Basic Information | |
---|---|
Family ID | F097803 |
Family Type | Metagenome |
Number of Sequences | 104 |
Average Sequence Length | 46 residues |
Representative Sequence | GENGFDSVDAIRGLKDATHVEHIDALLRAQYVAALTEYLPGKLVQ |
Number of Associated Samples | 86 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.96 % |
% of genes near scaffold ends (potentially truncated) | 96.15 % |
% of genes from short scaffolds (< 2000 bps) | 95.19 % |
Associated GOLD sequencing projects | 83 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (74.038 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.308 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.038 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.21% β-sheet: 0.00% Coil/Unstructured: 54.79% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF06826 | Asp-Al_Ex | 25.00 |
PF10011 | DUF2254 | 6.73 |
PF07617 | DUF1579 | 2.88 |
PF02627 | CMD | 2.88 |
PF03129 | HGTP_anticodon | 2.88 |
PF00326 | Peptidase_S9 | 2.88 |
PF00215 | OMPdecase | 1.92 |
PF08450 | SGL | 1.92 |
PF02566 | OsmC | 1.92 |
PF00135 | COesterase | 1.92 |
PF07992 | Pyr_redox_2 | 1.92 |
PF12833 | HTH_18 | 0.96 |
PF12697 | Abhydrolase_6 | 0.96 |
PF02687 | FtsX | 0.96 |
PF06964 | Alpha-L-AF_C | 0.96 |
PF07973 | tRNA_SAD | 0.96 |
PF13460 | NAD_binding_10 | 0.96 |
PF10091 | Glycoamylase | 0.96 |
PF00230 | MIP | 0.96 |
PF13620 | CarboxypepD_reg | 0.96 |
PF00486 | Trans_reg_C | 0.96 |
PF00903 | Glyoxalase | 0.96 |
PF07228 | SpoIIE | 0.96 |
PF12680 | SnoaL_2 | 0.96 |
PF13336 | AcetylCoA_hyd_C | 0.96 |
PF08281 | Sigma70_r4_2 | 0.96 |
PF04338 | DUF481 | 0.96 |
PF01329 | Pterin_4a | 0.96 |
PF00343 | Phosphorylase | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG2985 | Uncharacterized membrane protein YbjL, putative transporter | General function prediction only [R] | 25.00 |
COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.88 |
COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 2.88 |
COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.88 |
COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.88 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 2.88 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 2.88 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 1.92 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 1.92 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 1.92 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 1.92 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 1.92 |
COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.96 |
COG0058 | Glucan phosphorylase | Carbohydrate transport and metabolism [G] | 0.96 |
COG3137 | Putative salt-induced outer membrane protein YdiY | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.96 |
COG3534 | Alpha-L-arabinofuranosidase | Carbohydrate transport and metabolism [G] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.04 % |
Unclassified | root | N/A | 25.96 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000858|JGI10213J12805_10138529 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300000891|JGI10214J12806_13088067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 696 | Open in IMG/M |
3300001431|F14TB_103161774 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300004114|Ga0062593_100261150 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1440 | Open in IMG/M |
