| Basic Information | |
|---|---|
| Family ID | F097798 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GIEVKLAGAVVRVSSGMDDAAQLTAVLRAVRASASRS |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 5.00 % |
| % of genes near scaffold ends (potentially truncated) | 17.31 % |
| % of genes from short scaffolds (< 2000 bps) | 19.23 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (80.769 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.577 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.231 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.308 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.62% β-sheet: 15.38% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF05717 | TnpB_IS66 | 51.92 |
| PF13007 | LZ_Tnp_IS66 | 28.85 |
| PF13817 | DDE_Tnp_IS66_C | 4.81 |
| PF01527 | HTH_Tnp_1 | 1.92 |
| PF00589 | Phage_integrase | 1.92 |
| PF13683 | rve_3 | 1.92 |
| PF13601 | HTH_34 | 0.96 |
| PF07715 | Plug | 0.96 |
| PF13737 | DDE_Tnp_1_5 | 0.96 |
| PF03050 | DDE_Tnp_IS66 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 52.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 80.77 % |
| All Organisms | root | All Organisms | 19.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_109599153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1497 | Open in IMG/M |
| 3300001546|JGI12659J15293_10069977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 776 | Open in IMG/M |
| 3300001990|JGI24737J22298_10208779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100198639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1896 | Open in IMG/M |
| 3300004082|Ga0062384_101286535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 535 | Open in IMG/M |
| 3300005459|Ga0068867_101393508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
| 3300006059|Ga0075017_101136019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 611 | Open in IMG/M |
| 3300006354|Ga0075021_10430956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 830 | Open in IMG/M |
| 3300012915|Ga0157302_10140458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 810 | Open in IMG/M |
| 3300014169|Ga0181531_10675959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
| 3300014493|Ga0182016_10319933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 942 | Open in IMG/M |
| 3300015373|Ga0132257_102002710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 747 | Open in IMG/M |
| 3300016422|Ga0182039_11753749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 568 | Open in IMG/M |
| 3300022756|Ga0222622_11115482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
| 3300027737|Ga0209038_10182495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
| 3300028709|Ga0307279_10018192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 941 | Open in IMG/M |
| 3300030677|Ga0302317_10199500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 920 | Open in IMG/M |
