NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097701

Metagenome / Metatranscriptome Family F097701

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097701
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 46 residues
Representative Sequence VSSDMTRQRAEIEGAIAGRTLCDELRHVAETSGDADAYSDEA
Number of Associated Samples 90
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.15 %
% of genes near scaffold ends (potentially truncated) 99.04 %
% of genes from short scaffolds (< 2000 bps) 88.46 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (75.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(27.885 % of family members)
Environment Ontology (ENVO) Unclassified
(25.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.192 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.57%    β-sheet: 0.00%    Coil/Unstructured: 61.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF00441Acyl-CoA_dh_1 6.73
PF02622DUF179 4.81
PF01494FAD_binding_3 3.85
PF13452MaoC_dehydrat_N 2.88
PF00797Acetyltransf_2 2.88
PF01425Amidase 2.88
PF00106adh_short 1.92
PF07729FCD 1.92
PF00501AMP-binding 1.92
PF06742DUF1214 1.92
PF02979NHase_alpha 0.96
PF02770Acyl-CoA_dh_M 0.96
PF13657Couple_hipA 0.96
PF04672Methyltransf_19 0.96
PF08541ACP_syn_III_C 0.96
PF00082Peptidase_S8 0.96
PF16859TetR_C_11 0.96
PF12740Chlorophyllase2 0.96
PF01872RibD_C 0.96
PF14117DUF4287 0.96
PF08044DUF1707 0.96
PF06863DUF1254 0.96
PF02661Fic 0.96
PF13302Acetyltransf_3 0.96
PF07992Pyr_redox_2 0.96
PF02771Acyl-CoA_dh_N 0.96
PF13602ADH_zinc_N_2 0.96
PF00440TetR_N 0.96
PF00534Glycos_transf_1 0.96
PF10415FumaraseC_C 0.96
PF00196GerE 0.96
PF13561adh_short_C2 0.96
PF00912Transgly 0.96
PF03976PPK2 0.96
PF02211NHase_beta 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 8.65
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 7.69
COG1678Putative transcriptional regulator, AlgH/UPF0301 familyTranscription [K] 4.81
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 3.85
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 3.85
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 3.85
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 2.88
COG5361Uncharacterized conserved proteinMobilome: prophages, transposons [X] 2.88
COG2162Arylamine N-acetyltransferaseSecondary metabolites biosynthesis, transport and catabolism [Q] 2.88
COG5402Uncharacterized protein, contains DUF1214 domainFunction unknown [S] 1.92
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 1.92
COG1802DNA-binding transcriptional regulator, GntR familyTranscription [K] 1.92
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.96
COG2326Polyphosphate kinase 2, PPK2 familyEnergy production and conversion [C] 0.96
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 0.96
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 0.96
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 0.96
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.96 %
UnclassifiedrootN/A24.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_2_1_1_newblercontig133688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales639Open in IMG/M
3300004152|Ga0062386_100060901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2856Open in IMG/M
3300005366|Ga0070659_101664332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea coxensis570Open in IMG/M
3300005435|Ga0070714_101736393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales609Open in IMG/M
3300005435|Ga0070714_101807768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia597Open in IMG/M
3300005439|Ga0070711_100614398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia908Open in IMG/M
3300005537|Ga0070730_10436606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia844Open in IMG/M
3300006052|Ga0075029_101293105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium roseum512Open in IMG/M
