| Basic Information | |
|---|---|
| Family ID | F097716 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 44 residues |
| Representative Sequence | HAKAKGVSATWLPVPGGAHTDAWAQPAIISQIFDFFDAHKTKMK |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.92 % |
| % of genes near scaffold ends (potentially truncated) | 96.15 % |
| % of genes from short scaffolds (< 2000 bps) | 94.23 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.154 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.615 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.346 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.923 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 22.22% β-sheet: 0.00% Coil/Unstructured: 77.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF08714 | Fae | 9.62 |
| PF01968 | Hydantoinase_A | 7.69 |
| PF00557 | Peptidase_M24 | 6.73 |
| PF02416 | TatA_B_E | 2.88 |
| PF01979 | Amidohydro_1 | 1.92 |
| PF12802 | MarR_2 | 1.92 |
| PF12680 | SnoaL_2 | 1.92 |
| PF00174 | Oxidored_molyb | 1.92 |
| PF13360 | PQQ_2 | 1.92 |
| PF00266 | Aminotran_5 | 1.92 |
| PF05988 | DUF899 | 1.92 |
| PF01965 | DJ-1_PfpI | 0.96 |
| PF07676 | PD40 | 0.96 |
| PF00529 | CusB_dom_1 | 0.96 |
| PF02518 | HATPase_c | 0.96 |
| PF05569 | Peptidase_M56 | 0.96 |
| PF08241 | Methyltransf_11 | 0.96 |
| PF13505 | OMP_b-brl | 0.96 |
| PF01139 | RtcB | 0.96 |
| PF12697 | Abhydrolase_6 | 0.96 |
| PF07690 | MFS_1 | 0.96 |
| PF09587 | PGA_cap | 0.96 |
| PF06964 | Alpha-L-AF_C | 0.96 |
| PF10503 | Esterase_PHB | 0.96 |
| PF01408 | GFO_IDH_MocA | 0.96 |
| PF03372 | Exo_endo_phos | 0.96 |
| PF01322 | Cytochrom_C_2 | 0.96 |
| PF02900 | LigB | 0.96 |
| PF12796 | Ank_2 | 0.96 |
| PF04542 | Sigma70_r2 | 0.96 |
| PF09176 | Mpt_N | 0.96 |
| PF08281 | Sigma70_r4_2 | 0.96 |
| PF00581 | Rhodanese | 0.96 |
| PF13421 | Band_7_1 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG1795 | Formaldehyde-activating enzyme (5,6,7,8-tetrahydromethanopterin hydrolyase) | Energy production and conversion [C] | 9.62 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 2.88 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 1.92 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 1.92 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 1.92 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.96 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.96 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.96 |
| COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG3534 | Alpha-L-arabinofuranosidase | Carbohydrate transport and metabolism [G] | 0.96 |
| COG3909 | Cytochrome c556 | Energy production and conversion [C] | 0.96 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.15 % |
| Unclassified | root | N/A | 28.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090015|GPICI_9131986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1809 | Open in IMG/M |
| 3300002568|C688J35102_119905595 | Not Available | 809 | Open in IMG/M |
| 3300005334|Ga0068869_101599444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 580 | Open in IMG/M |
| 3300005337|Ga0070682_100368775 | Not Available | 1076 | Open in IMG/M |
| 3300005344|Ga0070661_101405721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 587 | Open in IMG/M |
| 3300005355|Ga0070671_101983902 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005356|Ga0070674_102058672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 520 | Open in IMG/M |
