| Basic Information | |
|---|---|
| Family ID | F097786 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 44 residues |
| Representative Sequence | NPPYGADEYLREAYGAIHQGIAAAGAGYVEVARLTPERMAQ |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.94 % |
| % of genes near scaffold ends (potentially truncated) | 93.27 % |
| % of genes from short scaffolds (< 2000 bps) | 90.38 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.269 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.423 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.115 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.038 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.99% β-sheet: 0.00% Coil/Unstructured: 71.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF14357 | DUF4404 | 63.46 |
| PF11859 | DUF3379 | 17.31 |
| PF08281 | Sigma70_r4_2 | 5.77 |
| PF00490 | ALAD | 3.85 |
| PF00067 | p450 | 1.92 |
| PF08501 | Shikimate_dh_N | 0.96 |
| PF02852 | Pyr_redox_dim | 0.96 |
| PF00709 | Adenylsucc_synt | 0.96 |
| PF12323 | HTH_OrfB_IS605 | 0.96 |
| PF01230 | HIT | 0.96 |
| PF00144 | Beta-lactamase | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 3.85 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 1.92 |
| COG0104 | Adenylosuccinate synthase | Nucleotide transport and metabolism [F] | 0.96 |
| COG0169 | Shikimate 5-dehydrogenase | Amino acid transport and metabolism [E] | 0.96 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.96 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.27 % |
| Unclassified | root | N/A | 31.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10282217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 605 | Open in IMG/M |
| 3300001413|JGI20180J14839_1013791 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100346797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1366 | Open in IMG/M |
| 3300004080|Ga0062385_10874739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 594 | Open in IMG/M |
| 3300004152|Ga0062386_101242071 | Not Available | 619 | Open in IMG/M |
| 3300004635|Ga0062388_102183617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300005148|Ga0066819_1007607 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 724 | Open in IMG/M |
| 3300005163|Ga0066823_10123259 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300005591|Ga0070761_10924135 | Not Available | 552 | Open in IMG/M |
| 3300005712|Ga0070764_10519049 | Not Available | 718 | Open in IMG/M |
| 3300006050|Ga0075028_100230278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1011 | Open in IMG/M |
| 3300006050|Ga0075028_100678987 | Not Available | 618 | Open in IMG/M |
| 3300006050|Ga0075028_100879866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300006052|Ga0075029_100472755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 824 | Open in IMG/M |
| 3300006052|Ga0075029_100602946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 734 | Open in IMG/M |
| 3300006052|Ga0075029_100780437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300006086|Ga0075019_10327515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 926 | Open in IMG/M |
| 3300006175|Ga0070712_101103354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