3300004114|Ga0062593_102091990 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300004114|Ga0062593_102173778 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300004156|Ga0062589_102724005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300004480|Ga0062592_101773335 | Not Available | 603 | Open in IMG/M |
3300005294|Ga0065705_10564987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 670 | Open in IMG/M |
3300005295|Ga0065707_10171024 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1478 | Open in IMG/M |
3300005354|Ga0070675_100329155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1351 | Open in IMG/M |
3300005366|Ga0070659_100914975 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300005444|Ga0070694_101958134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37 | 501 | Open in IMG/M |
3300005544|Ga0070686_100355293 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300005549|Ga0070704_100272375 | Not Available | 1399 | Open in IMG/M |
3300005617|Ga0068859_100176499 | All Organisms → cellular organisms → Bacteria | 2218 | Open in IMG/M |
3300005618|Ga0068864_100085403 | All Organisms → cellular organisms → Bacteria | 2775 | Open in IMG/M |
3300005718|Ga0068866_10813642 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300005842|Ga0068858_100793721 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 924 | Open in IMG/M |
3300005844|Ga0068862_101693923 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300006175|Ga0070712_100603413 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300006178|Ga0075367_10576350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 715 | Open in IMG/M |
3300006755|Ga0079222_11713784 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300006844|Ga0075428_101570038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
3300006844|Ga0075428_101829534 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300006847|Ga0075431_101089804 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300006880|Ga0075429_100462551 | Not Available | 1112 | Open in IMG/M |
3300006954|Ga0079219_11019769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
3300006969|Ga0075419_10311777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 1063 | Open in IMG/M |
3300007004|Ga0079218_13957910 | Not Available | 503 | Open in IMG/M |
3300009156|Ga0111538_13941133 | Not Available | 513 | Open in IMG/M |
3300009553|Ga0105249_12978814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
3300010397|Ga0134124_12488558 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300012212|Ga0150985_117841537 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
3300012469|Ga0150984_108244492 | Not Available | 609 | Open in IMG/M |
3300012469|Ga0150984_115199779 | Not Available | 898 | Open in IMG/M |
3300012469|Ga0150984_115501611 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300012898|Ga0157293_10025227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1147 | Open in IMG/M |
3300012898|Ga0157293_10057351 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 887 | Open in IMG/M |
3300012906|Ga0157295_10010701 | Not Available | 1626 | Open in IMG/M |
3300012906|Ga0157295_10089936 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300012907|Ga0157283_10160341 | Not Available | 672 | Open in IMG/M |
