NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F097605

Metagenome Family F097605

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097605
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 144 residues
Representative Sequence VRVVRAVFPRLNDWLNRLPDPRVQERCLYAAAHLWWQIIATFLSRKGSRNGFDEQRQSGEAAWNLGALCGQTPEDPRFAGQPTVTCSDNAARHASRVDPELVAQIPQLMFRDLLERRLFDGVRLFDRWYVLL
Number of Associated Samples 87
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 19.23 %
% of genes near scaffold ends (potentially truncated) 96.15 %
% of genes from short scaffolds (< 2000 bps) 94.23 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.64

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(20.192 % of family members)
Environment Ontology (ENVO) Unclassified
(38.462 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(46.154 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.62%    β-sheet: 3.75%    Coil/Unstructured: 45.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.64
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF14236DUF4338 2.88
PF11459AbiEi_3 0.96
PF03534SpvB 0.96
PF00873ACR_tran 0.96
PF13546DDE_5 0.96
PF04397LytTR 0.96
PF01408GFO_IDH_MocA 0.96



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001213|JGIcombinedJ13530_105085647All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium658Open in IMG/M
3300001213|JGIcombinedJ13530_105769043All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300004092|Ga0062389_104594500All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300005830|Ga0074473_10239381All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300006224|Ga0079037_101588644All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300009075|Ga0105090_10049903All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2615Open in IMG/M
3300009131|Ga0115027_10398748All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium961Open in IMG/M
3300009167|Ga0113563_12838161All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300009168|Ga0105104_10358809All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium806Open in IMG/M
3300009170|Ga0105096_10749805All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300009548|Ga0116107_1063315All Organisms → cellular organisms → Bacteria1207Open in IMG/M
3300009548|Ga0116107_1170411All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300009615|Ga0116103_1121676All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300009617|Ga0116123_1088408All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium834Open in IMG/M
3300009621|Ga0116116_1145039All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300010379|Ga0136449_101380658All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1090Open in IMG/M
3300010413|Ga0136851_10615500All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1075Open in IMG/M
3300012931|Ga0153915_12194434All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium646Open in IMG/M
3300014155|Ga0181524_10198502All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium985Open in IMG/M
3300014155|Ga0181524_10247365All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium840Open in IMG/M
3300014158|Ga0181521_10343576All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium751Open in IMG/M
3300014160|Ga0181517_10300185All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium844Open in IMG/M
3300014162|Ga0181538_10203771All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1109Open in IMG/M
3300014164|Ga0181532_10121962All Organisms → cellular organisms → Bacteria1597Open in IMG/M
3300014498|Ga0182019_11062585All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300014502|Ga0182021_11889774All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium719Open in IMG/M
3300014655|Ga0181516_10622554All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300014658|Ga0181519_11027950All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300017940|Ga0187853_10199177All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium938Open in IMG/M
3300017941|Ga0187850_10256415All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium785Open in IMG/M
