| Basic Information | |
|---|---|
| Family ID | F097701 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VSSDMTRQRAEIEGAIAGRTLCDELRHVAETSGDADAYSDEA |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.15 % |
| % of genes near scaffold ends (potentially truncated) | 99.04 % |
| % of genes from short scaffolds (< 2000 bps) | 88.46 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.885 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.192 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.57% β-sheet: 0.00% Coil/Unstructured: 61.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00441 | Acyl-CoA_dh_1 | 6.73 |
| PF02622 | DUF179 | 4.81 |
| PF01494 | FAD_binding_3 | 3.85 |
| PF13452 | MaoC_dehydrat_N | 2.88 |
| PF00797 | Acetyltransf_2 | 2.88 |
| PF01425 | Amidase | 2.88 |
| PF00106 | adh_short | 1.92 |
| PF07729 | FCD | 1.92 |
| PF00501 | AMP-binding | 1.92 |
| PF06742 | DUF1214 | 1.92 |
| PF02979 | NHase_alpha | 0.96 |
| PF02770 | Acyl-CoA_dh_M | 0.96 |
| PF13657 | Couple_hipA | 0.96 |
| PF04672 | Methyltransf_19 | 0.96 |
| PF08541 | ACP_syn_III_C | 0.96 |
| PF00082 | Peptidase_S8 | 0.96 |
| PF16859 | TetR_C_11 | 0.96 |
| PF12740 | Chlorophyllase2 | 0.96 |
| PF01872 | RibD_C | 0.96 |
| PF14117 | DUF4287 | 0.96 |
| PF08044 | DUF1707 | 0.96 |
| PF06863 | DUF1254 | 0.96 |
| PF02661 | Fic | 0.96 |
| PF13302 | Acetyltransf_3 | 0.96 |
| PF07992 | Pyr_redox_2 | 0.96 |
| PF02771 | Acyl-CoA_dh_N | 0.96 |
| PF13602 | ADH_zinc_N_2 | 0.96 |
| PF00440 | TetR_N | 0.96 |
| PF00534 | Glycos_transf_1 | 0.96 |
| PF10415 | FumaraseC_C | 0.96 |
| PF00196 | GerE | 0.96 |
| PF13561 | adh_short_C2 | 0.96 |
| PF00912 | Transgly | 0.96 |
| PF03976 | PPK2 | 0.96 |
| PF02211 | NHase_beta | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 8.65 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 7.69 |
| COG1678 | Putative transcriptional regulator, AlgH/UPF0301 family | Transcription [K] | 4.81 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 3.85 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 3.85 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 3.85 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 2.88 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 2.88 |
| COG2162 | Arylamine N-acetyltransferase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.88 |
| COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 1.92 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 1.92 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 1.92 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.96 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.96 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.96 % |
| Unclassified | root | N/A | 24.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908016|OU_2_1_1_newblercontig133688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 639 | Open in IMG/M |
| 3300004152|Ga0062386_100060901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2856 | Open in IMG/M |
| 3300005366|Ga0070659_101664332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea coxensis | 570 | Open in IMG/M |
| 3300005435|Ga0070714_101736393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 609 | Open in IMG/M |
| 3300005435|Ga0070714_101807768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
| 3300005439|Ga0070711_100614398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 908 | Open in IMG/M |