3300012909|Ga0157290_10128026 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
3300012913|Ga0157298_10326998 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
3300012913|Ga0157298_10425724 | Not Available | 513 | Open in IMG/M |
3300012915|Ga0157302_10500985 | Not Available | 525 | Open in IMG/M |
3300012957|Ga0164303_11387046 | Not Available | 525 | Open in IMG/M |
3300012958|Ga0164299_10610426 | Not Available | 747 | Open in IMG/M |
3300012986|Ga0164304_11612097 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300012988|Ga0164306_10407292 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300014326|Ga0157380_12268134 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300015258|Ga0180093_1108275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 687 | Open in IMG/M |
3300015371|Ga0132258_11405561 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1763 | Open in IMG/M |
3300015372|Ga0132256_101364248 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300015372|Ga0132256_102081227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
3300015372|Ga0132256_103636664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 518 | Open in IMG/M |
3300015372|Ga0132256_103712013 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 513 | Open in IMG/M |
3300015373|Ga0132257_100020476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6960 | Open in IMG/M |
3300015373|Ga0132257_102227150 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300015373|Ga0132257_104044677 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
3300015374|Ga0132255_100629029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21 | 1589 | Open in IMG/M |
3300017792|Ga0163161_11477898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
3300019356|Ga0173481_10343641 | Not Available | 710 | Open in IMG/M |
3300019361|Ga0173482_10122449 | Not Available | 976 | Open in IMG/M |
3300019362|Ga0173479_10042929 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
3300023263|Ga0247800_1085194 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300025315|Ga0207697_10185564 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300025921|Ga0207652_11375811 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300025923|Ga0207681_10789837 | Not Available | 793 | Open in IMG/M |
3300025925|Ga0207650_10215435 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
3300025935|Ga0207709_11028542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37 | 674 | Open in IMG/M |
3300025935|Ga0207709_11796768 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300025936|Ga0207670_11415641 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 590 | Open in IMG/M |
3300025940|Ga0207691_11115537 | Not Available | 656 | Open in IMG/M |
3300025941|Ga0207711_11544480 | Not Available | 607 | Open in IMG/M |
3300025961|Ga0207712_12055694 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
3300025981|Ga0207640_11184876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 679 | Open in IMG/M |
3300026075|Ga0207708_11049453 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300026121|Ga0207683_11257549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
3300027364|Ga0209967_1067014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 559 | Open in IMG/M |