| 3300009624|Ga0116105_1063293 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300009665|Ga0116135_1383150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 568 | Open in IMG/M |
| 3300009701|Ga0116228_10919717 | Not Available | 584 | Open in IMG/M |
| 3300010343|Ga0074044_10890890 | Not Available | 582 | Open in IMG/M |
| 3300010877|Ga0126356_10126716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 665 | Open in IMG/M |
| 3300011271|Ga0137393_11787738 | Not Available | 503 | Open in IMG/M |
| 3300012361|Ga0137360_11831788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 513 | Open in IMG/M |
| 3300012927|Ga0137416_12267030 | Not Available | 500 | Open in IMG/M |
| 3300012982|Ga0168317_1070488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 819 | Open in IMG/M |
| 3300014638|Ga0181536_10369312 | Not Available | 648 | Open in IMG/M |
| 3300014654|Ga0181525_10714349 | Not Available | 563 | Open in IMG/M |
| 3300014838|Ga0182030_10630077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1026 | Open in IMG/M |
| 3300015053|Ga0137405_1408430 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300015164|Ga0167652_1089574 | Not Available | 505 | Open in IMG/M |
| 3300015168|Ga0167631_1022166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 1002 | Open in IMG/M |
| 3300015193|Ga0167668_1031190 | Not Available | 1173 | Open in IMG/M |
| 3300015203|Ga0167650_1114678 | Not Available | 579 | Open in IMG/M |
| 3300017948|Ga0187847_10222261 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300017975|Ga0187782_11073689 | Not Available | 628 | Open in IMG/M |
| 3300018047|Ga0187859_10467622 | Not Available | 699 | Open in IMG/M |
| 3300019890|Ga0193728_1084077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1494 | Open in IMG/M |
| 3300020579|Ga0210407_11159998 | Not Available | 583 | Open in IMG/M |
| 3300020580|Ga0210403_10120511 | All Organisms → cellular organisms → Bacteria | 2134 | Open in IMG/M |
| 3300020582|Ga0210395_10897245 | Not Available | 659 | Open in IMG/M |
| 3300021168|Ga0210406_10080456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2788 | Open in IMG/M |
| 3300021180|Ga0210396_11291468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 608 | Open in IMG/M |
| 3300021181|Ga0210388_10344193 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300021401|Ga0210393_11420699 | Not Available | 554 | Open in IMG/M |
| 3300021405|Ga0210387_10034749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3993 | Open in IMG/M |
| 3300021405|Ga0210387_10980760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 741 | Open in IMG/M |
| 3300021420|Ga0210394_10342832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1312 | Open in IMG/M |
| 3300021420|Ga0210394_10883052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 778 | Open in IMG/M |
| 3300021420|Ga0210394_11607602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 547 | Open in IMG/M |
| 3300021474|Ga0210390_10324533 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300021477|Ga0210398_11320739 | Not Available | 566 | Open in IMG/M |
| 3300022557|Ga0212123_10451028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 848 | Open in IMG/M |
| 3300022722|Ga0242657_1086539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae | 752 | Open in IMG/M |