| 3300005537|Ga0070730_10436606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 844 | Open in IMG/M |
| 3300006052|Ga0075029_101293105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium roseum | 512 | Open in IMG/M |
| 3300006176|Ga0070765_101128472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 741 | Open in IMG/M |
| 3300006575|Ga0074053_11514843 | Not Available | 677 | Open in IMG/M |
| 3300006579|Ga0074054_11964461 | Not Available | 727 | Open in IMG/M |
| 3300006606|Ga0074062_10147410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 587 | Open in IMG/M |
| 3300006804|Ga0079221_10253873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1001 | Open in IMG/M |
| 3300006854|Ga0075425_101237777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 847 | Open in IMG/M |
| 3300006903|Ga0075426_11275183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
| 3300009162|Ga0075423_10317959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1632 | Open in IMG/M |
| 3300009683|Ga0116224_10568708 | Not Available | 541 | Open in IMG/M |
| 3300010048|Ga0126373_11482037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 744 | Open in IMG/M |
| 3300010154|Ga0127503_10672761 | Not Available | 929 | Open in IMG/M |
| 3300010361|Ga0126378_12133570 | Not Available | 639 | Open in IMG/M |
| 3300010373|Ga0134128_11177185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 846 | Open in IMG/M |
| 3300010376|Ga0126381_103027572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 667 | Open in IMG/M |
| 3300010396|Ga0134126_11760386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 680 | Open in IMG/M |
| 3300010396|Ga0134126_12077923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 620 | Open in IMG/M |
| 3300010397|Ga0134124_11459088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 711 | Open in IMG/M |
| 3300010861|Ga0126349_1294808 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300012210|Ga0137378_10543984 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300013105|Ga0157369_11639367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 654 | Open in IMG/M |
| 3300013307|Ga0157372_11103072 | Not Available | 918 | Open in IMG/M |
| 3300014657|Ga0181522_10338752 | Not Available | 895 | Open in IMG/M |
| 3300016422|Ga0182039_10906909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium aridum | 787 | Open in IMG/M |
| 3300016422|Ga0182039_12140117 | Not Available | 516 | Open in IMG/M |
| 3300017924|Ga0187820_1009131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2362 | Open in IMG/M |
| 3300017924|Ga0187820_1096854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora | 845 | Open in IMG/M |
| 3300017942|Ga0187808_10050756 | Not Available | 1755 | Open in IMG/M |
| 3300017947|Ga0187785_10155584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 964 | Open in IMG/M |
| 3300017973|Ga0187780_10114308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1863 | Open in IMG/M |
| 3300017975|Ga0187782_10404426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1038 | Open in IMG/M |
| 3300018060|Ga0187765_11075070 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300018085|Ga0187772_10035301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2997 | Open in IMG/M |
| 3300018085|Ga0187772_10050308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. WAC07061 | 2557 | Open in IMG/M |