3300017948|Ga0187847_10065420All Organisms → cellular organisms → Bacteria2040Open in IMG/M
3300017966|Ga0187776_10625294All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium753Open in IMG/M
3300017993|Ga0187823_10217073All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300018009|Ga0187884_10089103All Organisms → cellular organisms → Bacteria1361Open in IMG/M
3300018013|Ga0187873_1029466All Organisms → cellular organisms → Bacteria2622Open in IMG/M
3300018023|Ga0187889_10144929All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1131Open in IMG/M
3300018024|Ga0187881_10288465All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium682Open in IMG/M
3300018025|Ga0187885_10394258All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300018038|Ga0187855_10315823All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium913Open in IMG/M
3300018046|Ga0187851_10115756All Organisms → cellular organisms → Bacteria1652Open in IMG/M
3300022875|Ga0224553_1025169All Organisms → cellular organisms → Bacteria1461Open in IMG/M
3300025312|Ga0209321_10374970All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium674Open in IMG/M
3300025412|Ga0208194_1029379All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium870Open in IMG/M
3300025484|Ga0208587_1058949All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium881Open in IMG/M
3300025495|Ga0207932_1007138All Organisms → cellular organisms → Bacteria → Acidobacteria3525Open in IMG/M
3300025495|Ga0207932_1009891All Organisms → cellular organisms → Bacteria → Acidobacteria2898Open in IMG/M
3300025581|Ga0208355_1008900All Organisms → cellular organisms → Bacteria → Acidobacteria3461Open in IMG/M
3300025581|Ga0208355_1023380All Organisms → cellular organisms → Bacteria → Acidobacteria1789Open in IMG/M
3300025888|Ga0209540_10330263All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium856Open in IMG/M
3300027877|Ga0209293_10279043All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium843Open in IMG/M
3300028176|Ga0268284_1047402All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1176Open in IMG/M
3300028176|Ga0268284_1051410All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1117Open in IMG/M
3300028178|Ga0265593_1138439All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300028556|Ga0265337_1048704All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1199Open in IMG/M
3300029984|Ga0311332_10815945All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium744Open in IMG/M
3300030339|Ga0311360_10856774All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium720Open in IMG/M
3300031232|Ga0302323_102943079All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300031238|Ga0265332_10461032All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300031239|Ga0265328_10270426All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300031711|Ga0265314_10481780All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300031726|Ga0302321_100995024All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium954Open in IMG/M
3300031726|Ga0302321_101718626All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium726Open in IMG/M
3300031873|Ga0315297_10215806All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1583Open in IMG/M
3300032053|Ga0315284_10752213All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1136Open in IMG/M
3300032053|Ga0315284_11366201All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium763Open in IMG/M
3300032117|Ga0316218_1208416All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium697Open in IMG/M
3300032118|Ga0315277_10778011All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium908Open in IMG/M
3300032143|Ga0315292_10455093All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1077Open in IMG/M
3300032156|Ga0315295_11211475All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium740Open in IMG/M
3300032160|Ga0311301_12447506All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300032164|Ga0315283_10611529All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1179Open in IMG/M
3300032177|Ga0315276_11555353All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium687Open in IMG/M