| 3300005366|Ga0070659_101103883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 699 | Open in IMG/M |
| 3300005435|Ga0070714_101838220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 591 | Open in IMG/M |
| 3300005456|Ga0070678_101846963 | Not Available | 570 | Open in IMG/M |
| 3300005530|Ga0070679_100600332 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300005539|Ga0068853_100389147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 1303 | Open in IMG/M |
| 3300005577|Ga0068857_101336845 | Not Available | 696 | Open in IMG/M |
| 3300005764|Ga0066903_107464751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300005840|Ga0068870_11058957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 581 | Open in IMG/M |
| 3300005841|Ga0068863_100719455 | Not Available | 993 | Open in IMG/M |
| 3300005841|Ga0068863_102145308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 569 | Open in IMG/M |
| 3300005844|Ga0068862_101796737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 622 | Open in IMG/M |
| 3300006176|Ga0070765_100613638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 1026 | Open in IMG/M |
| 3300006237|Ga0097621_100378012 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300006237|Ga0097621_101029259 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300006914|Ga0075436_100986694 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300007004|Ga0079218_10885285 | Not Available | 874 | Open in IMG/M |
| 3300007004|Ga0079218_12377039 | Not Available | 622 | Open in IMG/M |
| 3300009156|Ga0111538_11150069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 981 | Open in IMG/M |
| 3300009162|Ga0075423_10155408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 2401 | Open in IMG/M |
| 3300009176|Ga0105242_10181889 | All Organisms → cellular organisms → Bacteria | 1855 | Open in IMG/M |
| 3300009176|Ga0105242_11570576 | Not Available | 691 | Open in IMG/M |
| 3300009177|Ga0105248_10465182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1426 | Open in IMG/M |
| 3300009177|Ga0105248_12871302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300009553|Ga0105249_11997147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300009553|Ga0105249_12023016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300009792|Ga0126374_11807940 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010048|Ga0126373_12039156 | Not Available | 636 | Open in IMG/M |
| 3300010360|Ga0126372_11385602 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300010396|Ga0134126_10475087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1444 | Open in IMG/M |
| 3300010398|Ga0126383_13669139 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300010399|Ga0134127_11547602 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Anatilimnocola → Anatilimnocola floriformis | 736 | Open in IMG/M |
| 3300010399|Ga0134127_12998590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300010400|Ga0134122_13160314 | Not Available | 516 | Open in IMG/M |
| 3300010403|Ga0134123_11790463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300010880|Ga0126350_11670779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 696 | Open in IMG/M |
| 3300012212|Ga0150985_103468208 | Not Available | 615 | Open in IMG/M |