3300028380|Ga0268265_11851686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
3300028587|Ga0247828_11079310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
3300028809|Ga0247824_10503421 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 715 | Open in IMG/M |
3300028809|Ga0247824_10847522 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300031562|Ga0310886_10470778 | Not Available | 753 | Open in IMG/M |
3300031562|Ga0310886_10824837 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300031640|Ga0318555_10380676 | Not Available | 765 | Open in IMG/M |
3300031765|Ga0318554_10346316 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300031908|Ga0310900_10169348 | Not Available | 1501 | Open in IMG/M |
3300031908|Ga0310900_10683385 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300031911|Ga0307412_11560279 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300031939|Ga0308174_10056854 | All Organisms → cellular organisms → Bacteria | 2665 | Open in IMG/M |
3300031943|Ga0310885_10794154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 537 | Open in IMG/M |
3300031944|Ga0310884_10236202 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300031996|Ga0308176_10419121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1341 | Open in IMG/M |
3300032012|Ga0310902_10311012 | Not Available | 974 | Open in IMG/M |
3300032012|Ga0310902_11216107 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300032039|Ga0318559_10557008 | Not Available | 535 | Open in IMG/M |
3300032043|Ga0318556_10721283 | Not Available | 519 | Open in IMG/M |
3300032067|Ga0318524_10636845 | Not Available | 562 | Open in IMG/M |
3300032144|Ga0315910_11262115 | Not Available | 577 | Open in IMG/M |
3300032157|Ga0315912_10015650 | All Organisms → cellular organisms → Bacteria | 6302 | Open in IMG/M |
3300032205|Ga0307472_102791913 | Not Available | 500 | Open in IMG/M |
3300034354|Ga0364943_0077710 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 12.50% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.81% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.81% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 3.85% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.88% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.88% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.92% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.92% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.96% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.96% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.96% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10213J12805_101385292 | 3300000858 | Soil | GANSFDSVDAIRGLKDASHVDNVDALFRAQYVASLTDYVPGKLV* |
JGI10214J12806_130880672 | 3300000891 | Soil | RGLKDATHVEHVDALLRARYVAALTDYLPGKLAS* |
F14TB_1031617742 | 3300001431 | Soil | LGVMRDGLARWIAENRFESVEAIRGLKDASRVADVDAFLRAQYVAALTDYLPGKLVQ* |
Ga0062593_1002611501 | 3300004114 | Soil | NGFDSVDAIRGLKDATHVEDVDALLRAQYVASLTEYIPGKLVQ* |
Ga0062593_1020919901 | 3300004114 | Soil | LADNRFDSVDAIRSLKNAAHVDDADAFLRAQYVASLRDYVPGKLVQ* |
Ga0062593_1021737781 | 3300004114 | Soil | EHVATMREGLERWLGENGFDSVEAIRGLKDATHVEHVDALFRAQYVASLTEYLPGKLV* |
Ga0062589_1027240051 | 3300004156 | Soil | GENGFASVDAIRGLKDATHVEHVDALLRAQYVAALTDYLPATIVR* |
Ga0062592_1017733351 | 3300004480 | Soil | NGFDSVDAIRGLKDATHVEDVDALFRAQYVAALTEYLPAKLVQ* |