3300032256|Ga0315271_10812825All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium805Open in IMG/M
3300032256|Ga0315271_11850065All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300032342|Ga0315286_11540529All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300032397|Ga0315287_10788975All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1117Open in IMG/M
3300032516|Ga0315273_10909031All Organisms → cellular organisms → Bacteria1135Open in IMG/M
3300032516|Ga0315273_11418125All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium859Open in IMG/M
3300032605|Ga0316232_1307326All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium591Open in IMG/M
3300032770|Ga0335085_11274978All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium777Open in IMG/M
3300032805|Ga0335078_10726178All Organisms → cellular organisms → Bacteria1226Open in IMG/M
3300032805|Ga0335078_11023267All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium975Open in IMG/M
3300032805|Ga0335078_11515554All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium748Open in IMG/M
3300032829|Ga0335070_11988015All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300032893|Ga0335069_12106030All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300032897|Ga0335071_10967879All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium798Open in IMG/M
3300033004|Ga0335084_11071415All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium810Open in IMG/M
3300033414|Ga0316619_10691618All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium859Open in IMG/M
3300033414|Ga0316619_11491335All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300033416|Ga0316622_102961021All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300033418|Ga0316625_102136882All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300033419|Ga0316601_101353872All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300033480|Ga0316620_11574742All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300033482|Ga0316627_101488136All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium684Open in IMG/M
3300033482|Ga0316627_102814712All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300033483|Ga0316629_10122700All Organisms → cellular organisms → Bacteria1519Open in IMG/M
3300033483|Ga0316629_11350845All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300033485|Ga0316626_10577036All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium967Open in IMG/M
3300033485|Ga0316626_10630467All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300033557|Ga0316617_101330208All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium718Open in IMG/M
3300034070|Ga0334822_081202All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium687Open in IMG/M
3300034091|Ga0326724_0346260All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium807Open in IMG/M
3300034091|Ga0326724_0646110All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300034282|Ga0370492_0448918All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil20.19%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment13.46%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland9.62%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog7.69%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.77%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil5.77%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere3.85%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.88%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water2.88%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland1.92%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater1.92%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.92%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland1.92%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.92%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.92%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.92%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.92%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.96%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.96%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.96%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.96%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.96%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005830Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBMEnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009170Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009615Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010413Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300022875Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 10-14EnvironmentalOpen in IMG/M
