Metagenome Family F097549

Basic Information
Family ID	F097549
Family Type	Metagenome
Number of Sequences	104
Average Sequence Length	43 residues
Representative Sequence	MAQVTLGIGSSHSPMLSTPHEAFAGLGDLDRARLPEFAARARE
Number of Associated Samples	93
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	95.15 %
% of genes near scaffold ends (potentially truncated)	94.23 %
% of genes from short scaffolds (< 2000 bps)	88.46 %
Associated GOLD sequencing projects	92
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.36

Most Common Taxonomy
Group	Bacteria (87.500 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (9.615 % of family members)
Environment Ontology (ENVO)	Unclassified (28.846 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (38.462 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 33.80% β-sheet: 0.00% Coil/Unstructured: 66.20%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF00496	SBP_bac_5	19.23
PF16363	GDP_Man_Dehyd	7.69
PF00296	Bac_luciferase	2.88
PF01370	Epimerase	2.88
PF13538	UvrD_C_2	1.92
PF02738	MoCoBD_1	1.92
PF08020	DUF1706	1.92
PF00005	ABC_tran	1.92
PF12399	BCA_ABC_TP_C	1.92
PF04963	Sigma54_CBD	0.96
PF01547	SBP_bac_1	0.96
PF13754	Big_3_4	0.96
PF13416	SBP_bac_8	0.96
PF13361	UvrD_C	0.96
PF00355	Rieske	0.96
PF05694	SBP56	0.96
PF12706	Lactamase_B_2	0.96
PF09335	SNARE_assoc	0.96
PF12770	CHAT	0.96
PF07238	PilZ	0.96
PF02900	LigB	0.96
PF00903	Glyoxalase	0.96
PF00282	Pyridoxal_deC	0.96
PF16338	AGL_N	0.96
PF01882	DUF58	0.96
PF00072	Response_reg	0.96

COG ID	Name	Functional Category	% Frequency in 104 Family Scaffolds
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	2.88
COG4283	Uncharacterized conserved protein DfsB/IRC4, DUF1706 (PF08020) domain	General function prediction only [R]	1.92
COG0076	Glutamate or tyrosine decarboxylase or a related PLP-dependent protein	Amino acid transport and metabolism [E]	0.96
COG0398	Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family	Function unknown [S]	0.96
COG0586	Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family	Cell wall/membrane/envelope biogenesis [M]	0.96
COG1238	Uncharacterized membrane protein YqaA, VTT domain	Function unknown [S]	0.96
COG1508	DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog	Transcription [K]	0.96
COG1721	Uncharacterized conserved protein, DUF58 family, contains vWF domain	Function unknown [S]	0.96

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	88.46 %
Unclassified	root	N/A	11.54 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	88.46 %
Unclassified	root	N/A	11.54 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	87.50 %
Unclassified	root	N/A	11.54 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.96 %

Name	Rank	Taxonomy	Distribution
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	41.35 %
Unclassified	root	N/A	11.54 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	10.58 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.96 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.96 %

Name	Rank	Taxonomy	Distribution
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	41.35 %
Unclassified	root	N/A	11.54 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5.77 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	1.92 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.96 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.96 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	41.35 %
Unclassified	root	N/A	11.54 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	2.88 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.92 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.96 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.96 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.96 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.96 %