3300006176|Ga0070765_101128472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia741Open in IMG/M
3300006575|Ga0074053_11514843Not Available677Open in IMG/M
3300006579|Ga0074054_11964461Not Available727Open in IMG/M
3300006606|Ga0074062_10147410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia587Open in IMG/M
3300006804|Ga0079221_10253873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1001Open in IMG/M
3300006854|Ga0075425_101237777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia847Open in IMG/M
3300006903|Ga0075426_11275183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia557Open in IMG/M
3300009162|Ga0075423_10317959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1632Open in IMG/M
3300009683|Ga0116224_10568708Not Available541Open in IMG/M
3300010048|Ga0126373_11482037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae744Open in IMG/M
3300010154|Ga0127503_10672761Not Available929Open in IMG/M
3300010361|Ga0126378_12133570Not Available639Open in IMG/M
3300010373|Ga0134128_11177185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii846Open in IMG/M
3300010376|Ga0126381_103027572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia667Open in IMG/M
3300010396|Ga0134126_11760386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia680Open in IMG/M
3300010396|Ga0134126_12077923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii620Open in IMG/M
3300010397|Ga0134124_11459088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii711Open in IMG/M
3300010861|Ga0126349_1294808All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300012210|Ga0137378_10543984All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300013105|Ga0157369_11639367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii654Open in IMG/M
3300013307|Ga0157372_11103072Not Available918Open in IMG/M
3300014657|Ga0181522_10338752Not Available895Open in IMG/M
3300016422|Ga0182039_10906909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium aridum787Open in IMG/M
3300016422|Ga0182039_12140117Not Available516Open in IMG/M
3300017924|Ga0187820_1009131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2362Open in IMG/M
3300017924|Ga0187820_1096854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora845Open in IMG/M
3300017942|Ga0187808_10050756Not Available1755Open in IMG/M
3300017947|Ga0187785_10155584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia964Open in IMG/M
3300017973|Ga0187780_10114308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1863Open in IMG/M
3300017975|Ga0187782_10404426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1038Open in IMG/M
3300018060|Ga0187765_11075070All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300018085|Ga0187772_10035301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2997Open in IMG/M
3300018085|Ga0187772_10050308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. WAC070612557Open in IMG/M
3300020581|Ga0210399_10238097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1516Open in IMG/M
3300021404|Ga0210389_10295284All Organisms → cellular organisms → Bacteria1270Open in IMG/M
3300021404|Ga0210389_11283121Not Available561Open in IMG/M
3300021407|Ga0210383_10069552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2939Open in IMG/M
3300021407|Ga0210383_10943407All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300021432|Ga0210384_11731205Not Available530Open in IMG/M
3300021560|Ga0126371_11745509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria745Open in IMG/M
3300022467|Ga0224712_10341712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii706Open in IMG/M
3300024249|Ga0247676_1054107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii656Open in IMG/M