| 3300020581|Ga0210399_10238097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1516 | Open in IMG/M |
| 3300021404|Ga0210389_10295284 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300021404|Ga0210389_11283121 | Not Available | 561 | Open in IMG/M |
| 3300021407|Ga0210383_10069552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2939 | Open in IMG/M |
| 3300021407|Ga0210383_10943407 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300021432|Ga0210384_11731205 | Not Available | 530 | Open in IMG/M |
| 3300021560|Ga0126371_11745509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 745 | Open in IMG/M |
| 3300022467|Ga0224712_10341712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 706 | Open in IMG/M |
| 3300024249|Ga0247676_1054107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 656 | Open in IMG/M |
| 3300025906|Ga0207699_11463818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300025915|Ga0207693_10940249 | Not Available | 662 | Open in IMG/M |
| 3300025981|Ga0207640_10582202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 945 | Open in IMG/M |
| 3300026959|Ga0207852_1025360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 610 | Open in IMG/M |
| 3300027043|Ga0207800_1043387 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300027168|Ga0208239_1006027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1032 | Open in IMG/M |
| 3300027516|Ga0207761_1102625 | Not Available | 557 | Open in IMG/M |
| 3300027986|Ga0209168_10654641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
| 3300028556|Ga0265337_1000860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 15962 | Open in IMG/M |
| 3300028780|Ga0302225_10156996 | Not Available | 1102 | Open in IMG/M |
| 3300028793|Ga0307299_10075301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1254 | Open in IMG/M |
| 3300028877|Ga0302235_10001979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 15005 | Open in IMG/M |
| 3300029910|Ga0311369_10638529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium shigaense | 883 | Open in IMG/M |
| 3300029944|Ga0311352_10181154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1806 | Open in IMG/M |
| 3300030013|Ga0302178_10536681 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon | 506 | Open in IMG/M |
| 3300030053|Ga0302177_10015844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4895 | Open in IMG/M |
| 3300030056|Ga0302181_10039259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia spinosispora | 2562 | Open in IMG/M |
| 3300030057|Ga0302176_10133180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 981 | Open in IMG/M |
| 3300030503|Ga0311370_10013000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13065 | Open in IMG/M |
| 3300031233|Ga0302307_10250833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 908 | Open in IMG/M |
| 3300031544|Ga0318534_10654802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
| 3300031546|Ga0318538_10548024 | Not Available | 627 | Open in IMG/M |
| 3300031549|Ga0318571_10465776 | Not Available | 504 | Open in IMG/M |
| 3300031640|Ga0318555_10512144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 650 | Open in IMG/M |
| 3300031679|Ga0318561_10278423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 914 | Open in IMG/M |
