342 | 3300032059 | Soil | MSDVNTASTAVDRRWLILGVIGLAQLMVVLDATIMN |
| Ga0318577_100071221 | 3300032091 | Soil | MSDATSIDGAWDRRRWLVLGVIALAQLMVVLDLTV |
| Ga0307471_1042453942 | 3300032180 | Hardwood Forest Soil | MSDATSISSAPDRRWLVLGVIGLAQLMVVLDITVMNI |
| Ga0316215_10112401 | 3300033544 | Roots | MSSATSTDSTWDRRRWLILGVIGLAQLMVVLDLTEMN |
| ⦗Top⦘ |