3300025906|Ga0207699_11463818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300025915|Ga0207693_10940249Not Available662Open in IMG/M
3300025981|Ga0207640_10582202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii945Open in IMG/M
3300026959|Ga0207852_1025360All Organisms → cellular organisms → Bacteria → Terrabacteria group610Open in IMG/M
3300027043|Ga0207800_1043387All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300027168|Ga0208239_1006027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1032Open in IMG/M
3300027516|Ga0207761_1102625Not Available557Open in IMG/M
3300027986|Ga0209168_10654641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria500Open in IMG/M
3300028556|Ga0265337_1000860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria15962Open in IMG/M
3300028780|Ga0302225_10156996Not Available1102Open in IMG/M
3300028793|Ga0307299_10075301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1254Open in IMG/M
3300028877|Ga0302235_10001979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria15005Open in IMG/M
3300029910|Ga0311369_10638529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium shigaense883Open in IMG/M
3300029944|Ga0311352_10181154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1806Open in IMG/M
3300030013|Ga0302178_10536681All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon506Open in IMG/M
3300030053|Ga0302177_10015844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4895Open in IMG/M
3300030056|Ga0302181_10039259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia spinosispora2562Open in IMG/M
3300030057|Ga0302176_10133180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria981Open in IMG/M
3300030503|Ga0311370_10013000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria13065Open in IMG/M
3300031233|Ga0302307_10250833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria908Open in IMG/M
3300031544|Ga0318534_10654802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria595Open in IMG/M
3300031546|Ga0318538_10548024Not Available627Open in IMG/M
3300031549|Ga0318571_10465776Not Available504Open in IMG/M
3300031640|Ga0318555_10512144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium650Open in IMG/M
3300031679|Ga0318561_10278423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria914Open in IMG/M
3300031679|Ga0318561_10450954All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300031681|Ga0318572_10421824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria793Open in IMG/M
3300031708|Ga0310686_107892081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes920Open in IMG/M
3300031713|Ga0318496_10338037All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300031713|Ga0318496_10384054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria776Open in IMG/M
3300031751|Ga0318494_10315327All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300031769|Ga0318526_10468536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales514Open in IMG/M
3300031770|Ga0318521_10117645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1482Open in IMG/M
3300031771|Ga0318546_11327659Not Available505Open in IMG/M
3300031795|Ga0318557_10443693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium aridum597Open in IMG/M
3300031805|Ga0318497_10086275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia alba1670Open in IMG/M
3300031805|Ga0318497_10615099Not Available609Open in IMG/M
3300031879|Ga0306919_11219225Not Available571Open in IMG/M
3300031896|Ga0318551_10345649Not Available841Open in IMG/M
3300031896|Ga0318551_10841642Not Available534Open in IMG/M
3300031896|Ga0318551_10855571Not Available530Open in IMG/M
3300031910|Ga0306923_11471823Not Available714Open in IMG/M
3300032090|Ga0318518_10458522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales653Open in IMG/M