| 3300031128|Ga0170823_17159537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
| 3300031719|Ga0306917_10494647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 960 | Open in IMG/M |
| 3300031893|Ga0318536_10074335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1676 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.73% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.85% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.85% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 3.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.88% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.92% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.96% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.96% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.96% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.96% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.96% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009510 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
| 3300009701 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010395 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.e | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300015206 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027119 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027504 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300034127 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16 | Environmental | Open in IMG/M |
| 3300034143 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 57SNS | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1095991534 | 3300000955 | Soil | TVQRASSAAAGIEVKLAGAVVRVSSGMDDADQLTVVLRAIRASASRS* |
| JGI12648J13191_10174013 | 3300001084 | Forest Soil | PPGIEVELAGAVVRVSSGMEDAAQLTAVLRAVRASAFRS* |
| JGI12659J15293_100699771 | 3300001546 | Forest Soil | PASVPRAASAPVIEVKLAGAVVRVAAGMDDATQLTAVLRAVRASASRT* |
| JGI12053J15887_102442543 | 3300001661 | Forest Soil | TVPDAAAPVIEVRLAGAVVRVTSGMEDAAQLTAVLRAIRASASRT* |
| C688J18823_100741643 | 3300001686 | Soil | IEVRLAGAVVCVVPGLDDAQLTAVLRAVRASVLRP* |
| JGI12627J18819_102350811 | 3300001867 | Forest Soil | RAASGAPGIEVKLAGAVVRVSSGMDDAAQLTAVLRAVRASASRS* |
| JGI24737J22298_102087792 | 3300001990 | Corn Rhizosphere | AATVQRTASAAPGIEVKLAGAVVRVSSGMDDAAQLTAVLRAVRASASRS* |
| JGIcombinedJ26739_1000908714 | 3300002245 | Forest Soil | VPRAAPAPVIEVKLAGAVVRVAAGMDDATQLTAVLRAVRASASRT* |
| JGIcombinedJ26739_1001986393 | 3300002245 | Forest Soil | MVQRTASAAPGIEVELAGAVVRISSGMDDAGQLTAVLRAVRASASRT* |
| Ga0062384_1012865352 | 3300004082 | Bog Forest Soil | MFLRRVAEHRLPSTAPAIEVKLAGAVVRVACGMDGALLTVVLRAVRAS* |
| Ga0062386_1010281731 | 3300004152 | Bog Forest Soil | ATPAIEVKLAGAVVRVVSGMDDATRLTAVLRAVRASASQT* |
| Ga0068869_1019467291 | 3300005334 | Miscanthus Rhizosphere | AEATAPTIEIRLAGAVVRVGSGMDDTAQLTAVLRAVRASASRT* |
| Ga0070701_101649293 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | AAASAAPVIEVKLAGAVVRVVSNVDDVARLTAVLRAVRASASRA* |