| 3300023101|Ga0224557_1199084 | Not Available | 698 | Open in IMG/M |
| 3300025414|Ga0208935_1038205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae | 638 | Open in IMG/M |
| 3300025612|Ga0208691_1064626 | Not Available | 826 | Open in IMG/M |
| 3300025634|Ga0208589_1028679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1530 | Open in IMG/M |
| 3300027432|Ga0209421_1028536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1087 | Open in IMG/M |
| 3300027867|Ga0209167_10691828 | Not Available | 557 | Open in IMG/M |
| 3300027884|Ga0209275_10593142 | Not Available | 635 | Open in IMG/M |
| 3300027889|Ga0209380_10053068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2301 | Open in IMG/M |
| 3300028036|Ga0265355_1001349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1575 | Open in IMG/M |
| 3300028742|Ga0302220_10270552 | Not Available | 622 | Open in IMG/M |
| 3300028780|Ga0302225_10187362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 997 | Open in IMG/M |
| 3300028808|Ga0302228_10290593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 733 | Open in IMG/M |
| 3300028879|Ga0302229_10057674 | All Organisms → cellular organisms → Bacteria | 1912 | Open in IMG/M |
| 3300028906|Ga0308309_10128527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2008 | Open in IMG/M |
| 3300029911|Ga0311361_10992732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 704 | Open in IMG/M |
| 3300029913|Ga0311362_10185781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2422 | Open in IMG/M |
| 3300029944|Ga0311352_10195642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1726 | Open in IMG/M |
| 3300029945|Ga0311330_10702138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 779 | Open in IMG/M |
| 3300029951|Ga0311371_11612447 | Not Available | 714 | Open in IMG/M |
| 3300029997|Ga0302302_1288791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 594 | Open in IMG/M |
| 3300030011|Ga0302270_10078323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2157 | Open in IMG/M |
| 3300030051|Ga0302195_10498175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 519 | Open in IMG/M |
| 3300030507|Ga0302192_10094954 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300030509|Ga0302183_10155409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 897 | Open in IMG/M |
| 3300030580|Ga0311355_11187285 | Not Available | 674 | Open in IMG/M |
| 3300030707|Ga0310038_10477835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 530 | Open in IMG/M |
| 3300030813|Ga0265750_1051083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 626 | Open in IMG/M |
| 3300031027|Ga0302308_10291415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1010 | Open in IMG/M |
| 3300031057|Ga0170834_101845452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 729 | Open in IMG/M |
| 3300031057|Ga0170834_103553373 | Not Available | 525 | Open in IMG/M |
| 3300031128|Ga0170823_15094337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 936 | Open in IMG/M |
| 3300031233|Ga0302307_10299142 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300031234|Ga0302325_11273332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 970 | Open in IMG/M |