3300032090|Ga0318518_10580958All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300032160|Ga0311301_10806620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1288Open in IMG/M
3300032174|Ga0307470_10028036All Organisms → cellular organisms → Bacteria2642Open in IMG/M
3300032180|Ga0307471_102794730Not Available620Open in IMG/M
3300032828|Ga0335080_11726052All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300032828|Ga0335080_11748422Not Available608Open in IMG/M
3300032892|Ga0335081_10286358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. SDr-062194Open in IMG/M
3300032898|Ga0335072_10637786All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300032954|Ga0335083_10215457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1744Open in IMG/M
3300033134|Ga0335073_11575958All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300033289|Ga0310914_11495248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria579Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil27.88%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa9.62%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.77%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.77%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.85%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.92%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.92%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.92%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.96%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.96%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.96%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.96%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.96%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.96%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010861Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024249Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026959Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027043Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027168Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes)EnvironmentalOpen in IMG/M
3300027516Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028556Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaGHost-AssociatedOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OU_000840002124908016VEETVSRDMTRQRSEIEGAIAGRTLCDELRQAAETSGDAWAYSDEAGTGAAGSP
Ga0062386_10006090113300004152Bog Forest SoilMVNSDIVRQRAEIEGMLAGRTLCDELRDVAETAGDAYAFSDEA
Ga0070659_10166433213300005366Corn RhizosphereVSSDIVQRRAEIEDVIAGRTLCDELRHVAETSGDAWAYSDEAVTGTDAEAGDGWQS
Ga0070714_10173639323300005435Agricultural SoilVSSDIMRRRAEIEAVIAGRTLCDELRDVAEASGAAGAYSDEDEAGWR
Ga0070714_10180776823300005435Agricultural SoilVSSDMTRQRAEIEGAIAGRTLCDELRHVAETSGDADAYSDEA
Ga0070711_10061439823300005439Corn, Switchgrass And Miscanthus RhizosphereMVSSDVTRQRREIEDAIAGRTLCDELREVAESAGDAGAYSDGAESAAGDGWH
Ga0070730_1043660623300005537Surface SoilMVSGDIMRQRAEIESAIAGRTLCDELRQVAETAGD
Ga0075029_10129310513300006052WatershedsVSSEIVQQRAAIEGVIAGRTLCDELRQVAETSGDAWAY
Ga0070765_10112847223300006176SoilMVSSEIMRQRAEIESAIAGRTLCDELRQVAETAGDA
Ga0074053_1151484313300006575SoilVSSDMTRQRTEIEGVIAGRTLCDELRQVAEISGDAW
Ga0074054_1196446113300006579SoilMSSDIVRRRAEIEGVIAGRTLCDELRHVAETSGDAW
Ga0074062_1014741023300006606SoilVSSDMTRQRAEIEGVIAGRTVCDELRRVAEVSGDAWAYSDEAGA
Ga0079221_1025387333300006804Agricultural SoilMASVRLRKVEETVSSEMNRQRTEIEGAIAGRTLCDELRHVAETSGDAGAYSDE
Ga0075425_10123777723300006854Populus RhizosphereMSSDIVRQRAEIEGVIAGRTLCDELRQVAETAGDADAYSDEA
Ga0075426_1127518313300006903Populus RhizosphereMTRQRAEIEGAIAGRTLCDELRQAAETSGDAWAYSDEAGA
Ga0075423_1031795933300009162Populus RhizosphereVEETVSSDMTWQRTEIEGEIAGRTLCDELRQAAKASGDAWAYSDEA
Ga0116224_1056870813300009683Peatlands SoilMVRRRAEIEGVIAGRTLCDELRDVAATAGDASAYSDE