| Ga0070711_1017447581 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ATTVIEVRLAGAVVRVGSDLNDAAPLTAVLRAVRAPASRS* |
| Ga0068867_1013935081 | 3300005459 | Miscanthus Rhizosphere | ATVQRTASAAPGIEVKLAGAVVRVSSGMDDAAQLTAVLRAVRASASRS* |
| Ga0068857_1001509963 | 3300005577 | Corn Rhizosphere | VIEVKLAGAVVRVVSNVDDVARLTAVLRAVRASASRP* |
| Ga0068856_1004761001 | 3300005614 | Corn Rhizosphere | SVIEVKLAGAVVRVVSNVDDVARLTAVLRAVRASASRP* |
| Ga0074479_110130561 | 3300005829 | Sediment (Intertidal) | TPPVIEVGLAGAVVRVVAGMDDIARLTAVLRAVRASASPG* |
| Ga0068863_1007081011 | 3300005841 | Switchgrass Rhizosphere | APSPASAATVIEVRLAGAVVRVGSDLNDAVPLTAVLRAVRAPASRS* |
| Ga0070766_106778643 | 3300005921 | Soil | IEVKLAGAVVRVAAGMDDATQLTAVLRAVRASASRT* |
| Ga0066787_101573921 | 3300005950 | Soil | IEVRLAGAVVRISGIDDGAQLTAVLRAVRASASKG* |
| Ga0066789_100922483 | 3300005994 | Soil | VAPVIEVRLAGAVVRISGIDDGAQLTAVLRAVRASASKG* |
| Ga0066789_102840793 | 3300005994 | Soil | AASVIEVRLAGAVVRVTSGMDDAAQLTAVLRAIRASASRT* |
| Ga0075024_1002909213 | 3300006047 | Watersheds | PGIEVELAGAVVRISSGMDDAGQLTAVLRAVRASASRT* |
| Ga0075017_1011360191 | 3300006059 | Watersheds | VKLAGAVVRVAGGMDDAAQLTAVLRAVRASASRT* |
| Ga0075015_1002208761 | 3300006102 | Watersheds | VPRASPAPVIEVKLAGAVVRVAAGMDDATQLTAVLRAVRASASRT* |
| Ga0070712_1006549143 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ASAAPGIEVKLAGAVVRVSSGMDDAAQLTAVLRAVRASASRS* |
| Ga0075021_104309561 | 3300006354 | Watersheds | PTVPRAAPAPVIEVKLAGAVVRVAAGMDDATQLTAVLRAVRASASRT* |
| Ga0079221_108922653 | 3300006804 | Agricultural Soil | LASPVIEVRLAGAVVRVVSGLDEAQLTAVLRAVRASVLRA* |
| Ga0105245_112106211 | 3300009098 | Miscanthus Rhizosphere | STPSPPVIEVRLAGAVVRVAPGMDNTAQLTAVLRAIRASASRT* |
| Ga0116230_100935332 | 3300009510 | Host-Associated | VIEVKLAGAVVRVVSGSDDGTQLAAVLRAVRASATGK* |
| Ga0116230_103780671 | 3300009510 | Host-Associated | PPRAAAAIAPVIEVKLAGAVVRVSGIDDGAQLTAVLRAVRASASKG* |
| Ga0105855_11038601 | 3300009649 | Permafrost Soil | VPVIEVRLAGAVVRVMSGAIDAAQLTAVLRALRASASRT* |
| Ga0116228_104403123 | 3300009701 | Host-Associated | AAVIEVKLAGAVVRVVSGSDDGTQLAAVLRAVRASVTGK* |
| Ga0116227_100650016 | 3300009709 | Host-Associated | ARKAGAAPIIEVKLAGATVRVSELGDGAELTAVLRAIRASAAKA* |
| Ga0126313_107032193 | 3300009840 | Serpentine Soil | VIEVRLAGAVVRVVSGLDDAQLTTVLRAVRASVLRA* |
| Ga0126314_107209021 | 3300010042 | Serpentine Soil | EHAAIEVELADAVVRVVPGVDDGLLAAVLRAVRASAA* |
| Ga0126310_105154931 | 3300010044 | Serpentine Soil | VASPVIEVSLAGAVVRVVSGLDDAQLTTVLRAVRASVLRA* |
| Ga0126310_117386152 | 3300010044 | Serpentine Soil | ASAAIEIRLAGAVVRADPGTDAEQLTAVLRAVRRSAAPS* |
| Ga0074044_109460271 | 3300010343 | Bog Forest Soil | VIEVRLAGAVVRITSSMDDAAQLTAVLRAIRASASRA* |
| Ga0126378_102525631 | 3300010361 | Tropical Forest Soil | GIEVKLAGAVVRVSSGMDDAAQLTAVLRAVRASALRS* |
| Ga0058701_107727592 | 3300010395 | Agave | VLARPVIEVRLAGAVVRVVSGPDDAQLTAVLRAIRASVLRA* |