Ga0065705_105649872 | 3300005294 | Switchgrass Rhizosphere | ANGFDSVDAIRGLKDATHVEDVDALFRAQYVAALTEYLPVRLVQ* |
Ga0065707_101710241 | 3300005295 | Switchgrass Rhizosphere | NGVQHVATMREGLERWLGANGFDSVDAIRGLKDATHVEDVDALFRAQYVAALTEYLPAKLVQ* |
Ga0070675_1003291551 | 3300005354 | Miscanthus Rhizosphere | ATMRDGLARWLGANGFDSVAAIRGLKDASHVEHVDALFRAQYVASLTDYLPGKLA* |
Ga0070659_1009149751 | 3300005366 | Corn Rhizosphere | RWLGANGFDSVDAIRGLKDATHVEHLDALFRAQYVASLTEY* |
Ga0070694_1019581342 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | SVDAIRGLKDATHVEHVDALLRAQYVAALTDYLPGKLVQ* |
Ga0070686_1003552932 | 3300005544 | Switchgrass Rhizosphere | EGLERWLGANGFDSVDAIRGLKDATHVEHVDALLRAQYVAALTEYLPGKLVQ* |
Ga0070704_1002723752 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | FASVEAIRGLKDATHVEHVDALFRAQYVAALTDYLPATLIR* |
Ga0068859_1001764991 | 3300005617 | Switchgrass Rhizosphere | WLADNRFDSVDAIRSLKNAAHVDDADAFLRAQYVASLRDYVPGKLVQ* |
Ga0068864_1000854031 | 3300005618 | Switchgrass Rhizosphere | ATMRDGLARWLGANGFDSVAAIRGLKDASHVEHFDALFRAQYVASLTDYLPGKLA* |
Ga0068866_108136422 | 3300005718 | Miscanthus Rhizosphere | RWLGANGFDSVDAIRGLKDASHVDNVDALFRAQYVSSLTDYVPGKLV* |
Ga0068858_1007937212 | 3300005842 | Switchgrass Rhizosphere | WLGVNGFDSVNAIRGLKDATHVEHVDALFRAQYVASLTEYLPGKLV* |
Ga0068862_1016939231 | 3300005844 | Switchgrass Rhizosphere | EGLERWLGANGFDSVDAIRGLKDATHVEHLDALFRAQYVASLTEY* |
Ga0070712_1006034131 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EAWLGTNGFTSVEAIRGLKDATHVDQVDALLRAQYVAALTDYMPATLVR* |
Ga0075367_105763501 | 3300006178 | Populus Endosphere | VTAIRGLKDATHAEHVDALFRAQYVAALTEYLPGKLVQ* |
Ga0079222_117137842 | 3300006755 | Agricultural Soil | LESWLGENGFASVEAIRGLKDATHAEHVDALFRAQYVAALTDYLPTTPYASVRH* |
Ga0075428_1015700381 | 3300006844 | Populus Rhizosphere | GLERWLGENGFDSVSAIRGLKDATHVEHVDALLRAQYVAALTDYLPGKLVS* |
Ga0075428_1018295342 | 3300006844 | Populus Rhizosphere | GLDRWLSENQFESVDAIRSLKDGTHVDDADAFLRAQYVASLRDYVPGKLVQ* |
Ga0075431_1010898041 | 3300006847 | Populus Rhizosphere | ENGFDSVSAIRGLKDATHVEHVDALLRAQYVAALTDYLPGKLVS* |
Ga0075429_1004625512 | 3300006880 | Populus Rhizosphere | RGLKDATHVEDVDALFRAQYVAALTEYLPAKLVQ* |
Ga0079219_110197691 | 3300006954 | Agricultural Soil | RGLKDATHAEHVDALFRAQYVAALTEYLPATIVR* |
Ga0075419_103117771 | 3300006969 | Populus Rhizosphere | VDAIRGLKDATHVEHVDTLLRAQYVAALPEYVPGKFVQ* |
Ga0079218_139579101 | 3300007004 | Agricultural Soil | RFDSVDAIRSLKNAAHVDDADAFLRAQYVASLRDYVPGKLVQ* |
Ga0111538_139411332 | 3300009156 | Populus Rhizosphere | MREGLERWPGENGFASVEAIRGLKDATHVEHVDALIRAQYVSALTDYLSAPVR* |
Ga0105249_129788141 | 3300009553 | Switchgrass Rhizosphere | MREGLERWLGANGFDSVDAIRGLKDASHVDNVDALFRAQYVSSLTDYVPGKLV* |
Ga0134124_124885581 | 3300010397 | Terrestrial Soil | DGLARWLGANGFDSVAAIRGLKDASHVEHVDALFRAQYVASLTDYLPGKLA* |
Ga0150985_1178415371 | 3300012212 | Avena Fatua Rhizosphere | GCVSVDAIRGLKDATHVEHVDALFRAQYVASLTEYLPGKLV* |
Ga0150984_1082444922 | 3300012469 | Avena Fatua Rhizosphere | LERWLEANGYASVDAIRGLKDATHVEHVDALFRAQYVASLTDYVPTKLV* |
Ga0150984_1151997791 | 3300012469 | Avena Fatua Rhizosphere | LERWLDANGFASVDAIRGLKDATHVGHVDALFRAQYGASLTEYLPGKLV* |
Ga0150984_1155016112 | 3300012469 | Avena Fatua Rhizosphere | WLGANGFDSVAAIRGLKDASHVEHVDALFRAQYVASLTEYLPGKLA* |
Ga0157293_100252271 | 3300012898 | Soil | GANGFDSVDAIRGLKDASHVEHVDALFRAQYVASLTEYVPGKLV* |