Ga0126373_1148203733300010048Tropical Forest SoilMVGSGIVRQRAEIEGVIAGRTLCDELRHVAETRGDADAYSD
Ga0127503_1067276113300010154SoilVSSDIVRRRAEIEGVIAGRTLCDELRRVAETSGDAWAYSDEAVTGAGDGW*
Ga0126378_1213357013300010361Tropical Forest SoilMVSSDIARQRAEIEDKIAGRTLCDELREVAETAGDAGAYADEAGTGAG
Ga0134128_1117718513300010373Terrestrial SoilVEETVSSDMTRQRTEIEGAIAGRTLCDELRQAAETSGD
Ga0126381_10302757223300010376Tropical Forest SoilVSSDVIRQRAEIEDVIAGRTLCDELRHVAETSGEAYAYSDEAVNGADA
Ga0134126_1176038623300010396Terrestrial SoilMMSSDIVRQRAEIEGVIAGRTLCDELRQVAETAGDAGAYSDEAG
Ga0134126_1207792313300010396Terrestrial SoilVEETVSSDMTRQRTEIEGAIAGRTLCDELRQAAETSG
Ga0134124_1145908823300010397Terrestrial SoilVSSDMTRQRTEIEGAIAGRTLCDELRQAAETSGDAWAYSDEAG
Ga0126349_129480813300010861Boreal Forest SoilVSSDIARQRAEIESVIAGRTLCDELRHVAESCGDARAYSDEAGAGGG
Ga0137378_1054398413300012210Vadose Zone SoilMTRQRTEIEGAIAGRTLCDELRQAAETSGDALAYSDETGTGADAGGGDGWRSLTWSQA
Ga0157369_1163936723300013105Corn RhizosphereVEETVSSDMTRQRTEIEGAIAGRTLCDELRQAAET
Ga0157372_1110307213300013307Corn RhizosphereVEETVSSDIVQRRAEIEDVIAGRTLCDELRHVAETSG
Ga0181522_1033875213300014657BogVEETVSSDVVRRRAEIEGVIAGRTLCDELRDVAATAGDASAYSDEAGTGAVAGAGWR
Ga0182039_1090690913300016422SoilMRSDTARQRAEIEDQIAGRTLCDELRDVAEASGDADAYSD
Ga0182039_1214011713300016422SoilVEGTVSSDIVRLRAEIEGVIAGRTICDELRHAAETWGDAYAYSDEVVTGADAG
Ga0187820_100913153300017924Freshwater SedimentMVNSDIARQRAEIEGLLTGRTLCDELRDVAETAGDAYAYSDEAGTEAGAGAG
Ga0187820_109685423300017924Freshwater SedimentVSGDLTRQRAEIEDVIAGRTLCDELRHVAETAGDGYAYSDEVVTGADA
Ga0187808_1005075613300017942Freshwater SedimentVSSDIVRQRAEIEDVIAGRTLCDELRHVAETAGDSYAYSDAAVTGADAGSSDAWLSLTWSQARQR
Ga0187785_1015558413300017947Tropical PeatlandMVGSGIVRQRAEIEGVIAGRTLCDELRHVAETRGDADAYSDEAGTGDGWRS
Ga0187780_1011430813300017973Tropical PeatlandVSSDIVRQRAEIEGVIAGRTLCDELRDVAETSGDADAYSDEAVTGAEAGDGAGD
Ga0187782_1040442623300017975Tropical PeatlandVSSDIARQRAEIEGVTAGLTLCDELRQVAETTGDGYAYSDEDVTGADAG
Ga0187765_1107507023300018060Tropical PeatlandVSGDIVRQRAEIEAVIAGRTLCDELRHIAETSGDAYAYSDEAVTGSGDGWQS
Ga0187772_1003530113300018085Tropical PeatlandVSRDIVRQRAEIEAVIAGRSLCDELRQVAETAGDSYAYSDEAVTGADAGAGDGW
Ga0187772_1005030813300018085Tropical PeatlandVSSDIARQRAEIEGVIAGRTLCDELRHVAETTADGYAYSDEVVTGADAT
Ga0210399_1023809733300020581SoilVSSDIVRQRAEIEAVIAGRTLCDELRHVAEASGAAGAYSDEDEA
Ga0210389_1029528413300021404SoilVNSDIVRQRTEIEGVTAGRTLCDELRHVAETCGDVPAYSD
Ga0210389_1128312113300021404SoilVSSDIVQRRAEIEGVIAGRTLCDELRHVAETSGDAWA
Ga0210383_1006955213300021407SoilVSSDIVRQRAEIEAVIAGRTLCDELRHVAEASGAAGAYSDE
Ga0210383_1094340723300021407SoilVGSDIARQRAEIEDEIAGRTLCDELRQLAGSAGDAGAY
Ga0210384_1173120513300021432SoilVSSEIVRRRAEIEGVIAGRTLCDELRHVAETSGDAWAYSNQAGAGDGWQ
Ga0126371_1174550923300021560Tropical Forest SoilVSSDVVRQRAEIEGAIAGRTLCDELRDVAETSGDA
Ga0224712_1034171213300022467Corn, Switchgrass And Miscanthus RhizosphereVSSDMTRQRTEIEGAIAGRTLCDELRQAAETSGDAWAYSDEAGAGGGW
Ga0247676_105410723300024249SoilVSSDMTRQRTEIEGAIAGRTLCDELRQAAETSGDA
Ga0207699_1146381823300025906Corn, Switchgrass And Miscanthus RhizosphereVSSEMTRLRAEIEGVIAGRTLCDELRHVAETSGDADAYSDEAGTGEGWRS
Ga0207693_1094024913300025915Corn, Switchgrass And Miscanthus RhizosphereVSSDIVQRRAEIEDVIAGRTLCDELRHVAETSGDAWAYSDEAVTGGTDAEPGDDGWQSLT
Ga0207640_1058220223300025981Corn RhizosphereVSSDMTRQRTEIEGAIAGRTLCDKLRQAAETSGDAW
Ga0207852_102536023300026959Tropical Forest SoilVSSDIVRQRAEIEDVIAGRTLCDELRHVAETAGDSYAYSDAAVTGA
Ga0207800_104338713300027043Tropical Forest SoilVSSDVFRQRAEIEDVIAGRTLCDELRHVAETAGDSYAYSDAAVTGADAGSSDAWPSL
Ga0208239_100602713300027168Forest SoilVSSDIVQRRAEIEGVIAGRTLCDELRHVAETSGDAWAYSDE
Ga0207761_110262523300027516Tropical Forest SoilVSSDIVRQRAEIEGLIAGRTLCDALRDVAETSGDAIAYSD
Ga0209168_1065464123300027986Surface SoilVSSDTARQRAEIEAVIAGQTLCDELRHVAETSGAAGAYSDE
Ga0265337_100086013300028556RhizosphereVSSDIARQRAEIEYEIAGRTLCDELRQLAETAGDAGAYS