| 3300031247|Ga0265340_10422286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 588 | Open in IMG/M |
| 3300031474|Ga0170818_107723691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 544 | Open in IMG/M |
| 3300031474|Ga0170818_110611737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → unclassified Chromatiales → Chromatiales bacterium | 999 | Open in IMG/M |
| 3300031672|Ga0307373_10100357 | Not Available | 2512 | Open in IMG/M |
| 3300031708|Ga0310686_108351259 | Not Available | 684 | Open in IMG/M |
| 3300031708|Ga0310686_116031249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1248 | Open in IMG/M |
| 3300031718|Ga0307474_10300479 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300031718|Ga0307474_11504285 | Not Available | 530 | Open in IMG/M |
| 3300032180|Ga0307471_101599148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 808 | Open in IMG/M |
| 3300032180|Ga0307471_102426571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 663 | Open in IMG/M |
| 3300032515|Ga0348332_11718768 | Not Available | 622 | Open in IMG/M |
| 3300033822|Ga0334828_139019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 568 | Open in IMG/M |
| 3300033887|Ga0334790_111094 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300034199|Ga0370514_066857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 908 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.42% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 11.54% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.73% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.77% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 4.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.81% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.88% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.92% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.92% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.92% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.96% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.96% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.96% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.96% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.96% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.96% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.96% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001413 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005148 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMA | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009701 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015164 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300029997 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033822 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_102822171 | 3300001356 | Peatlands Soil | GSGLMIVNPPFGADEYLATAYAAIHRGIAAPGAGYVEVARLTPEKL* |
| JGI20180J14839_10137911 | 3300001413 | Arctic Peat Soil | PDDAGLGLAGSGLMIVNPPYGADEFLTAAYGAIHRGIAAAGAGYVEVARLTPEKL* |
| JGIcombinedJ26739_1003467971 | 3300002245 | Forest Soil | LVNPPYGADDFLREAYLAIHASLAEAGRGYVEVARLTAERMAQ* |
| Ga0062385_108747391 | 3300004080 | Bog Forest Soil | AGVGLAGSGLMIVNPPFGADEYLREAYEAIQRGIAAPNSGYVEVARLTPERMAQ* |
