| Basic Information | |
|---|---|
| Family ID | F097769 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 40 residues |
| Representative Sequence | ASFMTGIGLLAYPIAWIVMPEEPLLLTAPAGAQRVTNQ |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.12 % |
| % of genes from short scaffolds (< 2000 bps) | 88.46 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.038 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.539 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.231 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.115 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.82% β-sheet: 0.00% Coil/Unstructured: 68.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00561 | Abhydrolase_1 | 63.46 |
| PF12697 | Abhydrolase_6 | 4.81 |
| PF12681 | Glyoxalase_2 | 3.85 |
| PF00275 | EPSP_synthase | 2.88 |
| PF07394 | DUF1501 | 1.92 |
| PF01471 | PG_binding_1 | 1.92 |
| PF00180 | Iso_dh | 1.92 |
| PF11950 | DUF3467 | 0.96 |
| PF13432 | TPR_16 | 0.96 |
| PF00483 | NTP_transferase | 0.96 |
| PF13248 | zf-ribbon_3 | 0.96 |
| PF00571 | CBS | 0.96 |
| PF00903 | Glyoxalase | 0.96 |
| PF00899 | ThiF | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.04 % |
| Unclassified | root | N/A | 0.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_107558363 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300001131|JGI12631J13338_1031198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300001356|JGI12269J14319_10204383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 773 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100484304 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300002568|C688J35102_120178779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300004092|Ga0062389_101102252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 979 | Open in IMG/M |
| 3300005176|Ga0066679_10368575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 940 | Open in IMG/M |
| 3300005434|Ga0070709_10038265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2936 | Open in IMG/M |
| 3300005435|Ga0070714_100234476 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300005435|Ga0070714_101803060 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300006052|Ga0075029_100013344 | All Organisms → cellular organisms → Bacteria | 4547 | Open in IMG/M |
| 3300006175|Ga0070712_101448921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300006893|Ga0073928_11166120 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300007076|Ga0075435_100031589 | All Organisms → cellular organisms → Bacteria | 4173 | Open in IMG/M |
| 3300007265|Ga0099794_10691369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300009038|Ga0099829_11735300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300009519|Ga0116108_1190631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 603 | Open in IMG/M |
| 3300009520|Ga0116214_1125984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300009520|Ga0116214_1128357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300009524|Ga0116225_1408915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300009638|Ga0116113_1105176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300009645|Ga0116106_1130067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300009709|Ga0116227_11156497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300009762|Ga0116130_1067851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
| 3300010049|Ga0123356_10042108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4255 | Open in IMG/M |