Ga0157293_100573512 | 3300012898 | Soil | DAIRGLKDATHVEHVDALFRAQYVASLTEYLPGKLV* |
Ga0157295_100107012 | 3300012906 | Soil | TMREGLECWLGANGFDSVDAIRGLKDASHVEHVDALFRAQYVASLTEYVPGKLV* |
Ga0157295_100899361 | 3300012906 | Soil | IRSLKDGTHVDDADAFLRAQYVASLRDYVPGKLVQ* |
Ga0157283_101603411 | 3300012907 | Soil | LREGLERWLGENGFDSVDAIRGLKDATHVEHVDALFRAQYVASLTEYVPGKLV* |
Ga0157290_101280262 | 3300012909 | Soil | FESVDAIRSLKNGTHVDDADAFLRAQYVASLRDYVPGKLVQ* |
Ga0157298_103269981 | 3300012913 | Soil | EGLERWLGENGFDSVDAIRGLKDATHVEHVDALFRAQYVASLTEYVPGKLV* |
Ga0157298_104257241 | 3300012913 | Soil | VEAIRGLKDATHVEHVDALIRAQYVSALTNYLSAPVR* |
Ga0157302_105009851 | 3300012915 | Soil | LGVIRAGLERWLVDNRFDSVDAIRSLKDATHVDDADAFLRAQYVASLRDYVPGKLVQ* |
Ga0164303_113870461 | 3300012957 | Soil | DSVDAIRGLKDATHVEHVDALFRAQYVASLTEYMPGKLV* |
Ga0164299_106104261 | 3300012958 | Soil | ENGFDSVDAIRGLKDATHVEHVDALFRAQYVASLTEYMPGKLV* |
Ga0164304_116120971 | 3300012986 | Soil | TLRDGVSRWLDANRFNSVEAIRGLKDATHAEHVDALFRAQYVAALTEYVPGKLVQ* |
Ga0164306_104072922 | 3300012988 | Soil | VEAIRGLKDATHAEHVDALFRAQYVAALTEYVPGKLVQ* |
Ga0157380_122681342 | 3300014326 | Switchgrass Rhizosphere | DAIRSLKSATHVDDADAFLRAQYVASLRDYVPGKLVQ* |
Ga0180093_11082753 | 3300015258 | Soil | GVMRDGLERWLADNRFDSVDAIRSLKDATHADDADAFLRAQYVASQRDYVPGKLVQ* |
Ga0132258_114055613 | 3300015371 | Arabidopsis Rhizosphere | VDAIRGLKDGTHVEHVDALLRAQYVAALTDYLPASTVR* |
Ga0132256_1013642481 | 3300015372 | Arabidopsis Rhizosphere | GFASVEAIRGLKDATHVDQLDALLRAQYVAALTEYLPAIPIR* |
Ga0132256_1020812272 | 3300015372 | Arabidopsis Rhizosphere | SAIRGLKDATHVEHVDALLRAQYVAALTDYLPGKLVS* |
Ga0132256_1036366641 | 3300015372 | Arabidopsis Rhizosphere | TMRKGLERWLGEHGFDSVSAIRGLKDATHVEHVDALLRAQYVAALTDYLPGKLVS* |
Ga0132256_1037120132 | 3300015372 | Arabidopsis Rhizosphere | GFDSVDAIRGLKDGTHVEHVDALLRAQYVAALTDYLPASTVR* |
Ga0132257_1000204767 | 3300015373 | Arabidopsis Rhizosphere | DSVDAIRGLKDATHVEDVDALFRAQYVAALTEYLPAKLVQ* |
Ga0132257_1022271502 | 3300015373 | Arabidopsis Rhizosphere | RGLKDATQVEHVDALLHAQYVAALTEYVPTKLVQ* |
Ga0132257_1040446771 | 3300015373 | Arabidopsis Rhizosphere | LRHGPRHLAAMRAGLERWLEANGFDSVAAIRGLKDASHVEHVDALFRAQYVASLTDYLPGKLA* |
Ga0132255_1006290291 | 3300015374 | Arabidopsis Rhizosphere | AIRGLKDATHVEHVDALFRAQYVAALTDYLPGKLVQ* |
Ga0163161_114778982 | 3300017792 | Switchgrass Rhizosphere | PEHVATMRDGLARWLGANGFDSVAAIRGLKDASHVEHFDALFRAQYVASLTDYLPGKLA |
Ga0173481_103436413 | 3300019356 | Soil | ERWLEDNRFDSVDAIRSLKNAAHVDDADAFLRAQYVASLRDYVPGKLVQ |
Ga0173482_101224491 | 3300019361 | Soil | NGFDSVNAIRGLKDATHVEQVDALFRAQYVASLTEYLPGKLV |
Ga0173479_100429291 | 3300019362 | Soil | DSVAAIRGLKDASHVEHFDALFRAQYVASLTDYLPGKLA |
Ga0247800_10851941 | 3300023263 | Soil | AIRGLKDATHVDQVDALIRAQYVAALTEYLPATLGR |
Ga0207697_101855642 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | GAFDSVDAIRGLKDASHVDNVDALFRAQYVSSLTDYVPGKLV |
Ga0207652_113758112 | 3300025921 | Corn Rhizosphere | ERWLGENGYDSVDAIRGLKDATHVEGVDALLRAQYVAALTEYLPGKLVQ |
Ga0207681_107898372 | 3300025923 | Switchgrass Rhizosphere | YLASLREGLERWLGENGFDSVDAIRGLKDATHVEHVDALFRAQYVASLTEYLPGKLV |
Ga0207650_102154353 | 3300025925 | Switchgrass Rhizosphere | RDGLARWLGANGFDSVDAIRGLKDASHVEHVDALFRAQYVAALTDYLPGKLVS |
Ga0207709_110285421 | 3300025935 | Miscanthus Rhizosphere | EGLERWLGANGFDSVDAIRGLKDATHVEHVDALLRAQYVAALTEYLPGKLVQ |