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	29.81 %
Unclassified	root	N/A	11.54 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	1.92 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.96 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.96 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.96 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.96 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.96 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	29.81 %
Unclassified	root	N/A	11.54 %
Acidiphilium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium	1.92 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	0.96 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.96 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.96 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.96 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.96 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	29.81 %
Unclassified	root	N/A	11.54 %
unclassified Acidiphilium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium	1.92 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.96 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	0.96 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.96 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.96 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.96 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	29.81 %
Unclassified	root	N/A	11.54 %
Acidiphilium sp. PM	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. PM	1.92 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	0.96 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	0.96 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.96 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.96 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.96 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	29.81 %
Unclassified	root	N/A	11.54 %
Acidiphilium sp. PM	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. PM	1.92 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	0.96 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	0.96 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.96 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.96 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.96 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	29.81 %
Unclassified	root	N/A	11.54 %
Acidiphilium sp. PM	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. PM	1.92 %
Rhabditida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida	0.96 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	0.96 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.96 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.96 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.96 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	29.81 %
Unclassified	root	N/A	11.54 %
Acidiphilium sp. PM	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. PM	1.92 %
Rhabditina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina	0.96 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	0.96 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.96 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.96 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.96 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	29.81 %
Unclassified	root	N/A	11.54 %
Acidiphilium sp. PM	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. PM	1.92 %
Rhabditomorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha	0.96 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	0.96 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.96 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.96 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.96 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	29.81 %
Unclassified	root	N/A	11.54 %
Acidiphilium sp. PM	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. PM	1.92 %
Rhabditoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea	0.96 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	0.96 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.96 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.96 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.96 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	29.81 %
Unclassified	root	N/A	11.54 %
Acidiphilium sp. PM	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. PM	1.92 %
Rhabditidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae	0.96 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	0.96 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.96 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.96 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.96 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	29.81 %
Unclassified	root	N/A	11.54 %
Acidiphilium sp. PM	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. PM	1.92 %
Rhabditidae incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis	0.96 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	0.96 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.96 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.96 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.96 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	29.81 %
Unclassified	root	N/A	11.54 %
Acidiphilium sp. PM	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. PM	1.92 %