| 3300010373|Ga0134128_12447556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300010379|Ga0136449_100829455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1522 | Open in IMG/M |
| 3300010379|Ga0136449_104220537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300011120|Ga0150983_13527078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300011269|Ga0137392_10579386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300011271|Ga0137393_10047971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3330 | Open in IMG/M |
| 3300012212|Ga0150985_120145221 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300012363|Ga0137390_11030037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300012927|Ga0137416_10495281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
| 3300014201|Ga0181537_10415989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300014489|Ga0182018_10118721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1534 | Open in IMG/M |
| 3300014655|Ga0181516_10209843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 988 | Open in IMG/M |
| 3300015265|Ga0182005_1196411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300017943|Ga0187819_10011328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5056 | Open in IMG/M |
| 3300017999|Ga0187767_10319787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300018008|Ga0187888_1388817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300018020|Ga0187861_10218286 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300018033|Ga0187867_10065679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2150 | Open in IMG/M |
| 3300018040|Ga0187862_10725349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300018433|Ga0066667_11701451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300018468|Ga0066662_12493322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300018482|Ga0066669_10273441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1352 | Open in IMG/M |
| 3300020583|Ga0210401_11104101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300020583|Ga0210401_11643911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300021180|Ga0210396_10890130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300021181|Ga0210388_11728924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300021401|Ga0210393_11154976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300021406|Ga0210386_10388166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1203 | Open in IMG/M |
| 3300021407|Ga0210383_10325857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1322 | Open in IMG/M |
| 3300021478|Ga0210402_10470799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1167 | Open in IMG/M |
| 3300021478|Ga0210402_10700058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300021478|Ga0210402_10924053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300021560|Ga0126371_12901780 | Not Available | 581 | Open in IMG/M |
| 3300024271|Ga0224564_1030958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
| 3300025434|Ga0208690_1033691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300025905|Ga0207685_10311268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300025906|Ga0207699_10590860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
| 3300025929|Ga0207664_10951793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300025934|Ga0207686_10881561 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300026301|Ga0209238_1054362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1431 | Open in IMG/M |