| 3300031679|Ga0318561_10450954 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300031681|Ga0318572_10421824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
| 3300031708|Ga0310686_107892081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 920 | Open in IMG/M |
| 3300031713|Ga0318496_10338037 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300031713|Ga0318496_10384054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 776 | Open in IMG/M |
| 3300031751|Ga0318494_10315327 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300031769|Ga0318526_10468536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 514 | Open in IMG/M |
| 3300031770|Ga0318521_10117645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1482 | Open in IMG/M |
| 3300031771|Ga0318546_11327659 | Not Available | 505 | Open in IMG/M |
| 3300031795|Ga0318557_10443693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium aridum | 597 | Open in IMG/M |
| 3300031805|Ga0318497_10086275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia alba | 1670 | Open in IMG/M |
| 3300031805|Ga0318497_10615099 | Not Available | 609 | Open in IMG/M |
| 3300031879|Ga0306919_11219225 | Not Available | 571 | Open in IMG/M |
| 3300031896|Ga0318551_10345649 | Not Available | 841 | Open in IMG/M |
| 3300031896|Ga0318551_10841642 | Not Available | 534 | Open in IMG/M |
| 3300031896|Ga0318551_10855571 | Not Available | 530 | Open in IMG/M |
| 3300031910|Ga0306923_11471823 | Not Available | 714 | Open in IMG/M |
| 3300032090|Ga0318518_10458522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 653 | Open in IMG/M |
| 3300032090|Ga0318518_10580958 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300032160|Ga0311301_10806620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1288 | Open in IMG/M |
| 3300032174|Ga0307470_10028036 | All Organisms → cellular organisms → Bacteria | 2642 | Open in IMG/M |
| 3300032180|Ga0307471_102794730 | Not Available | 620 | Open in IMG/M |
| 3300032828|Ga0335080_11726052 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300032828|Ga0335080_11748422 | Not Available | 608 | Open in IMG/M |
| 3300032892|Ga0335081_10286358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. SDr-06 | 2194 | Open in IMG/M |
| 3300032898|Ga0335072_10637786 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300032954|Ga0335083_10215457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1744 | Open in IMG/M |
| 3300033134|Ga0335073_11575958 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300033289|Ga0310914_11495248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 579 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.88% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.92% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.92% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.96% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.96% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.96% |
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.96% | |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908016 | Sample 642 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027043 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027168 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OU_00084000 | 2124908016 | VEETVSRDMTRQRSEIEGAIAGRTLCDELRQAAETSGDAWAYSDEAGTGAAGSP | |
| Ga0062386_1000609011 | 3300004152 | Bog Forest Soil | MVNSDIVRQRAEIEGMLAGRTLCDELRDVAETAGDAYAFSDEA |