| Ga0137398_105218623 | 3300012683 | Vadose Zone Soil | PVIEIKLAGAVVRVGSSMDDAAVLTTVLRAVRASASSA* |
| Ga0157302_101404583 | 3300012915 | Soil | STRAAPSVPVIEVKLAGAVVRVVGGQHDGSQLTAVLRAVRASASRS* |
| Ga0168317_10673641 | 3300012982 | Weathered Mine Tailings | EVKLAGAVVRVVSGLEDDAQLTAVLRAVRASASKP* |
| Ga0164308_110477871 | 3300012985 | Soil | TVIEVKLAGAVVRIGSDLSDAGPLTTVLRAVRASASRT* |
| Ga0181531_106759591 | 3300014169 | Bog | ETVPHAEAVAPMIEIRLAGAVVRVVSGMDDAAQLTAVLRAVRASASRA* |
| Ga0181537_106274253 | 3300014201 | Bog | VPIVSAATRPAPGPRMTPAASVIEVQLAGAVVRVSGLGDGAELAVVLRAIRASASEG* |
| Ga0182016_103199331 | 3300014493 | Bog | VTTVPPTSAPVIEVRLAGAVVRVVCDMDDTAQLTAVLRAVRASASRA* |
| Ga0167644_11685101 | 3300015206 | Glacier Forefield Soil | IEIKLAGAVVRVVSGMDDAAQLTAVLRAVRASASRT* |
| Ga0132256_1001348341 | 3300015372 | Arabidopsis Rhizosphere | EVKLAGAVVRVSSGMDDADQLTVVLRAIRASASRS* |
| Ga0132257_1020027103 | 3300015373 | Arabidopsis Rhizosphere | QRAASAAWGIEGELAGAVVRGSSGIDDAAQLIAVLRAVRALASP* |
| Ga0132257_1030402731 | 3300015373 | Arabidopsis Rhizosphere | AATVIEVRLAGAVVRVGSDLNDAVPLTAVLRAVRAPASRS* |
| Ga0182039_110317481 | 3300016422 | Soil | RAAPARGIEVKLAGAVVRVSSGMDDAAQLTAVLRAVRASALRS |
| Ga0182039_117537492 | 3300016422 | Soil | ATVQRAASVAREIEVKLAGAVVRVSPGMADAEQLTAVLRAIRASASRS |
| Ga0187879_100610991 | 3300017946 | Peatland | IEIRLAGAVVRVVSGMDDAAQLTAVLRAVRASASRA |
| Ga0187847_102308763 | 3300017948 | Peatland | SAAPAIEVKLAGAVVRVVSGMDDATRLTSVLRAVRASASRR |
| Ga0181520_105467193 | 3300017988 | Bog | EVRLAGAVVRVVSGLEDDARLTAVLRAVRASASKG |
| Ga0187855_101886301 | 3300018038 | Peatland | PSAAPAIEVKLAGAVVRVVSGMDDATRLTSVLRAVRASASRR |
| Ga0187858_102927763 | 3300018057 | Peatland | MTPEPPVIEVRLAGAVVRVVSGADDPAQLTAVLRAVRASASR |
| Ga0190275_129838431 | 3300018432 | Soil | SPATTVTTKIEVKLAGAVVRVGSDLSDAGPLTAVLRAVRASASRT |
| Ga0190270_112737511 | 3300018469 | Soil | APGIEVKLAGAVVRVSSGMDDAVQLTAVLRAVRASASRS |
| Ga0190267_101439471 | 3300019767 | Soil | PVIEVRLAGAVVRVVSGLDDAQLTAVLRAVRASVLRA |
| Ga0190267_102095573 | 3300019767 | Soil | VIEVRLADAVVRVVSGLDDAQLTAVLRAVRASASPA |
| Ga0210405_102454931 | 3300021171 | Soil | EVKLAGAVVRVSSGMDDAAQLTAVLRAVRASASRS |
| Ga0193699_102423691 | 3300021363 | Soil | AASTASGIEVKLAGAVVRVSSGMDDAAQLTAVLRAVRASASRS |
| Ga0210386_114130633 | 3300021406 | Soil | PAIEVKLAGAVVRVASGMDDAAQLTVVLRAVRASASRA |
| Ga0222622_111154822 | 3300022756 | Groundwater Sediment | TVQRTASVAPGIEVKLAGAVVRVSSGMDDAAQLTAVLRAVRASASRS |
| Ga0247794_100836273 | 3300024055 | Soil | APVIEVKLAGAVVRVVSGLEDGAQLTAVLRAVRASASRP |
| Ga0209109_100438304 | 3300025160 | Soil | SLEGAPAATSAPMIAVEIAGAVVRVVRGIDGALLTSVLRAVRASAA |
| Ga0209002_101252083 | 3300025289 | Soil | LSLEGAPAATSAPMIAVEIAGAVVRVVRGIDGALLTSVLRAVRASAA |
| Ga0207694_109808481 | 3300025924 | Corn Rhizosphere | AASVIEVKLAGAVVRVVSNVDDVAWLTAVLRAVRASASRP |
| Ga0207709_114156681 | 3300025935 | Miscanthus Rhizosphere | QCTASAAPGIEVKLAGAVVRVSSGMDDAAQLTAVLRAVRASASRS |