| 3300026328|Ga0209802_1277234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300026467|Ga0257154_1018065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1011 | Open in IMG/M |
| 3300026529|Ga0209806_1289576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300027497|Ga0208199_1109393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300027629|Ga0209422_1134206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300027853|Ga0209274_10394080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300027853|Ga0209274_10568807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300027869|Ga0209579_10230557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
| 3300027879|Ga0209169_10221385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 990 | Open in IMG/M |
| 3300027889|Ga0209380_10214754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1130 | Open in IMG/M |
| 3300027905|Ga0209415_10129779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2621 | Open in IMG/M |
| 3300029915|Ga0311358_10718389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300029954|Ga0311331_10659646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
| 3300029999|Ga0311339_11259237 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 673 | Open in IMG/M |
| 3300030000|Ga0311337_10983790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300030509|Ga0302183_10197043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300030618|Ga0311354_11364063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300030706|Ga0310039_10179585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
| 3300030737|Ga0302310_10581430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300030878|Ga0265770_1046988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300031057|Ga0170834_108774322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2288 | Open in IMG/M |
| 3300031122|Ga0170822_12898699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300031234|Ga0302325_11922531 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 734 | Open in IMG/M |
| 3300031524|Ga0302320_10823339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1022 | Open in IMG/M |
| 3300031711|Ga0265314_10284401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
| 3300031754|Ga0307475_11181475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300031754|Ga0307475_11472629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300031770|Ga0318521_10327696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
| 3300031962|Ga0307479_10291956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1611 | Open in IMG/M |
| 3300031962|Ga0307479_11740991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300032076|Ga0306924_11664932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300032770|Ga0335085_10340683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1761 | Open in IMG/M |
| 3300032783|Ga0335079_10102616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3241 | Open in IMG/M |
| 3300032805|Ga0335078_11497209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300032892|Ga0335081_10191675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2844 | Open in IMG/M |
| 3300032895|Ga0335074_10427653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1418 | Open in IMG/M |
| 3300033134|Ga0335073_10298898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1933 | Open in IMG/M |
| 3300033134|Ga0335073_10595506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1236 | Open in IMG/M |