3300025312Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4EnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025484Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025495Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025581Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300027877Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300028176Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_40mEnvironmentalOpen in IMG/M
3300028178Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36mEnvironmentalOpen in IMG/M
3300028556Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaGHost-AssociatedOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031238Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaGHost-AssociatedOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032117Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032605Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300034070Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-MEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ13530_10508564723300001213WetlandVRSVRAAFPQLNQWLNNLPDPRMQAMCLYSGAHLWWEIIAMFVSRSKSRNGFDQHRQSGEAAWNMGALCGQSPEDPRFGGTPTVTCSDNAAHHAKRVSSQCVAEVPIWMFREILKRRLLDHVRLLDRWYVVVLDGSVKEKCRQGFAQ
JGIcombinedJ13530_10576904323300001213WetlandVLRAVFPKLNCWLNALPDPRVQEMCLYTAAHLWWHIIATYLSRKGSRNGFDEQRQSGQAAWNMGLLCGQSAEDLRFDGAPTVTCSDNAAYHASRVDP
Ga0062389_10459450013300004092Bog Forest SoilLNALPDPRVQEMCLYSAAHLWWQIIATFLSRKGSRNGFDEQRQAGQGAWNLGVLCGQTAEDPRFDGQPTVTCSDNAAYHASRVDPETVAQIPVLMFRDLLERRTFDHARLFDGWYVMIVDGSVKEKCRAGFTEGGKSCTNGARYRYILQLSVVGPQGTLFPLLHEEMDMHNP
Ga0074473_1023938113300005830Sediment (Intertidal)FPRFNTWLNGLPDPRVQEMCLYAAAHLWWQIIATCLSRQGSRNGFDQQRQSGAAAWNMGALCGQTPEDPRFEGQPTVTCSDNAARHASRVDPELVAQIPLLMFRDLLERRLFDGVRLLDRWYVLLVDGSVKEKCRQGFQAGGKSSTHGVRYRYVLQLSVIGPEGTLFPLMHEEMD
Ga0079037_10158864423300006224Freshwater WetlandsMVLRAAFPKLNAWLNGLPDPRAQEMCLYTAAHLWWQIIATYLSRKGSRNGFDEQRQSGQAAWNMGLLCGQTAEDLRFDGEPTVTCSDNAAYHASRVDPEVVA
Ga0105090_1004990333300009075Freshwater SedimentMCRYTAAHLWWQILGTFLSRKGSRNGFDEQRQSGQAPWNMGALCGQSSEDPRFAGQPTVTCSDNAARHAGRVDPEAVAQIPVWMFHDLLERRCFEGARLFDRWYLMVVDGSVKEKCRQGFEAGGKASTNGARYR*
Ga0115027_1039874813300009131WetlandMCLYTAAHLWWHIIATYLSRKGSRNGFDEQRQSGQAAWNLGLLCGQSAEDPRFDGEPAVTCSDNAAYHASRVDPEAVAQIPVLMFRDLLERRLFDEARLFDRWYRIVLDGSVKEKCRQGF
Ga0113563_1283816123300009167Freshwater WetlandsMVLRAVFPKLNSWLNALPDPRMQEMCLYTAAHLWWHIIATYLSRKGSRNGFDEQRQSGQAAWNMGLLCGQTAEDLRFDGEPTVTCSDNAAYHASRVDPEVVAQIPVLMFRDLLDRRVFDGARLFDRWYRIVLDGSVKEKCRQRFEQGGKS
Ga0105104_1035880913300009168Freshwater SedimentVVVRAVFPKLNSWLNALPDPRVQEMCLYTAAHLWWHIIATYLSRKGSRNGFDEQRQSGQAAWNMGLLCGQTAEDLRFDGEPTVTCSDNAAYHASRVDPEVVAQI
Ga0105096_1074980513300009170Freshwater SedimentVRVVRAAFPRLNAWLNGLPDPRAQPMCVYSAAHLWWHILATFLSRKGSRHGFDEQRQAGAAAWNLGALCGQAPEDPRFAGQPRVTCSDNAARHASRVDPELVAQIPVLMFRDLLERRLFDGARLLDHWHLV
Ga0116107_106331513300009548PeatlandVRVVRAVFPSLNDWLNRPPDPRIQELCLYAAAHLWWQIIATCLSRQGSRNGFDQQRQSGEAAWNRGALCGQTSEDPRFDGQPTVACSDNAARHASRVDPELVAQIPLVMFRDLLERRLFEGVRLFARWYVLLVDGSVKEKCRQGFQEGGKSSAHGVRYRYVLQLSVIGPEGTLFPLMHEEMD
Ga0116107_117041113300009548PeatlandVRVVRTGFPRLNGRLNGLPDPRVQEMCLYAAAHLWWQVIGTFLSRKGSRNGYDEQRQSGPAAWNMRALCGRAPEDPRFDGPPTVAGSDNAALRASRVDPEWVAPIPVLMFPDLLERRTF
Ga0116103_112167613300009615PeatlandVRVVRTGFPRLNGRLNGLPDPRVQEMCLYAAAHLWWQVIGTFLSRKGSRNGFDEQRQSGQAAWNMGALCGQTPDEPRFEGEPSVTCSDNAARHASRVDPELVAQIPVLMFRDLLDRRLFDGVRL
Ga0116123_108840813300009617PeatlandVRVVRAVFPSLNDWLNRPPDPRIQELCLYAAAHLWWQIIATCLSRQGSRNGFDQQRQSGEAAWNRGALCGQTSEDPRFDGQPTVACSDNAARHASRVDPELVAQIPLVMFRDLLERRLFE