| Ga0062386_1012420713 | 3300004152 | Bog Forest Soil | PPYGADEYLQRSYGAIHAGLTDSSSGYVEVTRLTGERVAQ* |
| Ga0062388_1021836171 | 3300004635 | Bog Forest Soil | AGSGLMIVNPPYGADEYLRRAYAAIHEGIALPGAGYVEVARLTPERMAL* |
| Ga0066819_10076071 | 3300005148 | Soil | AGSGLMIVNPPYGADDYLNDAYAAIHKGIAAPGSGYVEIARLTPERMAQ* |
| Ga0066823_101232592 | 3300005163 | Soil | SGLMIVNPPYGADDYLNDAYAAIHKGIAAPGSGYVEIARLTPERMAQ* |
| Ga0070761_109241351 | 3300005591 | Soil | NPPHGADEYLTGAYAAIHQGIATSGSGYVEVARLTPERMAQ* |
| Ga0070764_105190493 | 3300005712 | Soil | DNYLSDAYAAIHKVIASSGSGYVEVTRLTPERMAQ* |
| Ga0075028_1002302781 | 3300006050 | Watersheds | PDDAGVGLAGSGLMIVNPPFGTDEYLTRAYATIREGIATPKAGYVEVGRLTPERMAQ* |
| Ga0075028_1006789871 | 3300006050 | Watersheds | VVNPPYGADDFLMQAYGVIHGAVAAAGAGYVEVARLTPELMAK* |
| Ga0075028_1008798661 | 3300006050 | Watersheds | GVGLAGSGLMIVNPPYGADDYLNDAYAAIHKGIAAPGSGYVEIARLTPERMAQ* |
| Ga0075029_1004727553 | 3300006052 | Watersheds | IVNPPYGADDHLREAYTAVHRAIAAAGAGYVEVDRLTPERMAQ* |
| Ga0075029_1006029463 | 3300006052 | Watersheds | VGLAGSGLMIANPPYGADEFLGEAYARLHELIGTPAMGYVEVARLTPERVAS* |
| Ga0075029_1007804371 | 3300006052 | Watersheds | GLLIVNPPYGADDHLLEAYSAIHSAVAAAGSGYVEVARLTPERVAQ* |
| Ga0075019_103275151 | 3300006086 | Watersheds | LIVNPPYGADDHLREAYTAVHRAIAAAGAGYVEVDRLTPERMAQ* |
| Ga0070712_1011033543 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AGVGLAGSGLMIVNPPYGADDYLNDAYAAIHKGIAAPGSGYVEIARLTPERMAQ* |
| Ga0116105_10632931 | 3300009624 | Peatland | YGADEHLTAAYAAIHRGVAPATDAGYVEVARLTPEQL* |
| Ga0116135_13831503 | 3300009665 | Peatland | GVGLAGSGLIIVNPPYGADEFLASAYSAVHRILAPSGSGYVEVARLTPERMAQ* |
| Ga0116228_109197171 | 3300009701 | Host-Associated | NPPYGADTYLQQAYSAIHGAIADPGAGYVEVTRLTPERIAR* |
| Ga0074044_108908901 | 3300010343 | Bog Forest Soil | GSGLIIVNPPYGADDYLAGAYAAIHQGIATPGAGYVEVARLTAERAGH* |
| Ga0126356_101267161 | 3300010877 | Boreal Forest Soil | AGSGLLIVNPPYGADQFLRDAYGAIHQAIATAGAGYVEVARLTPERMAQ* |
| Ga0137393_117877382 | 3300011271 | Vadose Zone Soil | AGSGLMVVNPPYGADDFLNQAYEVIHGAVAAAGAGYVEVARLTPELMAK* |
| Ga0137360_118317881 | 3300012361 | Vadose Zone Soil | AGVGLAGSGLMIVNPPHGTDEYLRDAYAAIHSGIAVPGAGYVEVGRLTPERMAQ* |
| Ga0137416_122670301 | 3300012927 | Vadose Zone Soil | IVNPPFGTDAYLRAAYAAIHAGIAASGAGYVAVTRLTPERMAQ* |
| Ga0168317_10704881 | 3300012982 | Weathered Mine Tailings | VNPPYGADDYLAAAYAAIHRILAPSGAGYVEVARLTPERMAQ* |
| Ga0181536_103693123 | 3300014638 | Bog | PPYGADEYLQNAYTTVHQGIAAPGSGYVEVARLTRERMAQ* |
| Ga0181525_107143493 | 3300014654 | Bog | DYLSGAYAAVHQGIAARGAGYVEVGRLTPERMAQ* |
| Ga0182030_106300771 | 3300014838 | Bog | DAGVGLAGSGLAIVNPPHGTDEYLSDAYAAIHRGIAPTGAGYVEVARLTPERMAQ* |
| Ga0137405_14084302 | 3300015053 | Vadose Zone Soil | VIVNPPYGADQFLRDAYTAIHRVIAAAGAGYVEVARLTPERVAQ* |
| Ga0167652_10895741 | 3300015164 | Glacier Forefield Soil | PYGTDSYLREAYAAVHDAVASAGAGYVEVARLTPERMSQ* |
| Ga0167631_10221661 | 3300015168 | Glacier Forefield Soil | GSGLMIVNPPYGADQFLRDAYAAIHQGIGAPGAGYVEVGRLTPERMAH* |
| Ga0167668_10311903 | 3300015193 | Glacier Forefield Soil | LLIVNPPYGADDYLRNAYAMIHRGIAAPGAGYVEVGRLTAERMAQ* |
| Ga0167668_10725503 | 3300015193 | Glacier Forefield Soil | DDFLQQAYGSIHSAVAAAGAGYVEVARLTPELVAK* |
| Ga0167650_11146783 | 3300015203 | Glacier Forefield Soil | PPYGADDHLRDAYTAIHRGIATPGAGYVEVGRLTPERMAQ* |