Ga0207709_117967682 | 3300025935 | Miscanthus Rhizosphere | AAIRGLKDASHVEHVDALFRAQYVASLTDYLPGKLA |
Ga0207670_114156411 | 3300025936 | Switchgrass Rhizosphere | WLGENGFASVDAIRGLKDATHVEHVDALLRAQYVAALTDYLPATSVR |
Ga0207691_111155371 | 3300025940 | Miscanthus Rhizosphere | DSVDAIRGLKDATHVEHVDALLRAQYVAALTEYLPGKLVQ |
Ga0207711_115444801 | 3300025941 | Switchgrass Rhizosphere | WLERWLGANGFDSVNAIRGLKDATHVEHVDALFRAQYVASLTEYLPGKLV |
Ga0207712_120556942 | 3300025961 | Switchgrass Rhizosphere | SVDAIRGLKDASHVDNVDALFRAQYVSSLTDYVPGKLV |
Ga0207640_111848761 | 3300025981 | Corn Rhizosphere | MREGLERWLGENGFDSVSAIRGLKDATHVEDVDALLRAQYVASLTEYLPGKLVPP |
Ga0207708_110494531 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | WLADNRFDSVDAIRSLKDGTHVDDADAFLRAQYVASLRDYVPGKLVQ |
Ga0207683_112575492 | 3300026121 | Miscanthus Rhizosphere | WLGESGFDSVDAIRGLKDATHVEQVDALLRAQYVAALTEYVPTNLGQ |
Ga0209967_10670141 | 3300027364 | Arabidopsis Thaliana Rhizosphere | MRQGLERWLDANGFTSVDAIRGLKDATHVESVDALLRAQYVAALTDYLPGKLVQ |
Ga0268265_118516861 | 3300028380 | Switchgrass Rhizosphere | GFDSVDAIRGLKDATHVEHLDALFRAQYVASLTEY |
Ga0247828_110793102 | 3300028587 | Soil | MREGLERWLEANGYDSVDAIRGLKDATHVEDIDALLRAQYVAALTDYLPGKLV |
Ga0247824_105034212 | 3300028809 | Soil | HVATMRDGLKRWLVANGFDSVDAIRGLKDATHVEHVDALIRAQYVAALTEYLPGKLVQ |
Ga0247824_108475221 | 3300028809 | Soil | PEYMGVMRDGLERWLVDNGFDSVDAIRSLKGATHVDDADAFLRAQYVASLRDYVPGKLVQ |
Ga0310886_104707782 | 3300031562 | Soil | GENGFDSVDAIRGLKDATHVEHIDALLRAQYVAALTEYLPGKLVQ |
Ga0310886_108248371 | 3300031562 | Soil | MRDGLDRWLSENQFESVDAIRSLKDGTHVDDADAFLRAQYVASLRDYVPGKLVQ |
Ga0318555_103806762 | 3300031640 | Soil | ERWLDENGFDSVDAIRGLKDATHVENVDALLRAQYVAALTEYLPGKLIQ |
Ga0318554_103463161 | 3300031765 | Soil | LERWLDENGFDSVDAIRGLKDATHVENVDALLRAQYVAALTEYLPGKLIQ |
Ga0310900_101693481 | 3300031908 | Soil | AGLERWLEANAFDSVDAIRGLKDATHVDDVDALIRAQYVAALTEYLPGKLVQ |
Ga0310900_106833852 | 3300031908 | Soil | ENAFASVEAIRGLKDATHVDQVDALIRAQYVAALTEYLPATLGR |
Ga0307412_115602792 | 3300031911 | Rhizosphere | MREGLERWLGENGFDSVDAIRGLKDATHVEHVDALLRAQYVAALTEYLPGKLVQ |
Ga0308174_100568543 | 3300031939 | Soil | NRFDSVDAIRGLKDATHVEHVDALLRAQYVSALTEYLPGKLVQ |
Ga0310885_107941542 | 3300031943 | Soil | DSVDAIRGLKDATHVEHVDALLRAQYVAALTDYMPAKLVQ |
Ga0310884_102362023 | 3300031944 | Soil | GLERWLGANGFDSVDAIRGLKDATHVEGVDALLRAQYVAALTEYLPGKLVQ |
Ga0308176_104191213 | 3300031996 | Soil | AIRGLKDATHVEDVDALLRAQYVASLTEYIPGKLVQ |
Ga0310902_103110122 | 3300032012 | Soil | LGEHGFDSVSAIRGLKDATHVEHVDALLRAQYVAALTDYLPGKLVS |
Ga0310902_112161072 | 3300032012 | Soil | REGLERWLGENAFASVEAIRGLKDATHVDQVDALIRAQYVAALTEYLPATLGR |
Ga0318559_105570082 | 3300032039 | Soil | ENAFDSVDAIRGLKDATHAEDVDALLRAQYVAALTEYLPGRLVQ |
Ga0318556_107212832 | 3300032043 | Soil | REGLERWLDENGFDSVDAIRGLKDATHVENVDALLRAQYVAALTEYLPGKLIQ |
Ga0318524_106368452 | 3300032067 | Soil | TMREGLERWLGENGFDSVDAIRGLKDATHAEHVDALIRAQYVAALTEYLPGKLV |
Ga0315910_112621151 | 3300032144 | Soil | FDSVAAVRGLKDATHVEHVDALLRAQYVAALTGYLPATLAR |
Ga0315912_100156501 | 3300032157 | Soil | VAAVRGLKDATHVEHVDALLRAQYVAALTGYLPATLAR |
Ga0307472_1027919131 | 3300032205 | Hardwood Forest Soil | RWLGANGFDSVDAIRGLKDGTHVEHVDALFRAQYVASLTEYLPGKLV |
Ga0364943_0077710_3_110 | 3300034354 | Sediment | IRSLKDGTHVDDADAFLRAQYVASLRDYVPGKLVQ |
⦗Top⦘ |