Ga0116116_114503923300009621PeatlandVRVVRTGFPRLNGRLNGLPDPRVQEMCLYAAAHLWWQVIGTFLSRKGSRNGFDEQRQSGQAAWNMGALCGQTPDDPRFEGEPSVTCSDNAARHASRVDPELVAQIPVLMFRDLLDRRLFDGVRLFDRWYVMVVDGSVKEKCR
Ga0136449_10138065823300010379Peatlands SoilVRVVRAVFPRLNDWLNRLPDPRIQERCLYAAAHLWWQIIATCLSRQGSRNGFDQQRQSGEAAWNMGALCGQTSEDPRFEGQPTVTCSDNAARHASRVDPERVAQIPGLMFRDLLERRRFDGVRLFGRWYVLVVDGSVKEKCRQGFHEGGKSCSGGARYR*
Ga0136851_1061550013300010413Mangrove SedimentMCLYTAAHLWWHIIATYLSRKGSRNGFDEQRQSGQAAWNMGLLCGQSAEDPRFDGEPTVTCSDNAAYHANRVEPEAVAQIPVLMFHDLLGRRLFDEARLFDRWYRIVLDGSVKEKCRQGFGQGGKSATNGARYRYVLQASVIGPAE
Ga0153915_1219443413300012931Freshwater WetlandsMCLYTAAHLWWQMVGTFLSRSGSRHAFDQQRQSGQAAWNLGELCGQTPEDPRFDGQPSVTCSDNAARHASRVDPEAVAQIPVLMFHDLLDRRTFDGVRLLERWYVLAVDGSVKEKCRQ
Ga0181524_1019850233300014155BogMVLRAVFPRLNAWLNALPDPRKREMCLYTAAHLWWHVIATFLSRKGSRNGFDEQRQSGQAAWNMGLLCGQSAEDPRFEGQPTVTCSDNAAYHASRVDPEEVAQIPVLMFHDLLERRTFDRARLFGRWYRIVLDGSVKEKCRAGFEEGGKSSTNGARYR
Ga0181524_1024736533300014155BogLVRVLRAAFPHLNDWLNGLPDPRVQEMCLYSAAHLWWQVLATYLCRKGSRHGLDQQRQSGQAPWNMGALCGQPPEDPRFGGQPAVTCSDNAAHHANRVDPEQVARLPVLLF
Ga0181521_1034357623300014158BogLTAEAFVRVVQAAFPKLNAWLNALPDPRRQEMCLYTAAHLWWEIIATFLSRKGSRNGFDEKRQSGEAAWNLGILCGQTAEDARFAGHPTVTCSDNAAHHARRVAPEEVAHIPVLMFHDLLERRTFDGTRLFDRWYLMVVDGSVKEKCREGFAEGGKSSTGEARYRYVLQLSVVGP
Ga0181517_1030018533300014160BogMVRVVRTVFPKLNTWLNALPDPRAQVMCLYAAAHLWWQIIATFLSRKGSRNGYDQQRQSGQAAWNMGELCGQSPDDPRFEGQPTVTCSDNAAYHASRVDPELVAQISVLMFHDLL
Ga0181538_1020377113300014162BogVRVVRAVFPRLNDWLNGLPDPRVQEMCVYAAAHLWWHVLATFLSRKGSRNGFDEQRQSGEAAWNMGALCGQAPEDPRFEGEPTVTCSDNAAYHASRVDPQRVAQIQGLMFRDLLERRLFDGVRLFDRWYVLVVDGSVKEKCRQGFHQGGKSATGGARYRYVLQLSVIGPHGT
Ga0181532_1012196213300014164BogLTAEAFVRVVQAAFPKLNAWLNALPDPRRQEMCLYTAAHLWWEIIATFLSRKGSRNGFDEKRQSGEAAWNLGILCGQTAEDARFAGHPTVTCSDNAAHHARRVAPEEVAHIPVLMF
Ga0182019_1106258513300014498FenLTAQALVRVVRAVFPRLNDWLNGLPDPRVQEMCVYVAAHLWWQILATFLSRKGSRNGFDEQRQSGEAAWNMGALCGQAAEDPRFEGAPTVTCSDNAAYHASRVDPQRVAQIPVLRFRDLLARRLFEGVRLFDRWY
Ga0182021_1188977423300014502FenVRVVRAVLPRLNDWVNCLADARVQEMCVYAAAHLWWHVLATFLSRKGSRNGFDEQRQSGEAAWNMGALCGQAPEDPRFEGEPTVTCSDNAAYHASRVDPQRVAQIPRLMFRDLLERRLFDGVRLFDRWYVLVVDGSVKEKCRQGFQEGGKSSTGAARY
Ga0181516_1062255413300014655BogMVVRALFPRLNAWLNALPDPRQQQLCLYTAAHHWWHIIATYLSRKGSRNGYDEQRQSGQAAWNMGLFCGQGAEDPRFEGQPTVTCSDNAARHASRVDPEAVARIPLLMFHDLLDRRLFDEARLFGRWYRLVLDGSVKEKCR
Ga0181519_1102795013300014658BogLTAEAFVRVVQTAFPKLNAWLNALPDPRRQEMCLYTAAHLWWEIIATFLSRKGSRNGFDEKRQSGEAAWNLGILCGQTAEDARFAGHPTVTCSDNAAHHANRVAPEEVAH
Ga0187853_1019917723300017940PeatlandVRVVRAVFPSLNDWLNRPPDPRIQELCLYAAAHLWWQIIATCLSRQGSRNGFDQQRQSGEAAWNRGALCGQTSEDPRFDGQPTVACSDNAARHASRVDPELVAQIPLVMFRDLLERRLFEGVRLFARWYVLLVDGSVKEKCRQGFQEGGKSSAHGVRYRYVLQLSVIGPEGTLFPLMHEEMDLHNPQT
Ga0187850_1025641513300017941PeatlandLTAEAFVRVVQAAFPKLNVWLNALPDPRRQEMCLYTAAHLWWEIIATFLSRKGSRNGFDEKRQSGEAAWNLGILCGQTAEDARFGGHPTVTCSDNAAHHARRVAPEEVAHIPVLIFHDLLERRTFDGTRLLDRWYLMVVDGSVKEKCREGFAEGGKSSTGDARYRYVLQLS
Ga0187847_1006542053300017948PeatlandMVVRAVFPRLNAWLNALPDPRVREMCLYTAAHLWWHIIANYLSRKGSRNGFDQQRQSGQAAWNMGLLCGQSAEDPRFDGQPTVTCSDNAAYHASRVDPELVAQITVFMFRDLLERRTFDNARLFGRWYRIVLDGSVKEKCRAGFEEGGKSSTNGARYRYVLQASVMGPEG
Ga0187776_1062529413300017966Tropical PeatlandMVVRALFPRLNAWLNGLPDPRAQRMCLYTAAHLWWHIIATYLSRQGSRNGFDEQRQSGQAAWNLGLLCGQTAEDPRFDGEPTVTCSDNAAYHASRVDPELVAQIPVLMFRDLLERRLFDEARLFDRWYRIVLDGSVKEKCRQGFEEGGKSSTN
Ga0187823_1021707323300017993Freshwater SedimentVRAAFPRLNAWLNALPDPRVQQMCRYAAAHLWWHIIATYLSRKGSRNGFDEQRQSGEAAWYLGRLCGQPADDPRFESQPTVTCSDNAAYHASRIDPEAVAQIPVLMFRDLLERRFFDNARIFERFYLMVVDGSVKEKCRQGFLEGGKSCTNGARYR
Ga0187884_1008910313300018009PeatlandLTAEAFVRVVQAAFPKLNVWLNALPDPRRQEMCLYTAAHLWWEIIATFLSRKGSRNGFDEKRQSGEAAWNLGILCGQTAEDARFGGHPTVTCSDNAAHHARRVAPEEVAHIPVLMFRDLLERRTFDGTRLLDRWYLMVVDGSVKEKCREGFAEGGKSSSGEARY
Ga0187873_102946613300018013PeatlandVRVVRAVFPSLNDWLNRPPDPRIQELCLYAAAHLWWQIIATCLSRQGSRNGFDQQRQSGEAAWNRGALCGQTSEDPRFDGQPTVACSDNAARHASRVDPELVAQIPLVMFRDLLERRLFEGVRLFARWYVLLVDGSVKEKCRQGFQEGGKSSAHGVRYRYVLQLSV
Ga0187889_1014492923300018023PeatlandVRVVRTGFPRLNGRLNGLPDPRVQEMCLYAAAHLWWQVIGTFLSRKGSRNGFDEQRQSGQAAWNMGALCGQTPDDPRFEGEPSVTCSDNAARHASRVDPELVAQIPVLMFRDLLDRRLFDGVRLFDRWYVMVVDGSVKEKCRQ
Ga0187881_1028846513300018024PeatlandLTAEAFVRVVQAAFPKLNVWLNALPDPRRQEMCLYTAAHLWWEILATFLSRKGSRNGFDQKRQSGEAAWNLGILCGQTAEDARFAGHPTVTGSDNAAHHARRVAPEEVAHIPVLMFRDLLERRTFDGTRLLDRWYLMVVDGSVKEKCREGFAEGGKSSTGEARYRYVL