Diploscapter	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter	0.96 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	0.96 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.96 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.96 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.96 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	29.81 %
Unclassified	root	N/A	11.54 %
Acidiphilium sp. PM	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. PM	1.92 %
Diploscapter pachys	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter → Diploscapter pachys	0.96 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	0.96 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.96 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.96 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2065487018\|GPINP_F5MS3JC02J4MGC	All Organisms → cellular organisms → Bacteria	547	Open in IMG/M
2199352025\|deepsgr__Contig_165827	All Organisms → cellular organisms → Bacteria → Proteobacteria	3000	Open in IMG/M
3300001139\|JGI10220J13317_10142256	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	574	Open in IMG/M
3300004643\|Ga0062591_100912005	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	825	Open in IMG/M
3300005183\|Ga0068993_10037799	All Organisms → cellular organisms → Bacteria	1344	Open in IMG/M
3300005295\|Ga0065707_10642963	All Organisms → cellular organisms → Bacteria	667	Open in IMG/M
3300005457\|Ga0070662_101654165	All Organisms → cellular organisms → Bacteria	553	Open in IMG/M
3300005458\|Ga0070681_11253064	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	664	Open in IMG/M
3300005518\|Ga0070699_100220872	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1688	Open in IMG/M
3300005518\|Ga0070699_101918197	All Organisms → cellular organisms → Bacteria	542	Open in IMG/M
3300005564\|Ga0070664_101016012	All Organisms → cellular organisms → Bacteria	780	Open in IMG/M
3300005713\|Ga0066905_100155183	All Organisms → cellular organisms → Bacteria	1655	Open in IMG/M
3300005713\|Ga0066905_100645468	All Organisms → cellular organisms → Bacteria	902	Open in IMG/M
3300005713\|Ga0066905_101717851	All Organisms → cellular organisms → Bacteria	577	Open in IMG/M
3300005764\|Ga0066903_102230068	All Organisms → cellular organisms → Bacteria	1057	Open in IMG/M
3300005843\|Ga0068860_100583705	All Organisms → cellular organisms → Bacteria	1122	Open in IMG/M
3300005843\|Ga0068860_101333409	All Organisms → cellular organisms → Bacteria	738	Open in IMG/M
3300005888\|Ga0075289_1085049	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	526	Open in IMG/M
3300006047\|Ga0075024_100546549	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	614	Open in IMG/M
3300006237\|Ga0097621_101165376	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	725	Open in IMG/M
3300006796\|Ga0066665_11681793	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	502	Open in IMG/M
3300006871\|Ga0075434_100358842	All Organisms → cellular organisms → Bacteria	1478	Open in IMG/M
3300006904\|Ga0075424_100046968	All Organisms → cellular organisms → Bacteria	4504	Open in IMG/M
3300006904\|Ga0075424_102478203	All Organisms → cellular organisms → Bacteria	543	Open in IMG/M
3300006914\|Ga0075436_100107716	All Organisms → cellular organisms → Bacteria	1944	Open in IMG/M
3300006931\|Ga0097620_101054156	All Organisms → cellular organisms → Bacteria	894	Open in IMG/M
3300009087\|Ga0105107_11134038	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	545	Open in IMG/M
3300009147\|Ga0114129_12480749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. PM	620	Open in IMG/M
3300009792\|Ga0126374_10844990	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. PM	704	Open in IMG/M
3300009804\|Ga0105063_1048268	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	602	Open in IMG/M
3300009837\|Ga0105058_1106389	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	661	Open in IMG/M
3300010048\|Ga0126373_10249508	All Organisms → cellular organisms → Bacteria	1746	Open in IMG/M
3300010048\|Ga0126373_12573202	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	567	Open in IMG/M
3300010159\|Ga0099796_10083078	Not Available	1178	Open in IMG/M
3300010325\|Ga0134064_10274613	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	633	Open in IMG/M
3300010358\|Ga0126370_10264164	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1343	Open in IMG/M
3300010358\|Ga0126370_11270243	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	688	Open in IMG/M
3300010359\|Ga0126376_11408738	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	722	Open in IMG/M
3300010366\|Ga0126379_11257916	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	846	Open in IMG/M
3300010397\|Ga0134124_10538989	Not Available	1134	Open in IMG/M
3300010400\|Ga0134122_10002455	All Organisms → cellular organisms → Bacteria	13633	Open in IMG/M
3300010400\|Ga0134122_10408170	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter → Diploscapter pachys	1202	Open in IMG/M
3300011270\|Ga0137391_11460700	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	529	Open in IMG/M
3300011271\|Ga0137393_10316342	All Organisms → cellular organisms → Bacteria	1330	Open in IMG/M
3300011442\|Ga0137437_1344720	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	504	Open in IMG/M
3300012189\|Ga0137388_11554824	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	598	Open in IMG/M
3300012208\|Ga0137376_11024886	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	707	Open in IMG/M