Ga0302225_1015699623300028780PalsaMVSRDIVRQRAEIEGLIAGRTLCDELRHAAETAGDAGAYSDM
Ga0307299_1007530133300028793SoilVSSDMTRQRTEIEGAIAGRTLCDELRQVAETSGDAWAYSDE
Ga0302235_1000197913300028877PalsaMVSRDIVRQRAEIEGVIAGRTLCDELRHAAETSGDAGAYSDMA
Ga0311369_1063852913300029910PalsaMVSRDIVRQRAEIEGLIAGRTLCDELRHAAETAGDAGAYSD
Ga0311352_1018115453300029944PalsaVGRDIVRQRAEIEGVIAGRTLCDELRHAAETAGDAGAYSDMAGAGDDWRSLTW
Ga0302178_1053668123300030013PalsaVSSDVVRQRAEIESVTAGRTLCDELRHVAEACGDARAYSDEA
Ga0302177_1001584443300030053PalsaMVSRDIVRQRAEIEGLIAGRTLCDELRHAAETAGDAGAYSDMAGAGDDWRSLTWE
Ga0302181_1003925933300030056PalsaMVSRDIVRQRAEIEGVIAGRTLCDELRHAAETSGDAGAY
Ga0302176_1013318033300030057PalsaVGRDIVRQRAEIEGVIAGRTLCDELRHAAETAGDAG
Ga0311370_1001300013300030503PalsaVGRDIVRQRAEIEGVIAGRTLCDELRHAAETAGDAGAYSDMAGAGDDWR
Ga0302307_1025083313300031233PalsaMVSRDIVRQRAEIEGLIAGRTLCDELRHAAETAGDAGAYSDMAGAGD
Ga0318534_1065480223300031544SoilVSSDIAGRRAEIEAVIAGWTLCDELRHVAETSGAA
Ga0318538_1054802413300031546SoilMRSDIARQRAEIEDQIAGRTLCDELRDVAEASGAD
Ga0318571_1046577623300031549SoilVNGDVIRQRAEIEGVIAGRTLCDELRHVAETAGDDYAYSDAAVTG
Ga0318555_1051214413300031640SoilVSSDIVRLRAEIEGAIAGRTICDELRHAAETWGDAY
Ga0318561_1027842323300031679SoilVSSDIVRQRAEIEGVIAGRILCDELRHVAETAGDSYAYSDEAGDGWQSLTWS
Ga0318561_1045095413300031679SoilVSSDTFQQRFEIEALIAGRTLCDELRDVAETSGDAYAYSDEAVTGDDWQSLT
Ga0318572_1042182413300031681SoilVEGTVSSDIVRLRAEIEGVIAGRTICDELRHAAETWGDAYAYSDEVVTGADAGAGAG
Ga0310686_10789208113300031708SoilMVNSDVMRQRAEIEGMLAGRTLCDELRDVAETAGDAYAFS
Ga0318496_1033803723300031713SoilVSSDIVQRRAEIEDAIAGRTLCDELRHVAETSGDAWAYSEEAVTGADAVAGDGWQTLT
Ga0318496_1038405413300031713SoilVSSDIVRQRAEIEGVIAGRILCDELRHVAETAGDSYAYSDEAGDGWQSLT
Ga0318494_1031532723300031751SoilVSSDIIQQRAEIESVIAGRILCDELQHVAETSGDAYAYSDEAVTGADAA
Ga0318526_1046853613300031769SoilVSSDIVRQRAEIEGVIAGRILCDELRHVAETAGDSYAYSDEAGDGWQSLTWSQAR
Ga0318521_1011764533300031770SoilVSSDIAGRRAEIEAVIAGRTLCDELRHVAETSGAAGAYSDEDEAGWR
Ga0318546_1132765913300031771SoilMRQRAEIEGATAGRTLCDELRHVADTCGDAQAYSDEAAGDG
Ga0318557_1044369313300031795SoilMRSDTARQRAEIEDQIAGRTLCDELRDVAEASGDADAYSDEALTD
Ga0318497_1008627513300031805SoilVSSDIIQQRAEIESVIAGRILCDELQHVAETSGDAYAYSDE
Ga0318497_1061509913300031805SoilVSSDMARQRAEIEGVIAGRTLCDELRYVAETAGDDYAYSDEVVTGADAGAGDGWQSL
Ga0306919_1121922513300031879SoilVSSDIVRQRAEIEGVIAGRILCDELRHVAETAGDSYAYSDD
Ga0318551_1034564913300031896SoilVSSDIVRLRAEIEGVIAGRTICDELRHAAETWGDAYA
Ga0318551_1084164223300031896SoilVSSDIVRQRAEIEGVIAGRILCDELRHVAETAGDSYAY
Ga0318551_1085557113300031896SoilMVNSDTMRQRAKAEDMIAGRTLCDELRDVAETAGDASAYSDQAEAGAGTGDGWQ
Ga0306923_1147182323300031910SoilMAAPDGEGEGTVSSDIVRQRAEIEGVTAGRTLCDELRHVAETCGDAGAYSEEAGGG
Ga0318518_1045852213300032090SoilVSSDIVRQRAEIEGVIAGRILCDELRHVAETAGDSYAYSDDAGDGWQS
Ga0318518_1058095813300032090SoilVSSDIIQQRAEIESVIAGRILCDELQHVAETSGDAYAYSDEAVTGADAATGDGWQSLTWSQT
Ga0311301_1080662013300032160Peatlands SoilMVNSDVMRQRAEIEGMLAGRTLCDELRDVAETAGDAYAFSDEAGTEAGTEAGTEAGAGTG
Ga0307470_1002803613300032174Hardwood Forest SoilVSSEMTRLRAEIEGVIAGRTLCDELRHVAETSGDADAYSDEAGTGEGWRSLT
Ga0307471_10279473013300032180Hardwood Forest SoilVSSDIVRRRAEIEGVMAGRTLCDELRHVAETSGDAWAY
Ga0335080_1172605213300032828SoilVSSEITRQRAEIEGATAGRTLCDELRHVAETCGDAQAYSDE
Ga0335080_1174842213300032828SoilVSSDVVRQRAEIERVIAGRTLCDELRQVAETCGDADAYSDE
Ga0335081_1028635813300032892SoilMSSDIARQRAEIEDATAGRTLCDELRHVAETCGDAWAYSDEAS
Ga0335072_1063778613300032898SoilMSDDIARQRAELEGTIAGRTLCDELRQVAETAGGAGAYSDAAAVGGGDGWQ
Ga0335083_1021545713300032954SoilVSSDIVQRRAEIEGVIAGRTLCDELRHVAETSGDAWAYSDEAVTGAGAGGGDGWQSLTGSQAR
Ga0335073_1157595813300033134SoilVSGDIARQRAELEGTIAGRTLCDELRQVAETAGGAGAYSDAAAVGGGDGWQTL
Ga0310914_1149524813300033289SoilVEGTVSSDIVRLRAEIEGVIAGRTLCDELRHVAETSGDAYAYSDEAANGADAGAGDGWRS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.