Ga0187885_1039425813300018025PeatlandVRVVRTGFPRLNGRLNGLPDPRVQEMCLYAAAHLWWQVIGTFLSRKGSRNGFDEQRQSGQAAWNMGALCGQTPDDPRFEGEPSVTCSDNAARHASRVDPELVAQIPVLMFRDLLDRRLFD
Ga0187855_1031582323300018038PeatlandLTAEAFVRVVQAAFPKLNVWLNALPDPRRQEMCLYTAAHLWWEIIATFLSRKGSRNGFDEKRQSGEAAWNLGILCGQTAEDARFGGHPTVTCSDNAAHHARRVAPEEVAHIPVLMFRDLLERRTFDGTRLFDRWYLMVVDGSVKEKCREGFA
Ga0187851_1011575613300018046PeatlandLTAEAFVRVVQAAFPKLNVWLNALPDPRRQEMCLYTAAHLWWEIIATFLSRKGSRNGFDEKRQSGEAAWNLGILCGQTAEDARFGGHPTVTCSDNAAHHARRVAPEEVAHIPVLMFRDLLERRTFDPARLFDHWYLMVVD
Ga0224553_102516913300022875SoilVRASFPKLNAWLNALPDPRRQEMCLYTAAHLWWEVLATFLSRQGSRNGFDQERQSGEAAWNLGQLCGQTAEDARFAGHPTVTCSDNAAYHASRVDAEEVARIPVLMFRDLLERRTFDGTRLFDRWYLMVVDGSV
Ga0209321_1037497023300025312SoilMGTFLSRAGSRHGFDQQRNSGEAPWNMGELCDQPGQDPRFDGQPTVTCSDNAARHAARVDPAQVQEIPLKMIRELLQRRLFDEARLFGHWYVLIVDGSVQEKCRQGGAQDGKT
Ga0208194_102937913300025412PeatlandLTAEAFVRVVQAAFPKLNVWLNALPDPRRQEMCLYTAAHLWWEIIATFLSRKGSRNGFDEKRQSGEAAWNLGILCGQTAEDARFGGHPTVTCSDNAAHHARRVAPEEVAHIPVLMFRDLLERRTFDGTRLLDRWYLMVVDGSVKEKCREGFAAGGKSSTGEARYRYVLQLS
Ga0208587_105894923300025484Arctic Peat SoilVRAAFPRLNQWLNSLPDPRVQEMCRYAAAHLWWTVLAMFLSRKGSRNGFDEQRQSGAAAANLGVLCGQTADDPRFAGQPTVTCSDNAAYHASRVDPELVAQIPVLMFQELLQRRTFDGARLFDHWYIMVVDGTVKEKCREGFSQGGKSSSGDARYRY
Ga0207932_100713813300025495Arctic Peat SoilVRAAFPRLNQWLNSLPDPRVQEMCRYAAAHLWWTVLAMFLSRKGSRNGFDEQRQSGEAAGNLGVLCGQTAQDPRFAGQPTVTCSDNAAYHASRVDPELVAQIPVLMFQELLQRRTFDGARLFDRWYLMVVDGTVKEKCRQGFTEDGKSSS
Ga0207932_100989113300025495Arctic Peat SoilVRTVGAAFPKLNQWLNSLPDPRVQEMCRYAAAHLWWTVLAMFLSRKGSRNGFDEQRQSGDAAENLGALCGQTAADPRFAGQPTVTCSDNAAYHASRVDPEMVAQIPVLMFQELLQRRTFDDARLFDRWYLMVVDGTVKEKCRQGFTEDGKSSS
Ga0208355_100890013300025581Arctic Peat SoilVRAAFPRLNQWLNSLPDPRVQEMCRYAAAHLWWTVLAMFLSRKGSRNGFDEQRQSGEAAGNLGVLCGQTAQDPRFAGQPTVTCSDNAAYHASRVDPELVAQIPVLMFQELL
Ga0208355_102338033300025581Arctic Peat SoilVGAAFPKLNKWLNSLPDPRVQEMCRYAAAHLWWTVLAMFLSRKGSRNGFDEQRQSGAAAANLGVLCGQTADDPRFAGQPTVTCSDNAAYHASRVDPELVAQIPVLMFQELL
Ga0209540_1033026323300025888Arctic Peat SoilVRAAFPRLNQWLNSLPDPRVQEMCRYAAAHLWWTVLAMFLSRKGSRNGFDEQRQSGEAAGNLGVLCGQTAQDPRFAGQPTVTCSDNAAYHASRVDPELVAQIPVLMFQELLQRRTFDGARLFDHWYIMVVDGTVKEKCR
Ga0209293_1027904323300027877WetlandLSAQALVRVVRAVFPRLNDRLNGLPDPRVQPMCVYAGAHLWWQIIATFLSRKGSRNGFDEQRQSGQAAWNLGALCGQAPEDPRFGGQPTVTCSDNAARHASRVDPELVAQ
Ga0268284_104740233300028176Saline WaterVRAVFPKLNAWLNALPDPRVQAMCRYVAAHLWWQIIATYLSRKGSRNGFDEQRQSGQAPWNMGRLCGQTAADPRFDGQPTVTGSDHAAHHASRVAPETVAQIPILLFRDLLARRRFDPARLFGRWYRLILDGSVKEKCRAGFEADGQSATNGARYRYVLQASVAGPAGTLFPLLHEEMDLHDPVADKEDCELKSFSRLSARLKQEF
Ga0268284_105141013300028176Saline WaterLIQVLRRVFPDLFLWLRDLPDPRVREMCRYTASHLWWHIIATYLSRSGSRNAFDEQRQVGQAAWNMGELCGQAATDPRFEGQPMVTCSDNAARHAARVDPEAVAWIVVQMMQVLLERRTFENARLLGQYYILLFDGSVQEKCRAGFSEGGKSGSGEARYRYVLQVVLVGPEGTAFPLMHEHMDLVDPQQDKED
Ga0265593_113843913300028178Saline WaterRVLRAVFPKLNAWLNALPDPRVQEMCRYVAAHLWWQIMATYLSRKGSRNGFDEQRQSGQAPWNMGLLCGQTAEDPRFDGQPTVTCSDNAAHHASRVDPETVAQIPILMFRDLLARRLFDSARLFGRWYRLVLDGSVKEKCRAGFEADGKSATNGARYRYVLQASVMGPAGTLFPLLHEEMDLHDPVADKEDCELKSFSRLSARLKQEFP
Ga0265337_104870433300028556RhizosphereVRAVRAACPQLNRWLNEVLPDPRSQPMCLYTAAHLWWQIIGTFLSRKGSRHGFDQQRQAGQAAYNLGALCGQAPEDPRFEGAPRVTCSDNAARHASRVDPEVVAQIPVLIFRELLERRLFDHSRLFERSYLMVLDGSVKEKCRQGFTQGGKSSTGTGRYRYVLQLSVIGPEGTLLPLMHEEMDVLNPQTEKE
Ga0311332_1081594523300029984FenMCLYTGAHLWWQIIGTFLSRKGSRNGFDQQRQSGQAAWNMGALCGQSPEDPRFAGQPTVTGSDNAARHAGRVDPEEVAQIPVLMFRDLLERRLFDHARLLDRWYLMVLDGSVKEKCRQDFEEGGKSSTGSARYRYVLQLS
Ga0311360_1085677423300030339BogMCLYTGAHLWWQIIGTFLSRKGSRNGFDQQRQSGQAAWNMGALCGQSPEDPRFAGQPTVTGSDNAARHAGRVDPEEVAQIPVLMFRDLLERRLFDHARLLDRWYLMVLDGSVKEKCRQGFEEGGKSSTGSARYR
Ga0302323_10294307913300031232FenIDAPLTAQALVRVVRAVLPRLNDWLNGLPDPRVQEMCVYAAAHLWWHVLATFLSRKGSRNGFDEQRQSGQAAWNLGALCGQAPEDPRFEGEPTVTCSDNAAYHASRVDPQLVAQILGLMFRDLLERRLFDGVRLFDRWYVLVVDGSVKEKCRQGFHQGGKSATSGARYRYVLQLSVIGPH
Ga0265332_1046103213300031238RhizosphereKPLKGIDEPLTAQGLVRTVRAVCPRLNHWLNQVLPDPRVQEMCLYTAAHLWWQIIGTFLSRKGSRHGFDQQRQAGQAAYNLGALCGQAPEDPRFEGAPRVTCSDNAARHASRVDPEVVAQIPVLIFRELLERRLFDHSRLFERSYLMVLDGSVKEKCRQGFTQGGKSSTGTGRYR