| Ga0070659_1016643321 | 3300005366 | Corn Rhizosphere | VSSDIVQRRAEIEDVIAGRTLCDELRHVAETSGDAWAYSDEAVTGTDAEAGDGWQS |
| Ga0070714_1017363932 | 3300005435 | Agricultural Soil | VSSDIMRRRAEIEAVIAGRTLCDELRDVAEASGAAGAYSDEDEAGWR |
| Ga0070714_1018077682 | 3300005435 | Agricultural Soil | VSSDMTRQRAEIEGAIAGRTLCDELRHVAETSGDADAYSDEA |
| Ga0070711_1006143982 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSSDVTRQRREIEDAIAGRTLCDELREVAESAGDAGAYSDGAESAAGDGWH |
| Ga0070730_104366062 | 3300005537 | Surface Soil | MVSGDIMRQRAEIESAIAGRTLCDELRQVAETAGD |
| Ga0075029_1012931051 | 3300006052 | Watersheds | VSSEIVQQRAAIEGVIAGRTLCDELRQVAETSGDAWAY |
| Ga0070765_1011284722 | 3300006176 | Soil | MVSSEIMRQRAEIESAIAGRTLCDELRQVAETAGDA |
| Ga0074053_115148431 | 3300006575 | Soil | VSSDMTRQRTEIEGVIAGRTLCDELRQVAEISGDAW |
| Ga0074054_119644611 | 3300006579 | Soil | MSSDIVRRRAEIEGVIAGRTLCDELRHVAETSGDAW |
| Ga0074062_101474102 | 3300006606 | Soil | VSSDMTRQRAEIEGVIAGRTVCDELRRVAEVSGDAWAYSDEAGA |
| Ga0079221_102538733 | 3300006804 | Agricultural Soil | MASVRLRKVEETVSSEMNRQRTEIEGAIAGRTLCDELRHVAETSGDAGAYSDE |
| Ga0075425_1012377772 | 3300006854 | Populus Rhizosphere | MSSDIVRQRAEIEGVIAGRTLCDELRQVAETAGDADAYSDEA |
| Ga0075426_112751831 | 3300006903 | Populus Rhizosphere | MTRQRAEIEGAIAGRTLCDELRQAAETSGDAWAYSDEAGA |
| Ga0075423_103179593 | 3300009162 | Populus Rhizosphere | VEETVSSDMTWQRTEIEGEIAGRTLCDELRQAAKASGDAWAYSDEA |
| Ga0116224_105687081 | 3300009683 | Peatlands Soil | MVRRRAEIEGVIAGRTLCDELRDVAATAGDASAYSDE |
| Ga0126373_114820373 | 3300010048 | Tropical Forest Soil | MVGSGIVRQRAEIEGVIAGRTLCDELRHVAETRGDADAYSD |
| Ga0127503_106727611 | 3300010154 | Soil | VSSDIVRRRAEIEGVIAGRTLCDELRRVAETSGDAWAYSDEAVTGAGDGW* |
| Ga0126378_121335701 | 3300010361 | Tropical Forest Soil | MVSSDIARQRAEIEDKIAGRTLCDELREVAETAGDAGAYADEAGTGAG |
| Ga0134128_111771851 | 3300010373 | Terrestrial Soil | VEETVSSDMTRQRTEIEGAIAGRTLCDELRQAAETSGD |
| Ga0126381_1030275722 | 3300010376 | Tropical Forest Soil | VSSDVIRQRAEIEDVIAGRTLCDELRHVAETSGEAYAYSDEAVNGADA |
| Ga0134126_117603862 | 3300010396 | Terrestrial Soil | MMSSDIVRQRAEIEGVIAGRTLCDELRQVAETAGDAGAYSDEAG |
| Ga0134126_120779231 | 3300010396 | Terrestrial Soil | VEETVSSDMTRQRTEIEGAIAGRTLCDELRQAAETSG |
| Ga0134124_114590882 | 3300010397 | Terrestrial Soil | VSSDMTRQRTEIEGAIAGRTLCDELRQAAETSGDAWAYSDEAG |
| Ga0126349_12948081 | 3300010861 | Boreal Forest Soil | VSSDIARQRAEIESVIAGRTLCDELRHVAESCGDARAYSDEAGAGGG |
| Ga0137378_105439841 | 3300012210 | Vadose Zone Soil | MTRQRTEIEGAIAGRTLCDELRQAAETSGDALAYSDETGTGADAGGGDGWRSLTWSQA |
| Ga0157369_116393672 | 3300013105 | Corn Rhizosphere | VEETVSSDMTRQRTEIEGAIAGRTLCDELRQAAET |
| Ga0157372_111030721 | 3300013307 | Corn Rhizosphere | VEETVSSDIVQRRAEIEDVIAGRTLCDELRHVAETSG |
| Ga0181522_103387521 | 3300014657 | Bog | VEETVSSDVVRRRAEIEGVIAGRTLCDELRDVAATAGDASAYSDEAGTGAVAGAGWR |
| Ga0182039_109069091 | 3300016422 | Soil | MRSDTARQRAEIEDQIAGRTLCDELRDVAEASGDADAYSD |
| Ga0182039_121401171 | 3300016422 | Soil | VEGTVSSDIVRLRAEIEGVIAGRTICDELRHAAETWGDAYAYSDEVVTGADAG |
| Ga0187820_10091315 | 3300017924 | Freshwater Sediment | MVNSDIARQRAEIEGLLTGRTLCDELRDVAETAGDAYAYSDEAGTEAGAGAG |
| Ga0187820_10968542 | 3300017924 | Freshwater Sediment | VSGDLTRQRAEIEDVIAGRTLCDELRHVAETAGDGYAYSDEVVTGADA |
| Ga0187808_100507561 | 3300017942 | Freshwater Sediment | VSSDIVRQRAEIEDVIAGRTLCDELRHVAETAGDSYAYSDAAVTGADAGSSDAWLSLTWSQARQR |