| 3300012212|Ga0150985_115838317 | Not Available | 522 | Open in IMG/M |
| 3300012898|Ga0157293_10045217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium → Haliangium sp. UPWRP_2 | 956 | Open in IMG/M |
| 3300012907|Ga0157283_10128683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 718 | Open in IMG/M |
| 3300012971|Ga0126369_11634713 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300012975|Ga0134110_10236497 | Not Available | 775 | Open in IMG/M |
| 3300013296|Ga0157374_10648479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 1068 | Open in IMG/M |
| 3300013308|Ga0157375_12988681 | Not Available | 565 | Open in IMG/M |
| 3300014325|Ga0163163_11813813 | Not Available | 670 | Open in IMG/M |
| 3300015200|Ga0173480_11272038 | Not Available | 501 | Open in IMG/M |
| 3300015371|Ga0132258_10892104 | All Organisms → cellular organisms → Bacteria | 2245 | Open in IMG/M |
| 3300015371|Ga0132258_12447259 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1307 | Open in IMG/M |
| 3300015373|Ga0132257_100483796 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300015373|Ga0132257_103508744 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300015373|Ga0132257_103938458 | Not Available | 540 | Open in IMG/M |
| 3300016357|Ga0182032_11873667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300017792|Ga0163161_11290791 | Not Available | 634 | Open in IMG/M |
| 3300017792|Ga0163161_11386156 | Not Available | 614 | Open in IMG/M |
| 3300018476|Ga0190274_11433733 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Anatilimnocola → Anatilimnocola floriformis | 780 | Open in IMG/M |
| 3300018476|Ga0190274_13793454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 511 | Open in IMG/M |
| 3300019362|Ga0173479_10054293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 1328 | Open in IMG/M |
| 3300020000|Ga0193692_1012690 | All Organisms → cellular organisms → Bacteria | 2057 | Open in IMG/M |
| 3300021170|Ga0210400_10531584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 970 | Open in IMG/M |
| 3300021433|Ga0210391_10773267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 751 | Open in IMG/M |
| 3300021475|Ga0210392_10672544 | Not Available | 770 | Open in IMG/M |
| 3300022886|Ga0247746_1193893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 531 | Open in IMG/M |
| 3300025321|Ga0207656_10748314 | Not Available | 501 | Open in IMG/M |
| 3300025907|Ga0207645_10004899 | All Organisms → cellular organisms → Bacteria | 9818 | Open in IMG/M |
| 3300025923|Ga0207681_10016388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4636 | Open in IMG/M |
| 3300025923|Ga0207681_10412825 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300025923|Ga0207681_10495327 | Not Available | 1000 | Open in IMG/M |
| 3300025926|Ga0207659_11232618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 643 | Open in IMG/M |
| 3300025931|Ga0207644_10657677 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300025937|Ga0207669_10326840 | Not Available | 1176 | Open in IMG/M |
| 3300025937|Ga0207669_11869370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 513 | Open in IMG/M |
| 3300025945|Ga0207679_10176247 | Not Available | 1765 | Open in IMG/M |
| 3300025945|Ga0207679_12057905 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300025960|Ga0207651_11271574 | Not Available | 661 | Open in IMG/M |