Ga0265328_1027042613300031239RhizosphereVRAVRAACPQLNRWLNEVLPDPRSQPMCLYTAAHLWWQIIATFLSRKGSRHGFDQQRQAGQAAYNLGALCGQGPEDPRFEGAPKVTCSDNAARHASRVDPEVVAQIPVLIFRELLERRLFDHSRL
Ga0265314_1048178013300031711RhizosphereVRAVRAACPQLNRWLNEVLPDPRSQPMCLYTAAHLWWQIIGTFLSRKGSRHGFDQQRQAGQAAYNLGALCGQAPEDPRFEGAPKVTCSDNAARHASRVDPEVVAQIPVLIFRELLERRLFDHSRL
Ga0302321_10099502423300031726FenVRTVRAACPKLNGWLNHTLPDPRNQEMCLYTAAHLWWQIIGTFLSRKGSRNGYDQQRQSGQAAYNMGALCGQDPEDPRFEGAPTVTCSDNAAHHACRVDPQVVAQLPVLMFRELLERRLFDHSRLFDRCYVMVLDGSVKEKCRQGFTADGKSSSGDARYRYVLQLS
Ga0302321_10171862613300031726FenVRVVRTVFPSLNDWLNGLPDPRVQEMCLYAAAHLWWQILATFLSRKGSRNGFDEQRQSGEAAWNMGALCGQAPEDPRFEGEPTVTCSDNAAYHASRVDPELVAQIPALMFRDLLARRLFD
Ga0315297_1021580623300031873SedimentVRVVRAVFPRLNDWLNRLPDPRIQEMCVYVAAHLWWQILATCLSRKGSRNGFDEQRQSGEAAWNMGALCGQAPEDPRFEGAPTVTCSDNAARHASRVDPEQAAQIPVLMFRDLLDRLLFEGVRLFDRWYVMLVDGSVK
Ga0315284_1075221333300032053SedimentVRAVFPRLNDWLNSLPDPRVQEMCVYAAAHLWWQILATGLSRKGSRNGFDEQRQSGEAAGNLGALCGQAPEDPRFAGHPTVTCSDNAARHARRVDPELVAQIPVLMFRDLLERRTFDGVRIFDRWYVLVVDGSVKEKCRQGFPEGGKSSTGGARYR
Ga0315284_1136620123300032053SedimentVRVVRAVFPSLNDWLNRLPDPRIQELCLYAAAHLWWQIIATCLCRQGSRNGFDQQRQSGEAAWNMGALCGQTSEDPRFDGQPTVTCSDNAARHASRVDPERVAHIPVLMFW
Ga0316218_120841613300032117FreshwaterMNPKLSAPQTTRASGHSPLSGPHPRPQRNPAGRKLLPGINEPLYAQVLLMVVRAVFPRLNTRLNALPDPRVQQMCRYAAAHLWWHIIATYLSRKGSRNGFDEQRQSGQAAWNMGLLCGQSAEDPRFEGEPTVTCSDNAAYHANRVEAEAVAQIPVLMFCDLLQRRIFDNARLLGRWYRIVLDGSVKEKCRQGFERGGKSCASG
Ga0315277_1077801123300032118SedimentVRVVRAVFPSLNDWLNRLPDPRIQELCLYAAAHLWWQIIATCLCRQGSRNGFDQQRQSGEAAWNMGALCGQTSEDPRFDGQPTVTCSDNAARHASRVDPERVAHIPVLMFRDLLARRLFDGVRLFDRWYVLVVDGSVKEKCRQGFHQGGKSAT
Ga0315292_1045509333300032143SedimentVRVVRAVFPRLNDWLNRLPDPRVQELCLYAAAHLWWHIIATFLSRKGSRNGFDEQRQSGEAAWNMGALCGQTPEDPRFAGAPTVTCSDNAALHASRVDPELVAQIPALMFRDLLERRSFDGVRLFDRW
Ga0315295_1121147513300032156SedimentVVRAVFPKLNAWLNALPDPRVQEMCRYVAAHLWWHIIATYLSRKGSRNGFDEQRQSGAAAWNMGLLCGQSAADPRFDGQPTVTGSDNAAHHARRVDPEAVAQIPVLMFHDLLERRLFDGARLFGRWYRMVVDGSVKEKCRAGFEAGGKSSTNGARYRYVLQL
Ga0311301_1244750623300032160Peatlands SoilATCLSRQGSRNGFDQQRQSGEAAWNMGALCGQTSEDPRFEGQPTVTCSDNAARHASRVDPERVAQIPGLMFRDLLERRRFDGVRLFGRWYVLVVDGSVKEKCRQGFHEGGKSCSGGARYR
Ga0315283_1061152913300032164SedimentVRVVRAVFPSLNDWLNRLPDPRIQELCLYAAAHLWWQIIATCLCRQGSRNGFDQQRQSGEAAWNMGALCGQTSEDPRFDGQPTVTCSDNAARHASRVDPERVAHIPVLMFRDLLARRLFDGVRLFDRWYVLLVDGSVKEKCRQGFQAGGKSSTHGVRYRYVLQLSVIGPEGTLFPLM
Ga0315276_1155535323300032177SedimentVRAVFPRLNDWLNSLPDPRVQEMCVDAAAHLWWQILATGLSRKGSRNGFDEQRQSGEAAGNLGALCGQAPEDPRFAGHPTVTCSDNAARHASRVDPELVAQIPVLMFRDLLERRTFDGVRIFDRWYVLVVDGSVKEKCRQGFPEGG
Ga0315271_1081282513300032256SedimentVRVVRAVFPRLNDWLNRLPDPRVQEMCVYAAAHLWWQILATFLSRKGSRNGFDEQRHSGEAAWNMGALCGQAAEDPRFEGEPTVTCSDNAVYHARRVDPKRAAQIPVLMFRDLLARRLFDGVRLFDR
Ga0315271_1185006513300032256SedimentMVVRAVFPRLNDWLNALPDPRVQRMCLYSAAHLWWHIIATFLSRKGSRNGFDEQRQSGQAAWNLGLLCGQTAEDPRFDGQPTVTCSDNAAYHASRVDPELVAQIPVLMFHDLLERRLFD
Ga0315286_1154052913300032342SedimentVRVVRTVFPRLNHWLNRLPDPRIQELCLYAAAHLWWQIIATFLSRKGSRNGFDEQRQSGQAAWNLGALCGQTPEDPRFQGEPTVTCSDNAAFHASRVDPERVAQIPALMFRDLLERRSFDGVRLFDRWYVLVVDGSVKEK
Ga0315287_1078897513300032397SedimentVRVVRAVFPRLNDWLNRLPDPRVQELCLYAAAHLWWHIIATFLSRKGSRNGFDEQRQSGEAAWNMGALCGQTPEDPRFAGAPTVTCSDNAALHASRVDPELVAQIPALMFRDLLERRSFDGVRLFDRWYVLVVDGSVKEKCRQGFQEGGKSSTGGAR
Ga0315273_1090903113300032516SedimentVRVVRAVFPRLNHWLYGLPDPRVQEMCLYAAAHLWWQILATFLSRQGSRNGFDEQRQSGEAAWNMGALCGQTSEDPRFDGQPTVTCSDNAARHASRVDPE
Ga0315273_1141812513300032516SedimentVRVVRAVFPSLNDWLNRLPDPRIQELCLYAAAHLWWQIIATCLCRQGSRNGFDQQRQSGEAAWNMGALCGQTSEDPRFDGQPTVTCSDNAARHASRVDPE
Ga0316232_130732613300032605FreshwaterRPQRNPAGRKLLPGINEPLYAQVLLMVVRAVFPRLNTRLNALPDPRVQQMCRYAAAHLWWHIIATYLSRKGSRNGFDEQRQSGQAAWNMGLLCGQSAEDPRFEGEPTVTCSDNAAYHANRVEAEAVAQIPVLMFCDLLQRRIFDNARLLGRWYRIVLDGSVKEKCRQGFERGGKSCASGDRYRYVLQASVMGPEGT
Ga0335085_1127497823300032770SoilMVLLATFPKLNAWLNALPDPRVQEMCLYTAAHLWWHVIATYLSRKGSRNGFDEQRQSGEAAWNMGVLCGQSAEDPRFEGQPTVTCSDNAAHHAARVDPEAVAQIPVLMFRELLERRLFDDARLFGRWYRVIADGS
Ga0335078_1072617813300032805SoilMVVRAVFPRLNAWLNSLPDPRMQRMCLYTAAHLWWHIIATYLSRKGSRNGFDEQRQSGQAAWNMGLLCGQSAEDPRFEGHPTVTCSDNAAYHASRVDPERVAQIPVLMFHDLLDRRTFDDARLFGRWYRIVLDGSVKEKCRAGFQ