| 3300033545|Ga0316214_1000742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3505 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.54% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.81% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.81% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.88% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.88% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.92% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.96% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.96% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.96% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.96% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.96% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.96% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001131 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1075583632 | 3300000955 | Soil | MAFMTVIGFLSYPIAWIVMPEEPLALPAPMGAEPVQNS* |
| JGI12631J13338_10311983 | 3300001131 | Forest Soil | SFMTVIGFISYPIAWVVMPEEPLLLAPPVGAQRVPTS* |
| JGI12269J14319_102043831 | 3300001356 | Peatlands Soil | WLIVGVMTGVGLLSYPIAWIVMPEEPLMLSAPAGQPVTHS* |
| JGIcombinedJ26739_1004843043 | 3300002245 | Forest Soil | TVIGFLSYPIAWIIMPEEPLLLPAPPIGAQQATNP* |
| C688J35102_1201787791 | 3300002568 | Soil | RLVGLIASVVTGVGLLSYPIAWIVMPEEPYKLPANVTTGQVVTNS* |
| Ga0062389_1011022523 | 3300004092 | Bog Forest Soil | WLLGSFMTGIGLLAYPIAWIVMPEEPLLLAAPVGAQHVAQHVANP* |
| Ga0066679_103685751 | 3300005176 | Soil | VWLIACFMTGIGFLSYPIAWIVMPEEPLLLAAPLATQRVTNS* |
| Ga0070709_100382651 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LVAFMTGIGFLSYPIAWIVMPEEPLLLPAPSGIHPATDAGS* |
| Ga0070714_1002344763 | 3300005435 | Agricultural Soil | VVWLMVAFMTVIGFLSYPIAWIIMPEEPPLLPVPAGTPQATHS* |
| Ga0070714_1018030601 | 3300005435 | Agricultural Soil | WLIVAFMTVIGFLSYPIAWIIMPEEPPLLPVPAGTPQATHS* |
| Ga0075029_1000133441 | 3300006052 | Watersheds | LVRVLWLITALMTGIGLLSYPIAWIAMPEEPLRLAAPVAVQHVSNS* |
| Ga0070712_1014489211 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VRVVWLMVAFMTVIGFLSYPIAWIIMPEEPPLLPVPAGTPQATHS* |
| Ga0073928_111661201 | 3300006893 | Iron-Sulfur Acid Spring | MTGIGVISYPIAWIVMPEEPLLLMAPAGAERVTNS* |
| Ga0075435_1000315891 | 3300007076 | Populus Rhizosphere | WLLVGVMTGVGLLSYPIAWIVMPEEPEVAPQPAGQQVTS* |
| Ga0099794_106913692 | 3300007265 | Vadose Zone Soil | WLVTVIMSGVGLIPYIIGWIVMPDEPLLLTAPAGAERVANP* |
| Ga0099829_117353003 | 3300009038 | Vadose Zone Soil | RLVWLITSVVTGIGLLSYPIAWIVMPEEPYMLAAQAQAGQQVTSPQA* |
| Ga0116108_11906311 | 3300009519 | Peatland | IASFMTGIGLISYPIAWIVMPEEPLLLTAPASAQPHVTHS* |
| Ga0116214_11259842 | 3300009520 | Peatlands Soil | WLFVAIMTGVGFLAYPIAWIVMPEEPLRLAAPAADPQVINP* |
| Ga0116214_11283571 | 3300009520 | Peatlands Soil | TGVGVLAYPIAWIVMPDEPLRLPAPAGAQQVINP* |
| Ga0116225_14089152 | 3300009524 | Peatlands Soil | FLTGVGLLAYPIAWIVIPEEPLPVSAPMGQRVTNP* |
| Ga0116113_11051761 | 3300009638 | Peatland | MTGIGLLAYPIAWIVMPEEPLLLTAPAGAQRVTNQ* |
| Ga0116106_11300672 | 3300009645 | Peatland | LIASFMTGIGLMSYPIAWIVMPEEPMLLTAPAGAQRVTNP* |
| Ga0116227_111564972 | 3300009709 | Host-Associated | SFMTGIGLLAYPIAWIVVPEEPLMLTASVPSGQQVPAS* |
| Ga0116130_10678513 | 3300009762 | Peatland | RVVWLIASFMTGIGLISYPIAWIVMPEEPLLLTAPASAQPHVTHS* |
| Ga0123356_100421081 | 3300010049 | Termite Gut | GVGLLSYPIAWILMPEEPYLLSTAERASQQATNP* |
| Ga0134128_124475562 | 3300010373 | Terrestrial Soil | WLLVGVMTGVGLLSYPIAWVVMPEEPLRLEAPAGQQAAVL* |
| Ga0136449_1008294552 | 3300010379 | Peatlands Soil | MTGVGLLAYPIAWIVMPEEPLLLTAPVGAQRATNP* |
| Ga0136449_1042205372 | 3300010379 | Peatlands Soil | VALMTGVGLLAYPIAWIVMPEEPLRFAPPAGAQQAINL* |