| 3300026075|Ga0207708_11656386 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300027717|Ga0209998_10078835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
| 3300027853|Ga0209274_10579493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → unclassified Rhizobium → Rhizobium sp. NZLR8 | 581 | Open in IMG/M |
| 3300027874|Ga0209465_10662001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 514 | Open in IMG/M |
| 3300027910|Ga0209583_10257021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 773 | Open in IMG/M |
| 3300031184|Ga0307499_10230284 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300031366|Ga0307506_10440245 | Not Available | 542 | Open in IMG/M |
| 3300031708|Ga0310686_117142440 | Not Available | 755 | Open in IMG/M |
| 3300031720|Ga0307469_11590954 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 628 | Open in IMG/M |
| 3300031854|Ga0310904_11080567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300031890|Ga0306925_11747104 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300031912|Ga0306921_11961048 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300032002|Ga0307416_103685020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 513 | Open in IMG/M |
| 3300032005|Ga0307411_11168087 | Not Available | 697 | Open in IMG/M |
| 3300032009|Ga0318563_10258016 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300032013|Ga0310906_10436915 | Not Available | 873 | Open in IMG/M |
| 3300032074|Ga0308173_11526413 | Not Available | 628 | Open in IMG/M |
| 3300032074|Ga0308173_11716770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 591 | Open in IMG/M |
| 3300032075|Ga0310890_10513616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 913 | Open in IMG/M |
| 3300032205|Ga0307472_100422800 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300032211|Ga0310896_10003727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 4300 | Open in IMG/M |
| 3300033433|Ga0326726_11853647 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300034160|Ga0370510_0115541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 817 | Open in IMG/M |
| 3300034663|Ga0314784_176310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.92% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.92% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.96% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.96% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.96% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034160 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03S_18 | Environmental | Open in IMG/M |
| 3300034663 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICI_03059410 | 2088090015 | Soil | VNAMWLPVPGGAHTDAWAQPAIIGQIFDFFDAHKTKMK |
| C688J35102_1199055951 | 3300002568 | Soil | VDHAKAKGVTVTWLPVIGGQHVDAWAQPEILKQTFDFFDKYKAKQK* |
| Ga0068869_1015994441 | 3300005334 | Miscanthus Rhizosphere | KAKGIDATWLPVPGGAHTDAWAQQEILNKTFDFFDAHKTKLK* |
| Ga0070682_1003687752 | 3300005337 | Corn Rhizosphere | AKAKGLNVTWLPVVGGQHVDAWAQPEILKQTFDFFDKYKTKQK* |
| Ga0070661_1014057211 | 3300005344 | Corn Rhizosphere | HAKAKGVNATWLPVVGGMHTDAWAQPEIISQIFDFFDKYRKK* |
| Ga0070671_1019839021 | 3300005355 | Switchgrass Rhizosphere | ASKTMVDHAKAKGVDATWLPVPGGMHTDAWAQPEIVTKIFDFFDAHARR* |
| Ga0070674_1020586722 | 3300005356 | Miscanthus Rhizosphere | DHAKAKGIDATWLPVPGGAHTDAWAQQEILNKTFDFFDAHKTKLK* |