| Ga0187847_102222613 | 3300017948 | Peatland | LAGSGLMIVNPPFGADEYLASAYAAIHRGIAAADAGYVEVARLTPEKL |
| Ga0187782_110736891 | 3300017975 | Tropical Peatland | VNPPFGADEFLASAYAAVHEALAMAGAGYVEVARLTPEQMA |
| Ga0187859_104676223 | 3300018047 | Peatland | NPPFGTDADLKSAYGVIHGALAPAAGAGYVEVARLTPERMAQ |
| Ga0193728_10840771 | 3300019890 | Soil | GSGLMIVNPPYGTDEYLREAYAAIHSGIAASGAGYVEVARLTPERMAQ |
| Ga0210407_111599981 | 3300020579 | Soil | PYGTDEYLQRAYGAIHGALGDSGVGYVEVARLTAERVAQ |
| Ga0210403_101205115 | 3300020580 | Soil | NPPYGADEYLREAYGAIHQGIAAAGAGYVEVARLTPERMAQ |
| Ga0210395_108972451 | 3300020582 | Soil | DEFFRDAYGAIHQAIAAAGAGYVEVARLTPERLAQ |
| Ga0210406_100804561 | 3300021168 | Soil | ADQFLRDAYGAIHQAIAPAGAGYVEVARLTPERMAQ |
| Ga0210396_112914681 | 3300021180 | Soil | GLAGSGLMIVNPPYGTDEYLTDAYAAIHQGIAAPGAGYVEVARLTAERVAH |
| Ga0210388_103441934 | 3300021181 | Soil | VNPPYGADEFLSAAYSAVHRTLAPAGSGYVEVERLTPERMAQ |
| Ga0210393_114206991 | 3300021401 | Soil | LMVVNPPYGADDFLKQAYEAIHGRVAAAGAGYVEVARLTPELMAQ |
| Ga0210387_100347491 | 3300021405 | Soil | IVNPPYGADDFFRDAYGAIHQAIAAAGAGYVEVARLTPERLAQ |
| Ga0210387_109807601 | 3300021405 | Soil | VNPPYGADQFLRDAYGVIHQAIAAPGAGYVEVDRLTPERMAQ |
| Ga0210394_103428324 | 3300021420 | Soil | PPYGADEFLSGAYAAIHRGIATPGAGYVEVARLTPERMAQ |
| Ga0210394_108830523 | 3300021420 | Soil | LAGSGLMIVNPPYGADEYLRRAYTAIHKGIASPGAGYVEVARLTPERMAL |
| Ga0210394_116076021 | 3300021420 | Soil | GSGLMIVNPPYGTDDYLRDAYTAIHSGIAAPGAGYVEVARLTPERMAQ |
| Ga0210390_103245331 | 3300021474 | Soil | LIVNPPYGADEYLRRAYTAIHEGIAVPGAGYVEVARLTPERMAL |
| Ga0210398_113207391 | 3300021477 | Soil | GADQHLADAYSAIHGGIATPGAGYVEVGRLTPERVAQ |
| Ga0212123_104510283 | 3300022557 | Iron-Sulfur Acid Spring | DEYLRAAYTAIHAGIAASGAGYVEVARLTPERMAQ |
| Ga0242657_10865391 | 3300022722 | Soil | VNPPYGADEYLRAAYGAIHQGIAAAGAGYVEVARLTPEGMAQ |
| Ga0224557_11990841 | 3300023101 | Soil | GADDYLQEAYAAIHGAIATAGSGYVEVARLTPERMAQ |
| Ga0208935_10382052 | 3300025414 | Peatland | YGADEHLTAAYAAIHRGVAPATDAGYVEVARLTPEQL |
| Ga0208691_10646263 | 3300025612 | Peatland | GADEFLASAYSAVHRILAPSGSGYVEVARLTPERMAQ |
| Ga0208589_10286791 | 3300025634 | Arctic Peat Soil | AGSGLLIVNPPYGADEYLSEAYTAIHRGIAVPGAGYVEVVRLTPERVAQ |
| Ga0209421_10285363 | 3300027432 | Forest Soil | GLMIVNPPYGADGFLRDAYGAIHQGIAAPGAGYVEVARLTPERMAQ |
| Ga0209167_106918281 | 3300027867 | Surface Soil | AGSGLLIVNPPYGADEYLRRAYTAIHEGIALPGAGYVDVTRLTPERMAQ |
| Ga0209275_105931423 | 3300027884 | Soil | YGTDEYLTDAYAAIHQGIAAPGAGYVEVARLTAERVAH |
| Ga0209380_100530681 | 3300027889 | Soil | PYGADDFLRQAYQAIHASLAEAGRGYVEVARLTAERMAQ |
| Ga0265355_10013491 | 3300028036 | Rhizosphere | MIVNPPYGADQFLRDAYSAIHQAIAAPGAGYVEVARLTPERMAH |
| Ga0302220_102705521 | 3300028742 | Palsa | ASVGLAGSGLLLVNPPYGADDFLREAYLAIHASLAEAGRGYVEVARLTPERMAQ |
| Ga0302225_101873623 | 3300028780 | Palsa | LMVINPPFGADEYLRAAYTAIHAGLAAAGSGYVEVDRLTPERIN |
| Ga0302228_102905933 | 3300028808 | Palsa | AGSGLLLVNPPYGADDFLREAYAAIHDSLAEAGRGYVEVARLTPERMAQ |
| Ga0302229_100576741 | 3300028879 | Palsa | SVGLAGSGLLLVNPPYGADDFLREAYLAIHASLAEAGRGYVEVARLTPERMAQ |
| Ga0308309_101285271 | 3300028906 | Soil | GLMIVNPPYGADQYLRDAYGAIHHAIAVPGAGYVEVVRLTPERLAQ |