| Ga0207702_103257311 | 3300026078 | Corn Rhizosphere | AASVIEVKLAGAVVRVVSNVDDVARLTAVLRAVRASASRP |
| Ga0207855_10219271 | 3300027039 | Tropical Forest Soil | RIVVHGVDAPGIAGAVVRVSPGLDDAAQLTAVLRAIRASASRS |
| Ga0209522_10047901 | 3300027119 | Forest Soil | MPPSAAPAIEVKVAGAVVRVVSGMDDAAQLTAVLRAVRASASRT |
| Ga0209114_10032171 | 3300027504 | Forest Soil | AIEVKLAGAVVRVASGIDDAAQLTAVLRAVRASASRR |
| Ga0209038_101824951 | 3300027737 | Bog Forest Soil | SSAAPAIEVKLAGAVVRVASGMDDAAQLTAVLRAVRASASRT |
| Ga0209275_100106361 | 3300027884 | Soil | IEVKLAGAVVRVACGMDGALLTAVLRAVRASASRT |
| Ga0307279_100181921 | 3300028709 | Soil | TTVQRAASAASGIEVKLAGAVVRVSSGMDDAAQLTAVLRAVRASASRS |
| Ga0307318_100620143 | 3300028744 | Soil | GIEVKLAGAVVRVSSGMDDAAQLTAVLRAVRASASRS |
| Ga0307316_100201171 | 3300028755 | Soil | IEVKLAGAVVRVSSGMDDAAQLTAVLRAVRVSASRS |
| Ga0302232_105774862 | 3300028789 | Palsa | PHAEAVAPMIEIRLAGAVVRVVSGMDDAAQLTAVLRAVRASASRA |
| Ga0311329_106734931 | 3300029907 | Bog | MRRAAPAVPVIEVKLAGAVVHVSEPGDGVALTAVLRAIRASVVKA |
| Ga0311352_104876993 | 3300029944 | Palsa | PSTAPAIEVKLVGAVVRVACGMDGALLTAVLRAVRASASRT |
| Ga0311334_112178693 | 3300029987 | Fen | PAAPACIEITLSGAVLRVVPGTDSAQLAAVLRAVRASATRS |
| Ga0302178_101822522 | 3300030013 | Palsa | MIEIRLAGAVVRVVSGMDDAAQLTAVLRAVRASASRA |
| Ga0311372_121847783 | 3300030520 | Palsa | KAAASPVIEVMLAGAVVRVSGLGDDAELTCVLRAIRASASNA |
| Ga0302317_101995001 | 3300030677 | Palsa | RAAGPRAALALPVIEVKLAGAVIRVVSGSDDGTQLAAVLRAVRASAAEK |
| Ga0308183_10477093 | 3300030988 | Soil | VIEVRLAGAVVRVVSGLDDTQLTAVLRAVRASALRA |
| Ga0170823_171595371 | 3300031128 | Forest Soil | TVQRATSAALGIEVKLAGAVVRVSSGMDDAAQLTAVLRAVRASASRS |
| Ga0302323_1034729042 | 3300031232 | Fen | PPASVAAATAPVIEVRLAGAVVRVSGIDDGAQLTAVLRAVRASASKG |
| Ga0302324_1024267351 | 3300031236 | Palsa | TGPAPRSRMASAASVIEVELAGAVVRVSGLGDGAELTAVLRAIRASASEG |
| Ga0318496_105537003 | 3300031713 | Soil | IEVRLAGAVVRIASDVDDTAQLTAVLRAIRASASGT |
| Ga0307476_100857444 | 3300031715 | Hardwood Forest Soil | APAIEVKLAGAVVRVASGIDDATQLTAVLRAVRASASRT |
| Ga0306917_104946471 | 3300031719 | Soil | ATVQRAASVTPEIEVKLAGAVVRVSAGMADAAQLTAVLRAVRASASRS |
| Ga0318517_101329423 | 3300031835 | Soil | PAPVIEVRLAGAVVRIASDVDDTAQLTAVLRAIRASASGT |
| Ga0318536_100743354 | 3300031893 | Soil | VQRAASVTPEIEVKLAGAVVRVSAGMADAAQLTAVLRAVRASASRS |
| Ga0335085_105460132 | 3300032770 | Soil | ELPSRAAAAVAPVIEVKLAGAVVRVSGIDDDAQLTAVLRAVRASASKG |
| Ga0335083_113835962 | 3300032954 | Soil | VVEVKLAGAVVRVSGIDDDAQLTAVLRAARASASKG |
| Ga0370489_0042394_1207_1314 | 3300034127 | Untreated Peat Soil | EVKLAGAVVRVASNMDDAAQLTAVLRAVRASASPT |
| Ga0334961_079238_65_181 | 3300034143 | Sub-Biocrust Soil | MERAAVEVEIAGAVVRVLPGVDDGPLTAVLRAVRASAA |
| Ga0372943_0093105_1612_1734 | 3300034268 | Soil | LATSVIEINLAGAVVRVVSGLDDAQLTAVLRAVRASALRA |
| Ga0372946_0620669_395_523 | 3300034384 | Soil | PRSVAAVVEIQLADAVVRVASGIDGALLTAVLRAVRASASRA |
| ⦗Top⦘ |