| Ga0070659_1011038831 | 3300005366 | Corn Rhizosphere | KAKGVAATWLPVTGGMHTDAWAQPEVIKQIFDFFDAHKKKG* |
| Ga0070714_1018382201 | 3300005435 | Agricultural Soil | DASKTMVDHAKAQGVDATWLPVIGGAHVDAWAQPEVIKQIFDFFDANKKKG* |
| Ga0070678_1018469632 | 3300005456 | Miscanthus Rhizosphere | VDRAKAKGITITFLPVQGGMHTDAWAQPEIIKQIFDFFDAHKTKTK* |
| Ga0070679_1006003321 | 3300005530 | Corn Rhizosphere | HAKAKGVAATWLPVTGGMHTDAWAQPEVIKQIFDFFDAHKKKG* |
| Ga0068853_1003891471 | 3300005539 | Corn Rhizosphere | MVDHAKAKGVDATWLPVIGGTHIDAWAQPEILEQTFDFFDAHKKKG* |
| Ga0068857_1013368452 | 3300005577 | Corn Rhizosphere | SKAMVDHAKAKGVDATWLPVVGGAHTDAWAQPDVIKQIFDFFDAHKKS* |
| Ga0066903_1074647512 | 3300005764 | Tropical Forest Soil | HAKAKGVDATWLPVPGGAHTDAWAQQEILNKTFDFFDAHKTKAK* |
| Ga0068870_110589571 | 3300005840 | Miscanthus Rhizosphere | KAMIDRAKAKGVNATFLGVAGGQHTDAWAQPEVIKQIFDFFDANKTKLK* |
| Ga0068863_1007194551 | 3300005841 | Switchgrass Rhizosphere | VTWLPVIGGAHVDAWAQPEIIKQTFDFFDKNATKKK* |
| Ga0068863_1021453081 | 3300005841 | Switchgrass Rhizosphere | VEHAKAKGVDATWLPVEGGMHTDAWAQPAVIEKIFDFFDAHKKHL* |
| Ga0068862_1017967372 | 3300005844 | Switchgrass Rhizosphere | QHAKAKGVNATWLPVPGGAHTDAWAQPAIIGQIFDFFDAHRTKTR* |
| Ga0070765_1006136381 | 3300006176 | Soil | MVDHARAKGIDATWLPVAGGMHTDAWAQPEIIKQIFDFFDRHPTKAK* |
| Ga0097621_1003780124 | 3300006237 | Miscanthus Rhizosphere | MIDRAKAKGVNATFLGVAGGQHTDAWAQPEVIKQIFDFFDANKTKLK* |
| Ga0097621_1010292591 | 3300006237 | Miscanthus Rhizosphere | FLGVQGGQHTDAWAQPDIIKQVFDFFDAHKTKVK* |
| Ga0075436_1009866941 | 3300006914 | Populus Rhizosphere | SKVMVDHAKAKGVDATWLPVIGGKHVDAWAQPEIINQIFDFFDAHKTKAQ* |
| Ga0079218_108852851 | 3300007004 | Agricultural Soil | TMVDHAKASGVDATWLPVIGGAHTDAWAQPEILKQTFDFFDKHRTKQK* |
| Ga0079218_123770391 | 3300007004 | Agricultural Soil | TMVDHAKASGVDATWLPVIGGAHTDAWAQPEILKQTFDFFDAHKTKQK* |
| Ga0111538_111500693 | 3300009156 | Populus Rhizosphere | WLPVPGGAHTDAWAQPAIISQIFDFFDAHKTKVK* |
| Ga0075423_101554081 | 3300009162 | Populus Rhizosphere | AKAKGVNVTWLPVPGGAHTDAWAQPAIIGQIFDFFDAHKTKSR* |
| Ga0105242_101818894 | 3300009176 | Miscanthus Rhizosphere | DHAKAKGIDATWLPVPGGAHTDAWAQQDILNKTFDFFDAHKAKLK* |
| Ga0105242_115705761 | 3300009176 | Miscanthus Rhizosphere | KVMVDHAKAKGVNATWLPVIGGMHTDAWAQPEILKQTFDFFDKYKTKQK* |
| Ga0105248_104651822 | 3300009177 | Switchgrass Rhizosphere | GVDATWLPVAGGMHTDAWAQPEIVTKIFDFFDAHKTKAK* |
| Ga0105248_128713021 | 3300009177 | Switchgrass Rhizosphere | TMVDHAKAKGVDATWLPVAGGMHTDAWAQPEIVAKIFAFFDSHPRK* |
| Ga0105249_119971472 | 3300009553 | Switchgrass Rhizosphere | VDHAQAKGVNATWLPVPGGLHTDAWAQPEIIAKIFDFFDSHPRK* |
| Ga0105249_120230161 | 3300009553 | Switchgrass Rhizosphere | AKAKGVDATWLPVAGGAHTDAWAQPEILNQIFDFFDAHKAKAR* |
| Ga0126374_118079401 | 3300009792 | Tropical Forest Soil | ASKVMVDHAVAKGVDATWLPVPGGKHVDAWAQPEIISQVFDFFDKHVGKAK* |
| Ga0126373_120391561 | 3300010048 | Tropical Forest Soil | ASKAMVDHAKAKGVDATWLPVIGGTHIDAWAQPEVIRQIFDFFDAHRKK* |
| Ga0126372_113856021 | 3300010360 | Tropical Forest Soil | KTMVDHAKASGVDATWLPVPGGKHVDAWAQPETLAQIFDFFDRHVGKAK* |
| Ga0134126_104750873 | 3300010396 | Terrestrial Soil | FDASKAMVDHAKAQGVDATWLPVVGGAHVDAWAQPEVIKQIFDFFDAHKK* |
| Ga0126383_136691392 | 3300010398 | Tropical Forest Soil | RAKGVDATWLPVPGGKHVDAWAQPEIISQVFDFFDRHAGKAK* |
| Ga0134127_115476023 | 3300010399 | Terrestrial Soil | AKGVNATWLPVAGGMHTDAWAQPEVISQIFDFFDKYKKK* |