| Ga0150983_135270781 | 3300011120 | Forest Soil | LVWLLASCLTGVGLLAYPIAWIVMPEEPLLLTAPAGAQRAANP* |
| Ga0137392_105793862 | 3300011269 | Vadose Zone Soil | LITAIMSGIGVIPYIIAWIVMPEEPLMLTAPAGAPRVTNP* |
| Ga0137393_100479715 | 3300011271 | Vadose Zone Soil | VSVMTGIGLLSYPIAWIVMPEEPLMLSAPVGAQRVTNS* |
| Ga0150985_1201452212 | 3300012212 | Avena Fatua Rhizosphere | LLVGIMTGIGLLSYPIAWIVIPEEPLMLSAPAGYPVTGQ* |
| Ga0137390_110300372 | 3300012363 | Vadose Zone Soil | ACFMTGIGFLSYPIAWIVMPEEPLLLAAPLAAQRVPTP* |
| Ga0137416_104952812 | 3300012927 | Vadose Zone Soil | RLVWLVVSVMTGIGLLSYPIAWIVMPEEPLMLSAPVGAQRVTNS* |
| Ga0181537_104159892 | 3300014201 | Bog | VIGFLSYPIAWIIMPEEPLLLPAPPIGAQQVTNP* |
| Ga0182018_101187211 | 3300014489 | Palsa | WLITSFMTGIGLISYPIAWIVMPDEPLLLLTEPAGAQPVTNP* |
| Ga0181516_102098432 | 3300014655 | Bog | WLLGSFMTGIGLLAYPIAWIVMPEEPLLLTAPAGAQRAMNP* |
| Ga0182005_11964112 | 3300015265 | Rhizosphere | RVVWLIVAFMTGIGFLSYPIAWIIMPEEPPLLPVPAGTPQATHS* |
| Ga0187819_100113286 | 3300017943 | Freshwater Sediment | SLMTGVGLLAYPIAWIVMPEEPLRLAAPAGAQPMINS |
| Ga0187767_103197872 | 3300017999 | Tropical Peatland | LVWLIVALMTGIGLLAYPIAWIVMPEEPMLIAAPPAAQSVTNP |
| Ga0187888_13888172 | 3300018008 | Peatland | IASFMTGIGLISYPIAWIVMPEEPLLLTAPVGAQRMTNP |
| Ga0187861_102182863 | 3300018020 | Peatland | VWLIASFMTGIGLISYPIAWIVMPEEPLLLTTPASAQPHVTHS |
| Ga0187867_100656791 | 3300018033 | Peatland | LMTGVGLLAYPIAWIVMPEEPLRLPAPVGAQPVINP |
| Ga0187862_107253492 | 3300018040 | Peatland | LVWLIASFMTGIGLISYPIAWIIMPEEPLRLAAPVGVQRVTNP |
| Ga0066667_117014512 | 3300018433 | Grasslands Soil | LVTVIMSGIGLIPYIIGWIVMPEEPLLLTAPAGAQGVTNP |
| Ga0066662_124933222 | 3300018468 | Grasslands Soil | CMTVIGFLSYPIAWIIMPEEPLMLREPAGAERVPNP |
| Ga0066669_102734411 | 3300018482 | Grasslands Soil | VAFMTVIGFLSYPIAWIIMPEEPPLLPVPAGTPQATHS |
| Ga0210401_111041012 | 3300020583 | Soil | FVSLMTGVGLLAYPVAWIVMPDEPLRLPAPAGVQQVINP |
| Ga0210401_116439111 | 3300020583 | Soil | LFVAVMTGVGLLAYPIAWIIMPEEPLRLPAPAGAEQVISP |
| Ga0210396_108901302 | 3300021180 | Soil | WFFTAFLTGVGLIAYPIAWIVMPEEPLRLSAPMGQQATST |
| Ga0210388_117289242 | 3300021181 | Soil | AIMTGVGFLAYPIAWIVMPEEPLRLAAPSADAQVISP |
| Ga0210393_111549761 | 3300021401 | Soil | FLTGVGLLAYPIAWIVMPEEPLRVSAPMAQQATSS |
| Ga0210386_103881663 | 3300021406 | Soil | VVWLIVACMTVIGFLSYPIAWIIMPEEPLLLPAPPIGAQQATNP |
| Ga0210383_103258571 | 3300021407 | Soil | WLFIVLVGGTGLLAYVIAWMVMPEEPLRLPAPVGAQPVINP |
| Ga0210402_104707993 | 3300021478 | Soil | ALMTGVGLLAYPIAWIVMPEEPLRLAAPAGAPQLINP |
| Ga0210402_107000581 | 3300021478 | Soil | CLIVAVMTGVGLLSYPIAWVVMPEEPLRLEAPAGHQAAVL |
| Ga0210402_109240531 | 3300021478 | Soil | ITAIMTGFGFVAYLIAWIVMPEEPLLLAAPSAAQPATNP |
| Ga0126371_129017802 | 3300021560 | Tropical Forest Soil | VVWLIVACMTVIGFLSYPIAWVIMPEEPLMLEAPRTGQPAQDTRS |
| Ga0224564_10309581 | 3300024271 | Soil | WLITAFMTGFGFLAYIIAWIIMPEEPLLLPAPVAARPATNP |
| Ga0208690_10336912 | 3300025434 | Peatland | VWLFVALMTGVGLLAYPIAWIVMPEEPLRLPAPVGAQPVINP |
| Ga0207685_103112681 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | AFMTGVGFLSYLIAWIIMPEEPLLLPAPQLGAQQATSR |
| Ga0207699_105908603 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | ASVVTGIGLLSYPIAWVVIPEEPYKLPANVTSGQVVTNS |
| Ga0207664_109517932 | 3300025929 | Agricultural Soil | WLIVAFMTVIGFLSYPIAWIIMPEEPPLLPVPAGTPQATHS |
| Ga0207686_108815613 | 3300025934 | Miscanthus Rhizosphere | LVGIMTGIGLLSYPIAWIVIPEEPLMLSAPAGYPVTGQ |
| Ga0209238_10543622 | 3300026301 | Grasslands Soil | WLMVAFMTVIGFLSYPIAWIIMPEEPPLLPVPAGTPQATHS |