| Ga0311361_109927321 | 3300029911 | Bog | MLINPPFGADEYLRAAYTAIHAGIAAAGSGYVEVNRLTPERIG |
| Ga0311362_101857811 | 3300029913 | Bog | GLVMVNPPHGTDEFLAAAYSAIHRTLAAPDAGYVEVARLTAERMAQ |
| Ga0311352_101956421 | 3300029944 | Palsa | GVGLAGSGLMIVNPPYGTDEYLTDAYAAIHQGIAAPGAGYVEVARLTAERVAH |
| Ga0311330_107021381 | 3300029945 | Bog | GADEALADAYTAIHSALAAPGAGYVEVARLTSERMAQ |
| Ga0311371_116124473 | 3300029951 | Palsa | PPFGADADLKIAYGVIHGALAPAGAGYVEVARLTPERMAQ |
| Ga0311336_103032074 | 3300029990 | Fen | DAFLKQAYEVIHGAVAASGAGYVEVARLTVELMAK |
| Ga0302302_12887912 | 3300029997 | Palsa | VGLAGSGLMVINPPFGADEYLRAAYTAIHAGLAAAGSGYVEVDRLTPERIN |
| Ga0302270_100783235 | 3300030011 | Bog | SGLMIVNPPYGTDEHLRRAYEAIHRAIAATGAGYVEVARLTPERMAQ |
| Ga0302195_104981752 | 3300030051 | Bog | LAGSGLMIVNPPYGTDEHLRRAYEAIHRAIAATGAGYVEVARLTPERMAQ |
| Ga0302192_100949544 | 3300030507 | Bog | PFGADDYLRQAYTAIHASVASAGHGYVEVTRLTPERMA |
| Ga0302183_101554092 | 3300030509 | Palsa | MIVNPPYGADQYLRDAYGAIHHAIAVPGAGYVEVARLTPERMAQ |
| Ga0311355_111872853 | 3300030580 | Palsa | GSGLMLVNPPFGADEYLLEAYTAIHAAVATADAGYVEVARLTPERMAH |
| Ga0310038_104778351 | 3300030707 | Peatlands Soil | GLMIVNPPFGADEYLATAYAAIHRGIAAPGAGYVEVARLTPEKL |
| Ga0265750_10510831 | 3300030813 | Soil | AGSGLMIVNPPYGADQFLRDAYGAIHEAIAAPGAGYVEVARLTPERMAQ |
| Ga0302308_102914153 | 3300031027 | Palsa | SGLLLVNPPYGADDFLREAYLAIHASLAEAGRGYVEVARLTPERMAQ |
| Ga0170834_1018454521 | 3300031057 | Forest Soil | MIVNPPYGADQFLRDAYGAIHRGIAAAGAGYVEVARLTPERLAQ |
| Ga0170834_1035533732 | 3300031057 | Forest Soil | IVNPPYGADQFLRDAYGAIHRGIAAAGAGYVEVARLTPERMAH |
| Ga0170823_150943371 | 3300031128 | Forest Soil | LAGSGLMIVNPPYGADQFLRDAYGAIHRGIAAAGAGYVEVARLTPERMAH |
| Ga0302307_102991423 | 3300031233 | Palsa | MIVNPPYGTDEYLTDAYAAIHQGIAAPGAGYVEVARLTAERVAH |
| Ga0302325_112733323 | 3300031234 | Palsa | ADEFLRQAYEAIHASVAEAGRGYVEVARLTGERMAQ |
| Ga0265340_104222862 | 3300031247 | Rhizosphere | GVGLAGSGLMIVNPPYGADEFLNKAYAAIHKGLATPGAGYVEVARLTPERMAQ |
| Ga0170818_1077236913 | 3300031474 | Forest Soil | DAGVGLAGSGLMIVNPPYGADDYLNDAYAAIHKGIAAPGSGYVEIARLTPERMAQ |
| Ga0170818_1106117373 | 3300031474 | Forest Soil | VNPPYGADEYLSGAYAAIHKGIAAPGAGYVEVARLTPERMAQ |
| Ga0307373_101003571 | 3300031672 | Soil | PFGIEEPLRAAYAAIHRHLAPAGAGYVEVARLTPERMAQ |
| Ga0310686_1083512591 | 3300031708 | Soil | PPYGADEYLHGAYAAIHAGIAAAASGYVEVARLTPERMAQ |
| Ga0310686_1160312493 | 3300031708 | Soil | FGADEYLRAAYTAIHEGLAAAGSGYVEVDRLTPERIS |
| Ga0307474_103004791 | 3300031718 | Hardwood Forest Soil | ADQFLRDAYGAIHQAIAAPGAGYVEVDRLTPERMAH |
| Ga0307474_115042851 | 3300031718 | Hardwood Forest Soil | GADRFLRDAYGAIHHGIAALGAGYVEVARLTPERMAQ |
| Ga0307471_1015991483 | 3300032180 | Hardwood Forest Soil | YGADEYLRDAYAVIHRAIAAPGAGYVEVVRLTPERMAQ |
| Ga0307471_1024265713 | 3300032180 | Hardwood Forest Soil | GVGLAGSGLMIVNPPYGADDYLTDAYAAIHKGIAAPGSGYVEIARLTPERMAQ |
| Ga0348332_117187683 | 3300032515 | Plant Litter | VNPPYGADEYLSEAYAAIHRGIATPGAGYVEVVRLTPERVAQ |
| Ga0334828_139019_14_172 | 3300033822 | Soil | VGLAGSGLMIVNPPYGTDEYLTEAYTAIHKGIAAPGAGYVEVARLTPERVAQ |
| Ga0334790_111094_711_839 | 3300033887 | Soil | MIVNPPFGADEYLATAYAAIHRGIAAPGAGYVEVARLTPEKL |
| Ga0370514_066857_786_908 | 3300034199 | Untreated Peat Soil | PPYGADAFLADAYGELHRGIAQPGAGYVQVARLTPERMPQ |
| ⦗Top⦘ |