| Ga0134127_129985902 | 3300010399 | Terrestrial Soil | WLPVIGGAHVDAWAQPDILKQTFDFFDKNPTKKK* |
| Ga0134122_131603141 | 3300010400 | Terrestrial Soil | HAKEKGVDATWLPVGGGMHTDAWAQPEIIKQIFDFFDAHRTKAK* |
| Ga0134123_117904633 | 3300010403 | Terrestrial Soil | VDATWLPVAGGAHTDAWAQPEILNQIFDFFDAHKAKAR* |
| Ga0126350_116707791 | 3300010880 | Boreal Forest Soil | RLMVDHAKAKGIDATWLPVAGGMHTDAWAQPEIIKQIFDFYESHKARKN* |
| Ga0150985_1034682082 | 3300012212 | Avena Fatua Rhizosphere | GSKVMVDHAKAKGVNATWLPVIGGAHTDAWAQPEILKQTFDFFDKYKTKQK* |
| Ga0150985_1158383172 | 3300012212 | Avena Fatua Rhizosphere | HAKAKGINVTWLPVIGGQHVDAWAQPEILEQTFDFFDKYKAKQK* |
| Ga0157293_100452172 | 3300012898 | Soil | SKAMVDHATAKGLNVTWLPVIGGAHVDAWAQPEILKQTFDFFDKNATKKK* |
| Ga0157283_101286831 | 3300012907 | Soil | HAKAKGVSATWLPVPGGAHTDAWAQPAIISQIFDFFDAHKTKMK* |
| Ga0126369_116347131 | 3300012971 | Tropical Forest Soil | TWLPVPGGKHVDAWAQPEILGQIFDFFDRHVGKAK* |
| Ga0134110_102364971 | 3300012975 | Grasslands Soil | DASKTMVDHAKAKGIDATWLPVAGGMHTDAWAQPEIIKQIFDFFDAHKTRKKS* |
| Ga0157374_106484792 | 3300013296 | Miscanthus Rhizosphere | MVDHAKAKGIDATWLPVPGGAHTDAWAQQDILNKTFDFFDAHKTKLK* |
| Ga0157375_129886811 | 3300013308 | Miscanthus Rhizosphere | NATFVGVAGGQHTDAWAQPEIIKQIFDFFDANKTKLK* |
| Ga0163163_118138131 | 3300014325 | Switchgrass Rhizosphere | KAKGVNATWLPVIGGMHTDAWAQPEILKQTFDFYDRYKTRQK* |
| Ga0173480_112720382 | 3300015200 | Soil | NVTWLPVIGGAHVDAWAQPEIIKQTFDFFDKNATKKK* |
| Ga0132258_108921041 | 3300015371 | Arabidopsis Rhizosphere | TMVDHAQAKGVNATWLPVPGGLHTDAWAQPEIIAKIFDFFDAHPRK* |
| Ga0132258_124472591 | 3300015371 | Arabidopsis Rhizosphere | HAKAKGVDATWLPVAGGQHTDAWAQPEIIKQEFAFFDAHVRKAGGAPPK* |
| Ga0132257_1004837963 | 3300015373 | Arabidopsis Rhizosphere | HAQAKGVNATWLPVPGGLHTDAWAQPEIIAKIFDFFDSHPRK* |
| Ga0132257_1035087442 | 3300015373 | Arabidopsis Rhizosphere | MDGTWLPVPGGMHTDAWAQPEIIKQIFDFFDAHSRKKSS* |
| Ga0132257_1039384581 | 3300015373 | Arabidopsis Rhizosphere | TWLPVPGGAHTDAWAQQEILNKTFDFFDAHKTKLK* |
| Ga0182032_118736672 | 3300016357 | Soil | DATWLPVIGGKHVDAWAQPEVLNQIFGFFDAHKSKAQ |
| Ga0163161_112907911 | 3300017792 | Switchgrass Rhizosphere | ARGVNATFLGVQGGIHTDAWAQPEIIKQIFDFFDAHKTKAK |
| Ga0163161_113861562 | 3300017792 | Switchgrass Rhizosphere | NATWLPVVGGMHTDAWAQPEIISQIFDFFDKYRKK |
| Ga0190274_114337332 | 3300018476 | Soil | FDASKTMVDHAKAKGVNATWLPVAGGMHTDAWAQPEIISQIFDFFDKYKKK |
| Ga0190274_137934542 | 3300018476 | Soil | DASKAMVDHALAKGVDATWLPVAGGLHTDAWAQPEIIAKIFDFFDTHARK |
| Ga0173479_100542931 | 3300019362 | Soil | MVDHAKAKGIDATWLPVPGGAHTDAWAQQEILNKTFDFFDAHKTKLK |
| Ga0193692_10126901 | 3300020000 | Soil | TFMGVTGGQHTDAWAQPEIIKQIFDFFDANKTKLKQ |
| Ga0210400_105315841 | 3300021170 | Soil | KGVDATWLPVAGGMHVDAWAQPDVIRQIFDFFDAHRKKG |
| Ga0210391_107732671 | 3300021433 | Soil | AMVDHAKVKGVNATWLPVAGGMHTDAWAQPEVIEEIFNFFDAHRKKH |
| Ga0210392_106725441 | 3300021475 | Soil | VDATWLPVVGGAHTDAWAQPEVIEQIFNFFDAHRKKG |
| Ga0247746_11938932 | 3300022886 | Soil | SKTMVDHAKAKGIDATWLPVPGGAHTDAWAQQEILNKTFDFFDAHKTKLK |
| Ga0207656_107483142 | 3300025321 | Corn Rhizosphere | KGLNVTWLPVIGGQHVDAWAQPEILKQTFDFFDKYKTKQK |
| Ga0207645_100048991 | 3300025907 | Miscanthus Rhizosphere | ASKTMVDHAQAKGVDATWLPVAGGLHTDAWAQPEVIAKIFDFFDTHARK |
| Ga0207681_100163888 | 3300025923 | Switchgrass Rhizosphere | GVNAIWLPVPGGLHTDAWAQPEIIAKIFDFFDSHPRK |
