NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097778

Metagenome / Metatranscriptome Family F097778

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097778
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 41 residues
Representative Sequence HELATQLGTVLEWQAGGRSFVLAGSLPPAAAEAAARELK
Number of Associated Samples 94
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 0.00 %
% of genes from short scaffolds (< 2000 bps) 0.00 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (100.000 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(12.500 % of family members)
Environment Ontology (ENVO) Unclassified
(21.154 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.038 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: Yes Secondary Structure distribution: α-helix: 16.42%    β-sheet: 25.37%    Coil/Unstructured: 58.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF00005ABC_tran 89.42
PF12730ABC2_membrane_4 2.88
PF13374TPR_10 0.96
PF09754PAC2 0.96
PF01987AIM24 0.96
PF14579HHH_6 0.96
PF04228Zn_peptidase 0.96
PF07991IlvN 0.96
PF12399BCA_ABC_TP_C 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0059Ketol-acid reductoisomeraseAmino acid transport and metabolism [E] 1.92
COG0499S-adenosylhomocysteine hydrolaseCoenzyme transport and metabolism [H] 0.96
COG2013AIM24 protein, required for mitochondrial respirationEnergy production and conversion [C] 0.96
COG2321Predicted metalloproteaseGeneral function prediction only [R] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

NameRankTaxonomyDistribution
UnclassifiedrootN/A100.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.54%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.54%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.73%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.77%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.85%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.92%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.92%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.92%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.96%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.96%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.96%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.96%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.96%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.96%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.96%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459017Litter degradation ZMR4EngineeredOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005887Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010862Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011987Permafrost microbial communities from Nunavut, Canada - A20_80cm_0MEnvironmentalOpen in IMG/M
3300011997Permafrost microbial communities from Nunavut, Canada - A15_80cm_18MEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012508Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510Host-AssociatedOpen in IMG/M