| Ga0209802_12772341 | 3300026328 | Soil | VWLVTVIMSGIGLIPYIIGWIVMPEEPLLLTAPAGAQGVTNP |
| Ga0257154_10180652 | 3300026467 | Soil | ASFMTGIGVISYPIAWIVMPEEPLLLMVPGGAQRVTNS |
| Ga0209806_12895762 | 3300026529 | Soil | LLWLIVAVMTGVGLLAYPIAWIVMPDQPEIRSLPAGQQLTTP |
| Ga0208199_11093932 | 3300027497 | Peatlands Soil | WLFVAIMTGVGFLAYPIAWIVMPEEPLRLAAPAADPQVINP |
| Ga0209422_11342062 | 3300027629 | Forest Soil | AWLIGSFMTGIGLFAYPIAWIVMPEEPLLLAEPAGAQRVTNP |
| Ga0209274_103940802 | 3300027853 | Soil | LITSFMTGIGLISYPIAWIVMPEEPLLLPEPAGAQPVTNP |
| Ga0209274_105688072 | 3300027853 | Soil | LITSLMTGIGLLAYPIAWIVMPEEPLLLAAPVGAQRATNP |
| Ga0209579_102305572 | 3300027869 | Surface Soil | SLVFDGIGLLSYPIAWIVMPEEPLLLSAPVTARHAANM |
| Ga0209169_102213851 | 3300027879 | Soil | LAWLFVALMTGVGLFAYPIAWIVMPEEPLRLPAPVGAQQVMNI |
| Ga0209380_102147542 | 3300027889 | Soil | VRLMWLLVAFMTGVGLIAYPIAWIVMPDEPLLLAAPVGAQRVANQ |
| Ga0209415_101297795 | 3300027905 | Peatlands Soil | LITAFMTGFGFLAYLIAWIVMPEEPLLLPAPVAAQQVTNP |
| Ga0311358_107183891 | 3300029915 | Bog | ASFMTGIGLIAYPIAWIVMPEEPLLLAAPVGAQQVPNP |
| Ga0311331_106596462 | 3300029954 | Bog | SFMTGIGLLAYPIAWIVIPEEPLMLTASVPSGQQVPTS |
| Ga0311339_112592371 | 3300029999 | Palsa | CLPPMTCIGLLAYPIAWIIMPEEPLLLSPPVGAGQMTNP |
| Ga0311337_109837902 | 3300030000 | Fen | SIMTGVGLIAYPIAWIVMPEEPYMLSAPAGYQVPNP |
| Ga0302183_101970431 | 3300030509 | Palsa | MTGIGLISYPIAWIVMPDEPLLLPEPAGAQRVTNP |
| Ga0311354_113640632 | 3300030618 | Palsa | VWLITSFMTGIGLISYPVAWVVMPDEPLLLPEPAGAQRVTNP |
| Ga0310039_101795852 | 3300030706 | Peatlands Soil | VWLIASFMTGIGLISYPIAWIVMPEEPLMLAAPAGVQRVTNP |
| Ga0302310_105814301 | 3300030737 | Palsa | RLVWLITSFMTGIGLISYPIAWIVMPEEPLLLAVPVGAQQVTNA |
| Ga0265770_10469882 | 3300030878 | Soil | LVWLLASCLTGIGLLAYPIAWIVMPEEPLPLTVPVGAQRAANP |
| Ga0170834_1087743222 | 3300031057 | Forest Soil | VWLIVAFMTGVGFLSYLIAWIIMPEEPLLLPAPQLGAQQATSR |
| Ga0170822_128986992 | 3300031122 | Forest Soil | VWLIVAFMTGVGFLSYLIAWIVMPEEPLLLPAPQLGAQQATSR |
| Ga0302325_119225311 | 3300031234 | Palsa | PMTCIGLLAYPIAWIIMPEEPLLLSPPVGAGQMTNP |
| Ga0302320_108233391 | 3300031524 | Bog | ASFMTGIGLLAYPIAWIVMPEEPLLLTAPAGAQRVTNQ |
| Ga0265314_102844012 | 3300031711 | Rhizosphere | WLITLFMSGFGLIPYIIAWIIMPEEPRLLSAPVNAQQVPNA |
| Ga0307475_111814751 | 3300031754 | Hardwood Forest Soil | WLITSFMTGIGLISYPIAWIVMPEEPLLLAAPADAQRATNP |
| Ga0307475_114726292 | 3300031754 | Hardwood Forest Soil | ASFMTGIGVISYPIAWIVMPEEPLLLMAPAGAQRATNP |
| Ga0318521_103276961 | 3300031770 | Soil | MTGIGFFSYPIAWIIMPEEPLMLQAPSGALPVSDTHS |
| Ga0307479_102919561 | 3300031962 | Hardwood Forest Soil | FMTGVGFLSYLIAWIIMPEEPLLLPAPQLGAQQATNL |
| Ga0307479_117409911 | 3300031962 | Hardwood Forest Soil | MSGIGLIPYIIAWIVMPEEPLLLTAPVGAQRATNP |
| Ga0306924_116649321 | 3300032076 | Soil | IMACMTGIGFFSYPIAWIIMPEEPLMLQAPSGALPVSDTHS |
| Ga0335085_103406833 | 3300032770 | Soil | TAFLTGVGLLAYPIAWIVIPEEPLPVSAPLGQRVPSN |
| Ga0335079_101026161 | 3300032783 | Soil | LLVAVMTGIGIFSYPIAWIVIPEEPLFLQAPVAQQQATHS |
| Ga0335078_114972091 | 3300032805 | Soil | SCMTVIGFLSYPIAWIIMPEEPLMLPSPAAGAKQATSP |
| Ga0335081_101916751 | 3300032892 | Soil | MVRVVWLIMAFMTVIGFLSYPIAWIVMPEEPMLVPAPTGAQPATNTRS |
| Ga0335074_104276533 | 3300032895 | Soil | ASFTTIIGMLSYPIAWIVMPEEPLLLRDGAPAGKPATNS |
| Ga0335073_102988981 | 3300033134 | Soil | VVWLIASVTTVIGMISYPIAWIVMPEEPLMLSAPANAQRATNP |
| Ga0335073_105955063 | 3300033134 | Soil | VRVVWLIMAFMTVIGFLSYPIAWIIMPEEPLLLPAPIGAQPAQNA |
| Ga0316214_10007428 | 3300033545 | Roots | LVWLITAIMTCIGFLPYVIAWIVMPEEPYLLPAPMNAQPVNSQPMNVQP |
| ⦗Top⦘ |