| Ga0207681_104128251 | 3300025923 | Switchgrass Rhizosphere | AKGVDATWLPVAGGLHTDAWAQPEIIAKIFDFFDSHPRK |
| Ga0207681_104953271 | 3300025923 | Switchgrass Rhizosphere | KGIDATWLPVPGGAHTDAWAQQEILNKTFDFFDAHKTKLK |
| Ga0207659_112326182 | 3300025926 | Miscanthus Rhizosphere | ARAKGVDATWLPVEGGLHTDAWAQPAVLSRIFDFFDAHKKHL |
| Ga0207644_106576772 | 3300025931 | Switchgrass Rhizosphere | AKAKGVDATWLPVAGGLHTDAWAQPEIIAKIFDFFDAHPRK |
| Ga0207669_103268401 | 3300025937 | Miscanthus Rhizosphere | MVDHATAKGLNVTWLPVIGGAHVDAWAQPDILKQTFDFFDKNATKKK |
| Ga0207669_118693702 | 3300025937 | Miscanthus Rhizosphere | DHAKAKGIDATWLPVPGGAHTDAWAQQEILNKTFDFFDAHKTKLK |
| Ga0207679_101762471 | 3300025945 | Corn Rhizosphere | AWLPVAGGLHTDAWAQPEIITQIFDFFDKHTAKAK |
| Ga0207679_120579052 | 3300025945 | Corn Rhizosphere | VDHAKAKGVNATWLPVVGGMHTDAWAQPEIVTQIFDFFDKYKKK |
| Ga0207651_112715742 | 3300025960 | Switchgrass Rhizosphere | DHAKAKGINATWLPVVGGMHIDAWAQPEILKQTFDFFDKYKTKQK |
| Ga0207708_116563862 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MDYAAGKAMIDRAKARGVNATFLGVQGGIHTDAWAQPEIIKQIFDFFDAHKTKAK |
| Ga0209998_100788352 | 3300027717 | Arabidopsis Thaliana Rhizosphere | ASETMVAHAKAKGVDATWLPVPGGAHTDAWAQPAIISRIFDFFDAHRTKLK |
| Ga0209274_105794932 | 3300027853 | Soil | KAKGVNATWLPVAGGAHTDAWAQPEVIEKIFDFFDAHRKRS |
| Ga0209465_106620011 | 3300027874 | Tropical Forest Soil | VDQAKAKGVDATWLPVPGGAHTDAWAQQEILNKTFDFFDAHKTKAK |
| Ga0209583_102570213 | 3300027910 | Watersheds | VMVDHAKARGVDATWSPVPGGKHVDAWAQPEIIAKIFDFFDAHKTKAK |
| Ga0307499_102302842 | 3300031184 | Soil | ATWLPVAGGKHTDAWAQPEIVAQIFDFFDKHTTKVK |
| Ga0307506_104402451 | 3300031366 | Soil | IDRAKTKGVNATFVGVAGGQHTDAWAQPEIIKQIFDFFDANKTKRK |
| Ga0310686_1171424401 | 3300031708 | Soil | HARAKGIDATWLPVAGGMHTDAWAQPEIITQIFDFFDRHKTKAK |
| Ga0307469_115909542 | 3300031720 | Hardwood Forest Soil | MVDHARAKGVDATWLPVIGGKHVDAWAQPEIINQIFDFFDAHKTKAQ |
| Ga0310904_110805671 | 3300031854 | Soil | FSASETMVQHAKAKGVSATWLPVPGGAHTDAWAQPAVINQIFDFFDAHKTKAK |
| Ga0306925_117471042 | 3300031890 | Soil | KARGVDATWLPVPGGKHVDAWAQPEVISQVFDFFDRHVGKAK |
| Ga0306921_119610482 | 3300031912 | Soil | MVDHARAKGVDATWLPVPGGKHVDAWAQPDIISQVFDFFDKHAGKAK |
| Ga0307416_1036850201 | 3300032002 | Rhizosphere | AHANAKGVNATWLPVPGGAHTDAWAQPAVISQIFDFFDAHRTKLK |
| Ga0307411_111680871 | 3300032005 | Rhizosphere | KVMVDHARAKGVNVAWLPVVGGAHTDAWAHPEILKQTFDFYDKYQTKLK |
| Ga0318563_102580162 | 3300032009 | Soil | SKTMVDHAKARGVDATWLPVPGGKHVDAWAQPEILGQIFDFFDRHVGKAK |
| Ga0310906_104369152 | 3300032013 | Soil | AKAKGVSATWLPVPGGAHTDAWAQPAVINQIFDFFDAHKTKAK |
| Ga0308173_115264131 | 3300032074 | Soil | GLNVTWLPVIGGQHVDAWAQPEILKQTFDFFDKYKTKQK |
| Ga0308173_117167701 | 3300032074 | Soil | HAKAKGVDATWLPVAGGMHTDAWAQPEVIKQIFDFFDAHRKRS |
| Ga0310890_105136161 | 3300032075 | Soil | VMVDHATAKGLNVTWLPVIGGAHVDAWAQPDILKQTFDFFDKNATKKK |
| Ga0307472_1004228002 | 3300032205 | Hardwood Forest Soil | KGVDATWLPVPGGKHVDAWAQPEIISQIFDFFDAHKTKAR |
| Ga0310896_100037275 | 3300032211 | Soil | SETMVQHAKAKGVSATWLPVPGGAHTDAWAQPAIISQIFDFFDAHKTKTK |
| Ga0326726_118536472 | 3300033433 | Peat Soil | DATWLPVPGGKHVDAWAQPEIIAKVFDFFDAHKTKAK |
| Ga0370510_0115541_10_144 | 3300034160 | Untreated Peat Soil | MVDHAKAKGVDATWLPVAGGAHTDAWAQPAVIAQIFDFFDAHRR |
| Ga0314784_176310_360_500 | 3300034663 | Soil | VQHAKAKGVSATWLPVPGGAHTDAWAQPAIISQIFDFFDAHKTKTK |
| ⦗Top⦘ |