| Ga0187785_101555841 | 3300017947 | Tropical Peatland | MVGSGIVRQRAEIEGVIAGRTLCDELRHVAETRGDADAYSDEAGTGDGWRS |
| Ga0187780_101143081 | 3300017973 | Tropical Peatland | VSSDIVRQRAEIEGVIAGRTLCDELRDVAETSGDADAYSDEAVTGAEAGDGAGD |
| Ga0187782_104044262 | 3300017975 | Tropical Peatland | VSSDIARQRAEIEGVTAGLTLCDELRQVAETTGDGYAYSDEDVTGADAG |
| Ga0187765_110750702 | 3300018060 | Tropical Peatland | VSGDIVRQRAEIEAVIAGRTLCDELRHIAETSGDAYAYSDEAVTGSGDGWQS |
| Ga0187772_100353011 | 3300018085 | Tropical Peatland | VSRDIVRQRAEIEAVIAGRSLCDELRQVAETAGDSYAYSDEAVTGADAGAGDGW |
| Ga0187772_100503081 | 3300018085 | Tropical Peatland | VSSDIARQRAEIEGVIAGRTLCDELRHVAETTADGYAYSDEVVTGADAT |
| Ga0210399_102380973 | 3300020581 | Soil | VSSDIVRQRAEIEAVIAGRTLCDELRHVAEASGAAGAYSDEDEA |
| Ga0210389_102952841 | 3300021404 | Soil | VNSDIVRQRTEIEGVTAGRTLCDELRHVAETCGDVPAYSD |
| Ga0210389_112831211 | 3300021404 | Soil | VSSDIVQRRAEIEGVIAGRTLCDELRHVAETSGDAWA |
| Ga0210383_100695521 | 3300021407 | Soil | VSSDIVRQRAEIEAVIAGRTLCDELRHVAEASGAAGAYSDE |
| Ga0210383_109434072 | 3300021407 | Soil | VGSDIARQRAEIEDEIAGRTLCDELRQLAGSAGDAGAY |
| Ga0210384_117312051 | 3300021432 | Soil | VSSEIVRRRAEIEGVIAGRTLCDELRHVAETSGDAWAYSNQAGAGDGWQ |
| Ga0126371_117455092 | 3300021560 | Tropical Forest Soil | VSSDVVRQRAEIEGAIAGRTLCDELRDVAETSGDA |
| Ga0224712_103417121 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSDMTRQRTEIEGAIAGRTLCDELRQAAETSGDAWAYSDEAGAGGGW |
| Ga0247676_10541072 | 3300024249 | Soil | VSSDMTRQRTEIEGAIAGRTLCDELRQAAETSGDA |
| Ga0207699_114638182 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSEMTRLRAEIEGVIAGRTLCDELRHVAETSGDADAYSDEAGTGEGWRS |
| Ga0207693_109402491 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSDIVQRRAEIEDVIAGRTLCDELRHVAETSGDAWAYSDEAVTGGTDAEPGDDGWQSLT |
| Ga0207640_105822022 | 3300025981 | Corn Rhizosphere | VSSDMTRQRTEIEGAIAGRTLCDKLRQAAETSGDAW |
| Ga0207852_10253602 | 3300026959 | Tropical Forest Soil | VSSDIVRQRAEIEDVIAGRTLCDELRHVAETAGDSYAYSDAAVTGA |
| Ga0207800_10433871 | 3300027043 | Tropical Forest Soil | VSSDVFRQRAEIEDVIAGRTLCDELRHVAETAGDSYAYSDAAVTGADAGSSDAWPSL |
| Ga0208239_10060271 | 3300027168 | Forest Soil | VSSDIVQRRAEIEGVIAGRTLCDELRHVAETSGDAWAYSDE |
| Ga0207761_11026252 | 3300027516 | Tropical Forest Soil | VSSDIVRQRAEIEGLIAGRTLCDALRDVAETSGDAIAYSD |
| Ga0209168_106546412 | 3300027986 | Surface Soil | VSSDTARQRAEIEAVIAGQTLCDELRHVAETSGAAGAYSDE |
| Ga0265337_10008601 | 3300028556 | Rhizosphere | VSSDIARQRAEIEYEIAGRTLCDELRQLAETAGDAGAYS |
| Ga0302225_101569962 | 3300028780 | Palsa | MVSRDIVRQRAEIEGLIAGRTLCDELRHAAETAGDAGAYSDM |
| Ga0307299_100753013 | 3300028793 | Soil | VSSDMTRQRTEIEGAIAGRTLCDELRQVAETSGDAWAYSDE |
| Ga0302235_100019791 | 3300028877 | Palsa | MVSRDIVRQRAEIEGVIAGRTLCDELRHAAETSGDAGAYSDMA |
| Ga0311369_106385291 | 3300029910 | Palsa | MVSRDIVRQRAEIEGLIAGRTLCDELRHAAETAGDAGAYSD |
| Ga0311352_101811545 | 3300029944 | Palsa | VGRDIVRQRAEIEGVIAGRTLCDELRHAAETAGDAGAYSDMAGAGDDWRSLTW |
| Ga0302178_105366812 | 3300030013 | Palsa | VSSDVVRQRAEIESVTAGRTLCDELRHVAEACGDARAYSDEA |
| Ga0302177_100158444 | 3300030053 | Palsa | MVSRDIVRQRAEIEGLIAGRTLCDELRHAAETAGDAGAYSDMAGAGDDWRSLTWE |
| Ga0302181_100392593 | 3300030056 | Palsa | MVSRDIVRQRAEIEGVIAGRTLCDELRHAAETSGDAGAY |
| Ga0302176_101331803 | 3300030057 | Palsa | VGRDIVRQRAEIEGVIAGRTLCDELRHAAETAGDAG |
| Ga0311370_100130001 | 3300030503 | Palsa | VGRDIVRQRAEIEGVIAGRTLCDELRHAAETAGDAGAYSDMAGAGDDWR |