3300012513Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510Host-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300025544Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033758Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_AEnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4ZMR_045000902170459017Switchgrass, Maize And Mischanthus LitterMTGVAARSLDGVTAHELATPLGTVLGWRSGGTSTCSPDPVPPAAAEAAAQAVK
Ga0066677_1044715923300005171SoilGLTGHELATQLGTAIEWTRNGVSFVLAGSLPPAAAESAARALK*
Ga0066683_1012319613300005172SoilTAHELATQLGTAITWNSGGTSYLLAGSLPPAAAEAAARAVK*
Ga0066678_1103222313300005181SoilHELATQLGTVLGWQRNGVDFVLAGSLPPAAAETAARDLGK*
Ga0066675_1127169523300005187SoilTLDGVTAHELTTQLGTILTWDRGSVSYVLAGSVPSSAAEAAARALK*
Ga0070673_10146526013300005364Switchgrass RhizosphereSISLDGATAHELATQLGTVLTWDRAGVSYVLAGSVPSSAAEAAARALR*
Ga0070706_10180540123300005467Corn, Switchgrass And Miscanthus RhizosphereHELATQLGTVLTWDRSGVSYVLAGSLPPAAAEAAARSLK*
Ga0070707_10038766033300005468Corn, Switchgrass And Miscanthus RhizosphereTAHELATQLGTVLEWQEGGRSFVLGGSLPPAAAESAARELK*
Ga0070741_1001810813300005529Surface SoilELATQLGTVLEWQRGGTSFLLAGSLPPAAAESAARELG*
Ga0070741_1043789913300005529Surface SoilLSTQLGTILTWDKGGVTYVLAGSVPSAAAEAAARAIG*
Ga0066701_1006627813300005552SoilHELATQLGTVLEWQQGGRSFVLAGSLPPAAAESAARELK*
Ga0066692_1021162113300005555SoilLPSVSLDGVTAHELATQLGTVLGWDRGGVSYVLAGSIPTAAAESAARSLK*
Ga0066692_1042306123300005555SoilLNGVTAHELATQLGTVLEWQQGGRSFVLAGSLPPAAAESAARELK*
Ga0066704_1066864223300005557SoilLDGLTGHELATQLGTAIQWRRNGVSFILAGSLPPAAAESAARALK*
Ga0066706_1097017323300005598SoilGHELATQLGTAIEWQRNGVSFVLAGSLPPAAAESAARALK*
Ga0075292_104890713300005887Rice Paddy SoilSTQLGTILTWRRAGVDFVLAGSQPAAAAEAAARVLG*
Ga0070717_1173916323300006028Corn, Switchgrass And Miscanthus RhizosphereLATQLGTVLEWQRDGTAYVLAGSLPAAAGEAAARQLK*
Ga0075028_10029974013300006050WatershedsLATALGTVIEWKNGGVDYVLAGSLPSAAAEAAARTLK*
Ga0070712_10126415923300006175Corn, Switchgrass And Miscanthus RhizosphereTAHELATQLGTVLEWQSQGTGFVLAGSLPPAAAEAAARAVK*
Ga0074060_1194387213300006604SoilVSLDGLTGHELATQLGTAIEWQRNGVSFVLAGSLPPAAAESAARALR*
Ga0074062_1249746623300006606SoilVSLNGVTAHELATQLGTVIEWQQGGHSFVLAGSLPPTAAEAAARELK*
Ga0075433_1061825723300006852Populus RhizosphereTAHELSTQLGTILTYRDGDVDYVVAGSVPRSAAEAAARQLR*
Ga0075425_10212262523300006854Populus RhizosphereTQLGTALQWRRRGVEFVLAGSVPPAAAEAAARDLR*
Ga0075434_10125604423300006871Populus RhizosphereAHEFATQLGTIVTWQRAGVSTTLAGSVPAAAAEAAARELR*
Ga0075424_10055728413300006904Populus RhizosphereATQLGTLLAWQANGTAYVLGGSLPPAAAEAAARALR*
Ga0066709_10125256923300009137Grasslands SoilVTAHELATQLGTVLGWERGGVQFVLVGSLPSAAAESAARTLK*
Ga0111538_1196961013300009156Populus RhizosphereSAHELSTQLGTLIQWQRGGTSYVVAGSMPAAAAEAAARQLK*
Ga0105242_1322424513300009176Miscanthus RhizosphereTQLGTVVEWQRGGVAFVLAGSVPSATAETAARNFT*
Ga0134063_1057539523300010335Grasslands SoilVALGSATGHELATELGTVLLFDRAGVTFVLAGSMPPAAPEAAARGLLG*
Ga0126383_1254817523300010398Tropical Forest SoilTQLGTILEWQRDGVAFVLAGSLPPAAAETAARELE*
Ga0126348_116564913300010862Boreal Forest SoilITGLPTVSLNGVTAHELATQLGTVVEWSQGGTGFVLAGSLPPAAAESAARELK*
Ga0120164_104659313300011987PermafrostLDGVTGHELATQLGTIIQWERGGVSYVLAGSLPPAAAQEAARNLK*