Ga0335078_1102326723300032805SoilVRVLRGVFPRLNDWLNQLPDPRVQEMCLYSAAHLWWQVLATYLCRKGSRNGFDQQRQSGQAPWNMGALCGQPPEDPRFEGLPAVTCSDNAAHHADRVNPEKVARLLVLLFRQLHQRRFFDGARLLDRWYVLIVDGTVKEKCRHGGEQGGKSSGGQGRYRYVLQLSVIGPEGTLLPLMHEEMDMHNP
Ga0335078_1151555423300032805SoilVRAAFPRLNDWLNDLPDPRVQEMCLYAAAHLWWQIIATFLSRQGSRNGYDQQRQSGQAAWNLGELCGQSPDDPRFAGQPTVTCSDNAAYHAGRVDPESVARIPALMFRDLLER
Ga0335070_1198801513300032829SoilLLMVLLATFPKLNAWLNALPDPRVQEMCLYTAAHLWWHVIATYLSRKGSRNGFDEQRQSGEAAWNMGVLCGQSAEDPRFEGQPTVTCSDNAAHHAARVDPEAVAQIPVLMFRELLERRLFDDARLFGRWYRVIADGSVKEQCRQGFEEGGKSSTNGARYRYVLQLSVIGPAGTL
Ga0335069_1210603023300032893SoilLTAQGLVEVVRAAFPKLNAWFNGLPDPRVQEKCLYTAAHLWWQVIATFLSRTGSRNGFDQQRQAGEAAFNLGLLCGQTAEDPRFAGQPSVTSSDNAAYHAGRVDPELVAQIPVLMFRDLLERRTFDDARLLERWYIM
Ga0335071_1096787913300032897SoilVRRAFPRLNTWLNGLPDPRCQEMCLYAAAHLWWSVLAMFLGRFGSRNAYDQKRQSGQAAWNLGLLCEQTAEDPRFDGQPAVTCSDNAARHAARVDPEAVAQIPVLMFHDLLARRTFEDARLFDRYYLIVADGSVKEKCRQGFEQGGKTSTNGARYRYILQLSVLGPEGTLFPLMH
Ga0335084_1107141513300033004SoilLTAQGLVAVVRAAFPKLNAWFNGLPDPRVQEKCLYTAAHLWWQVIATFLSRTGSRNGFDQQRQAGEAAFNLGLLCGQTAEDPRFAGQPTVTSSDNAAYHAGRVDPELVAQIPVLMFRDLLERRTFDDARLLERWYIMVVDGSVKEKCRQDFTEGGKSCTNGARYRYILQLSVVGP
Ga0316619_1069161813300033414SoilLSAQALVRVVRAVFPRLNDRLNRLPDPRVQERCVYTGAHLWWQVIATFLSRKGSRNGFDEQRQSGEAAWNLGALCGQVPEDPRFEGHPTVTCSDNAARHASRVDPGQVDQIPVQMFR
Ga0316619_1149133513300033414SoilLTARALVRVVRAAFPRLNDWLNRLPDPRVQELCLYVAAHLWWQIIATFLSRKGSRNGFDEQRQSGEAAWNLGALCGQTPEDPRFEGEPTVTCSDNAARHASRVDPERVAQISVLMFRDLLERRSFDGVRLFDHWYVLVVDGSVKEKCRQGFHQGGKFSPGGARY
Ga0316622_10296102113300033416SoilVRVVRAVFPSLNDWLNGLPDPRIQELCLYAAAHLWWQIIATCLSRQGSRNGFDQQRQSGEAAWNMGALCGQNSEDPRFDGQPTVTCSDNAARHASRVDPEVVAQIPRLMFRDLLERR
Ga0316625_10213688213300033418SoilMVVRAVFPRLNAWLNALPDPRVREMCLYTAAHLWWQIIATYLSRKGSRNGFDEQRQSGQAAWNMGLLCGQTAEDPRFAGEPTVTCSDNAAYHASRVDPEMVAQIPVLMFRDLLERRLFDGARLFD
Ga0316601_10135387213300033419SoilVRVVRAVFPRLNDWLNRLPDPRVQERCLYAAAHLWWQIIATFLSRKGSRNGFDEQRQSGEAAWNLGALCGQTPEDPRFAGQPTVTCSDNAARHASRVDPELVAQIPQLMFRDLLERRLFDGVRLFDRWYVLL
Ga0316620_1157474213300033480SoilLSAQALVRVVRAVFPRLNDRLNRLPDPRVQERCVYTGAHLWWQVIATFLSRKGSRNGFDEQRQSGEAAWNLGALCGQVPEDPRFEGHPTVTCSDNAARHASRVDPGQVDQIPVQMFRDLLERRLLDGVRLFDHWYVLVVDGSVKEKCRQGFHQGGKSSTGGARYRYVLQLSVLGPAG
Ga0316627_10148813613300033482SoilLSAQALVRVVRAVFPRLNDRLNRLPDPRVQERCVYTGAHLWWQVIATFLSRKGSRNGFDEQRQSGEAAWNLGALCGQVPEDPRFEGHPTVTCSDNAARHASRVDPGQVDQIPVQMFRDLLERRLLDGVRLFDHWYVLVVDGSVKEKCRQGFHQGGKSSTGGARYRY
Ga0316627_10281471213300033482SoilRAGRPGRLIFRGRHSCRLSTAAPLWWQILATFLSRTGSRNGFDQQRQSGQAAWNRGALCGQSPEDPRFAGAPTVTCSDNAARHANRVDPEAVAQLPVLMFGDLLERRLFDGVRLLGRWYVLVIDGSVKEKCRQGFPQGGKFSSGDARYRYVLQASVLGSDWRMRTRIGRRW
Ga0316629_1012270013300033483SoilMVLRAAFPKLNAWLNGLPDPRAQEMCLYTAAHLWWQIIATYLSRKGSRNGFDEQRQSGQAAWNMGLLCGQTAEDPRFAGEPTVTCSDNAAYHASRVDPEMVAQIPVLMFRDLLERRLFDGARLFDRWYRIVLDGSVKEKCRQGFEA
Ga0316629_1135084523300033483SoilVRVVQAVFPRLNDWLNGLPDPRVQEMCVYAAAHLWWQILATFLSRKGSRNGFDEQRQSGEAPWNMGALCGQVPEDPRFEGEPTVTCSDNAAYHASRVDPQRVAQIQGLMFRDLLERRLFDGVRLFDR
Ga0316626_1057703613300033485SoilMCLYTAAHLWWHIIATYLSRKGSRNGFDEQRQSGQAAWNMGLLCGQTAEDLRFDGEPTVTCSDNAAYHASRVDPEVVAQIPVLMFRDLLERRLFDEARLFDRWYRIVLDGSVKEKCR
Ga0316626_1063046733300033485SoilVRTVRAACPRLNCWLNQVLPDPRYQPMCLYTAAHLWWQVIGTFLARKGSRNSFDQQRQSGQAAWNMGALCGQSSEDPRFAGEPTVTCSDNAARHASRVAPEAVAQIPVLIFRDLLQRRL
Ga0316617_10133020823300033557SoilLSAQALVRVVRAVFPRLNDRLNGLPDPRVQPMCVYTGAHLWWQIIATFLSRKGSRNGFDEQRQSGQAAWNLGALCGQAPEDPRFGGQPTVTCSDNAARHARRVDPELVAPIPGLLFRDLLDRRLFEGVRLFDHWYVLVVD
Ga0334822_081202_1_4563300034070SoilLTAQALVRVVRAVFPRLNDWLNCLPDPRVQEMCVYVAAHLWWQILATFLSRKGSRNGFDEQRQSGEAAWNMGALCGQAPEDPRFEGEPTVTCSDNAAYHASRVDPQLVAQIPGLMFRDLLERRLFDGVRLFDRWYVLVVDGSVKEKCRQGFH
Ga0326724_0346260_428_8053300034091Peat SoilLVRVLRAVFPRLNDWLNDLPDPRVQEMCLYSAAHLWWQVLATYLCRKGSRNGFDQQRQSGQAPWNMGALCGQPPEDPRFGGQPAVTCSDNAAHHAQRVDPEKVARLPVLMFRELHRRRLFDSSRLL
Ga0326724_0646110_1_4443300034091Peat SoilMVLRAVFPRLNAWLNALPDPRKREMCLYTAAHLWWHVIATFLSRKGSRNGFDEQRQSGQAAWNMGLLCGQSAEDPRFDGQPTVTCSDNAAYHASRVDPEEVAQIPVLMFHDLLERRTFDSARLFGRWYRIVLDGSVKEKCRAGFEEGG
Ga0370492_0448918_176_5233300034282Untreated Peat SoilVVRAVFPGLNAWLNALPDPRVREMCLYTAAHLWWHVIATYLSRKGSRNGFDEQRQSGQAAWNMGLLCGQSAQDPRFNGQPTVTCSDNAAHHAARVDPEKVAQLPVLMFHDLLERRV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.