| Ga0302307_102508331 | 3300031233 | Palsa | MVSRDIVRQRAEIEGLIAGRTLCDELRHAAETAGDAGAYSDMAGAGD |
| Ga0318534_106548022 | 3300031544 | Soil | VSSDIAGRRAEIEAVIAGWTLCDELRHVAETSGAA |
| Ga0318538_105480241 | 3300031546 | Soil | MRSDIARQRAEIEDQIAGRTLCDELRDVAEASGAD |
| Ga0318571_104657762 | 3300031549 | Soil | VNGDVIRQRAEIEGVIAGRTLCDELRHVAETAGDDYAYSDAAVTG |
| Ga0318555_105121441 | 3300031640 | Soil | VSSDIVRLRAEIEGAIAGRTICDELRHAAETWGDAY |
| Ga0318561_102784232 | 3300031679 | Soil | VSSDIVRQRAEIEGVIAGRILCDELRHVAETAGDSYAYSDEAGDGWQSLTWS |
| Ga0318561_104509541 | 3300031679 | Soil | VSSDTFQQRFEIEALIAGRTLCDELRDVAETSGDAYAYSDEAVTGDDWQSLT |
| Ga0318572_104218241 | 3300031681 | Soil | VEGTVSSDIVRLRAEIEGVIAGRTICDELRHAAETWGDAYAYSDEVVTGADAGAGAG |
| Ga0310686_1078920811 | 3300031708 | Soil | MVNSDVMRQRAEIEGMLAGRTLCDELRDVAETAGDAYAFS |
| Ga0318496_103380372 | 3300031713 | Soil | VSSDIVQRRAEIEDAIAGRTLCDELRHVAETSGDAWAYSEEAVTGADAVAGDGWQTLT |
| Ga0318496_103840541 | 3300031713 | Soil | VSSDIVRQRAEIEGVIAGRILCDELRHVAETAGDSYAYSDEAGDGWQSLT |
| Ga0318494_103153272 | 3300031751 | Soil | VSSDIIQQRAEIESVIAGRILCDELQHVAETSGDAYAYSDEAVTGADAA |
| Ga0318526_104685361 | 3300031769 | Soil | VSSDIVRQRAEIEGVIAGRILCDELRHVAETAGDSYAYSDEAGDGWQSLTWSQAR |
| Ga0318521_101176453 | 3300031770 | Soil | VSSDIAGRRAEIEAVIAGRTLCDELRHVAETSGAAGAYSDEDEAGWR |
| Ga0318546_113276591 | 3300031771 | Soil | MRQRAEIEGATAGRTLCDELRHVADTCGDAQAYSDEAAGDG |
| Ga0318557_104436931 | 3300031795 | Soil | MRSDTARQRAEIEDQIAGRTLCDELRDVAEASGDADAYSDEALTD |
| Ga0318497_100862751 | 3300031805 | Soil | VSSDIIQQRAEIESVIAGRILCDELQHVAETSGDAYAYSDE |
| Ga0318497_106150991 | 3300031805 | Soil | VSSDMARQRAEIEGVIAGRTLCDELRYVAETAGDDYAYSDEVVTGADAGAGDGWQSL |
| Ga0306919_112192251 | 3300031879 | Soil | VSSDIVRQRAEIEGVIAGRILCDELRHVAETAGDSYAYSDD |
| Ga0318551_103456491 | 3300031896 | Soil | VSSDIVRLRAEIEGVIAGRTICDELRHAAETWGDAYA |
| Ga0318551_108416422 | 3300031896 | Soil | VSSDIVRQRAEIEGVIAGRILCDELRHVAETAGDSYAY |
| Ga0318551_108555711 | 3300031896 | Soil | MVNSDTMRQRAKAEDMIAGRTLCDELRDVAETAGDASAYSDQAEAGAGTGDGWQ |
| Ga0306923_114718232 | 3300031910 | Soil | MAAPDGEGEGTVSSDIVRQRAEIEGVTAGRTLCDELRHVAETCGDAGAYSEEAGGG |
| Ga0318518_104585221 | 3300032090 | Soil | VSSDIVRQRAEIEGVIAGRILCDELRHVAETAGDSYAYSDDAGDGWQS |
| Ga0318518_105809581 | 3300032090 | Soil | VSSDIIQQRAEIESVIAGRILCDELQHVAETSGDAYAYSDEAVTGADAATGDGWQSLTWSQT |
| Ga0311301_108066201 | 3300032160 | Peatlands Soil | MVNSDVMRQRAEIEGMLAGRTLCDELRDVAETAGDAYAFSDEAGTEAGTEAGTEAGAGTG |
| Ga0307470_100280361 | 3300032174 | Hardwood Forest Soil | VSSEMTRLRAEIEGVIAGRTLCDELRHVAETSGDADAYSDEAGTGEGWRSLT |
| Ga0307471_1027947301 | 3300032180 | Hardwood Forest Soil | VSSDIVRRRAEIEGVMAGRTLCDELRHVAETSGDAWAY |
| Ga0335080_117260521 | 3300032828 | Soil | VSSEITRQRAEIEGATAGRTLCDELRHVAETCGDAQAYSDE |
| Ga0335080_117484221 | 3300032828 | Soil | VSSDVVRQRAEIERVIAGRTLCDELRQVAETCGDADAYSDE |
| Ga0335081_102863581 | 3300032892 | Soil | MSSDIARQRAEIEDATAGRTLCDELRHVAETCGDAWAYSDEAS |
| Ga0335072_106377861 | 3300032898 | Soil | MSDDIARQRAELEGTIAGRTLCDELRQVAETAGGAGAYSDAAAVGGGDGWQ |
| Ga0335083_102154571 | 3300032954 | Soil | VSSDIVQRRAEIEGVIAGRTLCDELRHVAETSGDAWAYSDEAVTGAGAGGGDGWQSLTGSQAR |
| Ga0335073_115759581 | 3300033134 | Soil | VSGDIARQRAELEGTIAGRTLCDELRQVAETAGGAGAYSDAAAVGGGDGWQTL |
| Ga0310914_114952481 | 3300033289 | Soil | VEGTVSSDIVRLRAEIEGVIAGRTLCDELRHVAETSGDAYAYSDEAANGADAGAGDGWRS |
| ⦗Top⦘ |