Ga0120162_1000072483300011997PermafrostLAGVTAHELATQLGTVLGWDSGQVSFVLAGSLPSGAAEAAARALK*
Ga0137381_1041793433300012207Vadose Zone SoilHELATQLGTVLEWQAGGRSFVLAGSLPPAAAEAAARELK*
Ga0137376_1036343033300012208Vadose Zone SoilLNGVTAHELATQLGTVLEWQAGGRSFVLAGSLPPAAAESAARELK*
Ga0137384_1080988313300012357Vadose Zone SoilTELGTVLAWDRGGVSYILAGSVPSAAAEAAARGLK*
Ga0157315_100945413300012508Arabidopsis RhizosphereAHELATQLGTVLSWQANGTAFVLGGSLPPAAAEAAARALR*
Ga0157326_103708913300012513Arabidopsis RhizosphereITAHELATQLGTVLSWQANGTAFVLGGSLPPAAAEAAARALR*
Ga0137398_1067324213300012683Vadose Zone SoilTQLGTVVEWSQSGTGFVLAGSLPPAAAESAARELK*
Ga0137394_1008353813300012922Vadose Zone SoilGHELATQLGTAIEWQRNGVSFVIAGSLPPAAAESAARALK*
Ga0137359_1116787923300012923Vadose Zone SoilLATQLGTVIEWQHSGVAYVLAGSLPPAAAEAAARELK*
Ga0164298_1098598913300012955SoilTQLGTVLEWQAGGRSFVLAGSLPPAAAESAARELK*
Ga0164299_1042318423300012958SoilQELATQLGTVLTWKRGEVAYVLAGSMPPAAAEAAARGLG*
Ga0126369_1065324533300012971Tropical Forest SoilENVLTNLPEVSLGGISAHELSTQLGTILAWRQGGVESVLVGSVPAATAEAAARELAP*
Ga0134087_1041181013300012977Grasslands SoilQLGTVVTWQRDGVGYVLAGSLPPAAAEAAARDLK*
Ga0134087_1045907713300012977Grasslands SoilELATQLGTVLEWQEGGRAFVLAGSLPPAAAESAARELK*
Ga0164304_1150509223300012986SoilSLGGTTAHELSTQLGTVLGWDEGQVSFVLAGSLPSGAAESAARALR*
Ga0164305_1139219223300012989SoilSLSGITAHELVTQLGTVLTWDRGGVTYILAGSLPSGAAEAAATAIG*
Ga0163162_1240969613300013306Switchgrass RhizosphereATQLGTALQWRRRGVEFVLAGSVPPAAAEAAARDLR*
Ga0137409_1105102313300015245Vadose Zone SoilQLGTVLFFDRNRVSFVLAGSMPPTAAEMAARSLG*
Ga0137403_1067095413300015264Vadose Zone SoilVTAHELATQLGTVVEWSQGGTGFVLAGSLPPAAAESAARELK*
Ga0132256_10062765333300015372Arabidopsis RhizosphereGVTAHELATQLGTVLEWQRDGTSYVVAGSLPAAAAEAAGRQLLK*
Ga0134074_115624013300017657Grasslands SoilLATQLGTVLTWKRGEVAYVLAGSVPPAAAEAAARALG
Ga0187785_1059649723300017947Tropical PeatlandITAHELATQLGTAIEWHEGGTAYVLAGSLPPAAAEAAARQLK
Ga0187776_1128475523300017966Tropical PeatlandELATQLGTILTWQAGGTSFVLAGSLPASAAETAARAVK
Ga0187780_1064718423300017973Tropical PeatlandVTAHELPTQLGTVLGWDRGDVSFVLAGSVPTSAAEAAARALG
Ga0187773_1110930813300018064Tropical PeatlandHELSTQLGTVLQWNAGGTNFVLAGSLPAAAAETAARAVK
Ga0066667_1111488013300018433Grasslands SoilTVARDGWTGHELATQLGTAIQWTRDGVSYVLVGSLPPAAAESAARALK
Ga0066667_1127016723300018433Grasslands SoilAVTLDGVTAHELATQLGTILTWDNGNVTYLLAGSVPSSAAEAAARALK
Ga0066667_1149499223300018433Grasslands SoilATQLGTVVLFQQAGVSYVLAGSLPPAAAEAAARALQ
Ga0066667_1206006213300018433Grasslands SoilHELATQLGTVLEWQRGGVDYVLAGSLPPGAAEAAARALR
Ga0066662_1140769913300018468Grasslands SoilTAHELATQLGTVLEWQTGGTSYVLAGSLPTAAAEAAARAVK
Ga0193699_1017770213300021363SoilLATQLGTVLTWDRAGVTYVLAGSLPSSAAEAAATAIG
Ga0210397_1151215913300021403SoilGVTAHEVSTQLGTVLSWDRGGVTYVLAGSVATTAAESAARALG
Ga0247661_106703323300024254SoilHELATQLGTALTWRKGGVSFVLAGSVPPAAAEAAARALG
Ga0208078_101861533300025544Arctic Peat SoilTQLGTVLEWQQGGRSLVLAGSLPPAAAESAARELK
Ga0207699_1122693123300025906Corn, Switchgrass And Miscanthus RhizosphereTQLGTVLTWKRGEVDYVLAGSVPPAAAEAAARALG
Ga0207663_1154310113300025916Corn, Switchgrass And Miscanthus RhizosphereTQLGTAIQWTRDGVSFVLVGSLPPAAAESAARALK
Ga0207663_1172343323300025916Corn, Switchgrass And Miscanthus RhizosphereATQLGTVLTWDRACVTYVLAGSLPPAAAEAAARSLR
Ga0207646_1017053133300025922Corn, Switchgrass And Miscanthus RhizosphereATQLGTVIAWQREGVAYVLAGSLPPAAAEAAARNLK
Ga0207700_1037673113300025928Corn, Switchgrass And Miscanthus RhizosphereLDGLQGHELATQLGTAIQWTRNGVSFVLVGSLPPAAAESAARALK
Ga0207700_1112045913300025928Corn, Switchgrass And Miscanthus RhizosphereLATQLGTVLEWQSQGTGFVLAGSLPPAAAEAAARAVK
Ga0207700_1198294223300025928Corn, Switchgrass And Miscanthus RhizosphereDGVTAHELSTQLGTVLSWDAGQASYVLAGSLPSGAAESAARALK
Ga0207664_1120956323300025929Agricultural SoilATQLGTILTWDAGGVSYVLAGSVPAAAAESAARALR
Ga0207665_1059607313300025939Corn, Switchgrass And Miscanthus RhizosphereTGHELATQLGTILTWDRGGVSYILAGSVPSSAAEAAARGL
Ga0207661_1062774613300025944Corn RhizosphereYELSTQLGTILSWDSGGVSYVLAGSVPATAAESAARTLK
Ga0209801_113303713300026326SoilATQLGTALEWQRNGVSFVLAGSLPPAAAESAARSLK
Ga0209804_127058013300026335SoilGLPTVSLDGLTGHELATQLGTAIEWTRNGVSFVLAGSLPPAAAESAARALK
Ga0209808_119320823300026523SoilLPTVSLNGVTAHELATQLGTVLEWQEGGRAFVLAGSLPPAAAESAARELK
Ga0209059_103092923300026527SoilVTAHELATQLGTVLQWQDAGTSIVLAGSLPSAAAEAAARQLK
Ga0209073_1039321423300027765Agricultural SoilHELATQLGTAIEWKRNGVAFVLVGSLPPAAAESAARALK
Ga0209465_1054030723300027874Tropical Forest SoilELATQLGTALQWRRAGVEYVLAGSVPAAAAEAAARDLR
Ga0207428_1015965933300027907Populus RhizosphereIDGLTAHELATQLGTVIAWQSGGTSFVLAGSRARAAAVAAARALK
Ga0307292_1046359923300028811SoilKVSLDGVTGHELATELGTALRWERDGVGYVLAGSLPASAAEAAARSLK
Ga0307312_1016626013300028828SoilTQLGTLIEWQRGGVTFVLAGSVPSAKAETAARDVQ
Ga0311336_1072438523300029990FenTQLGTIVTWQHAGVSTTLAGSIPSAAAEAAARELG
Ga0307468_10106386823300031740Hardwood Forest SoilDGLKGHELATQLGTAVQWTRNGVSFVLAGSLPPAAAESAARALK
Ga0318517_1001745213300031835SoilTQLGTILAWQSGGTSFVLAGSQPAAAAEAAARAVK
Ga0318512_1072915713300031846SoilLDGVSAHELATELGTVLQWQSGGTTFVLAGSQPPAAAEAAARAVK
Ga0318536_1054594223300031893SoilLPTVSLDGLTAHELATQLGTVLEWQSGGTSYVLAGSLPASATETAARAVK
Ga0318520_1031575513300031897SoilAHELATQLGTVLEWESNGTRFILAGSLPASAAEAAARDVK
Ga0318520_1080223713300031897SoilLPTVSLDGLTAHELSTQLGTVLAWDAGGTSFVLAGSLPASAAEAAARAVK
Ga0308175_10213420113300031938SoilLSGITAHELATQLGTVLTWDRGGVSYILAGSLPSSAAEAAAAAIG
Ga0308174_1150016523300031939SoilVTAHELATQLGTVLGWNRAGVTYVLAGSIPSSAAEAAARALR
Ga0318563_1039423713300032009SoilTQLGTVLEWESNGTRFILAGSLPASAAEAAARDVK
Ga0318507_1020211023300032025SoilLTAHELATQLGTILAWQSGGTSFVLAGSQPAAAAEAAARAVK
Ga0318559_1058041523300032039SoilTFSVNGVTAHELATQLGTVLTWDKGGVTYILAGSVPSSAAEAAATALTK
Ga0318553_1037655213300032068SoilSLDGVSAHELATELGTVLQWQSGGTTFVLAGSQPPAAAEAAARAVK
Ga0306924_1236664423300032076SoilTVHELATQLGTVLDWSSGGASFVLAGSLSAADAEAAARTVK
Ga0318525_1026868113300032089SoilGLTAHELATQLGTILAWQSGGTSFVLAGSQPAAAAEAAARAVK
Ga0307472_10047515513300032205Hardwood Forest SoilVSLDGLTGHELATQLGTALEWQRNGVSFVLAGSLPPAAAESAARSLK
Ga0306920_10238112423300032261SoilDGLTAHELATQLGTALEWQSGGTSYVLAGSLPAAAAEAAARAVR
Ga0314868_013822_2_1363300033758PeatlandNGITAHELATQLGTAIEWHDGGTAYVLAGSLPPAAAEAAARQLK
Ga0372943_0974578_423_5633300034268SoilSLDGVTAHELSTQLGTALAWDRGGVSYVLAGSVPSSAAEAAARSLK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.