3300012350\|Ga0137372_10938603	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	609	Open in IMG/M
3300012362\|Ga0137361_10010688	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	6547	Open in IMG/M
3300012363\|Ga0137390_11782817	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	547	Open in IMG/M
3300012906\|Ga0157295_10292914	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	565	Open in IMG/M
3300012929\|Ga0137404_10232269	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1576	Open in IMG/M
3300012948\|Ga0126375_11070073	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	662	Open in IMG/M
3300012958\|Ga0164299_10104142	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1481	Open in IMG/M
3300012971\|Ga0126369_12106946	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	652	Open in IMG/M
3300012971\|Ga0126369_12201141	All Organisms → cellular organisms → Bacteria	638	Open in IMG/M
3300013102\|Ga0157371_10047989	All Organisms → cellular organisms → Bacteria	3035	Open in IMG/M
3300014324\|Ga0075352_1101677	All Organisms → cellular organisms → Bacteria	755	Open in IMG/M
3300015259\|Ga0180085_1025432	All Organisms → cellular organisms → Bacteria	1653	Open in IMG/M
3300015374\|Ga0132255_102292562	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	824	Open in IMG/M
3300018054\|Ga0184621_10207506	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	702	Open in IMG/M
3300018422\|Ga0190265_11036770	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	942	Open in IMG/M
3300019458\|Ga0187892_10023605	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	5577	Open in IMG/M
3300021088\|Ga0210404_10789466	Not Available	542	Open in IMG/M
3300021445\|Ga0182009_10034445	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	2049	Open in IMG/M
3300025558\|Ga0210139_1013752	All Organisms → cellular organisms → Bacteria	1517	Open in IMG/M
3300025916\|Ga0207663_11032919	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	660	Open in IMG/M
3300025926\|Ga0207659_11029538	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	709	Open in IMG/M
3300025932\|Ga0207690_10005391	All Organisms → cellular organisms → Bacteria → Proteobacteria	7535	Open in IMG/M
3300025934\|Ga0207686_11061584	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	659	Open in IMG/M
3300025981\|Ga0207640_11482832	All Organisms → cellular organisms → Bacteria	609	Open in IMG/M
3300026041\|Ga0207639_11353134	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	668	Open in IMG/M
3300026075\|Ga0207708_11563139	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	580	Open in IMG/M
3300026304\|Ga0209240_1097634	Not Available	1057	Open in IMG/M
3300026318\|Ga0209471_1049999	All Organisms → cellular organisms → Bacteria	1946	Open in IMG/M
3300026320\|Ga0209131_1178432	Not Available	1030	Open in IMG/M
3300026328\|Ga0209802_1058902	All Organisms → cellular organisms → Bacteria	1863	Open in IMG/M
3300026333\|Ga0209158_1198972	Not Available	702	Open in IMG/M
3300026371\|Ga0257179_1037677	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	607	Open in IMG/M
3300027360\|Ga0209969_1024377	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	909	Open in IMG/M
3300027614\|Ga0209970_1030289	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	939	Open in IMG/M
3300027654\|Ga0209799_1042714	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1011	Open in IMG/M
3300027669\|Ga0208981_1141541	Not Available	612	Open in IMG/M
3300027695\|Ga0209966_1166052	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	516	Open in IMG/M
3300027725\|Ga0209178_1020053	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	2083	Open in IMG/M
3300027846\|Ga0209180_10353287	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	838	Open in IMG/M
3300027952\|Ga0209889_1011648	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	2133	Open in IMG/M
3300028381\|Ga0268264_10631929	Not Available	1058	Open in IMG/M
3300028587\|Ga0247828_10252267	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20	949	Open in IMG/M
3300028828\|Ga0307312_10831395	Not Available	612	Open in IMG/M
3300031229\|Ga0299913_11778842	All Organisms → cellular organisms → Bacteria	565	Open in IMG/M
(restricted) 3300031248\|Ga0255312_1029529	All Organisms → cellular organisms → Bacteria	1309	Open in IMG/M
3300031720\|Ga0307469_10811056	Not Available	859	Open in IMG/M
3300031740\|Ga0307468_100585392	All Organisms → cellular organisms → Bacteria	907	Open in IMG/M
3300031740\|Ga0307468_101387749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	645	Open in IMG/M
3300031798\|Ga0318523_10059590	All Organisms → cellular organisms → Bacteria	1814	Open in IMG/M
3300031820\|Ga0307473_10033058	All Organisms → cellular organisms → Bacteria	2277	Open in IMG/M
3300031820\|Ga0307473_10899773	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	639	Open in IMG/M
3300032044\|Ga0318558_10124910	All Organisms → cellular organisms → Bacteria	1223	Open in IMG/M
3300032397\|Ga0315287_12623675	All Organisms → cellular organisms → Bacteria	538	Open in IMG/M
3300032782\|Ga0335082_11341899	All Organisms → cellular organisms → Bacteria	584	Open in IMG/M
3300033432\|Ga0326729_1061277	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	576	Open in IMG/M
3300034354\|Ga0364943_0168495	Not Available	796	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	78.85%
Host-Associated	Host-Associated	21.15%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	71.15%
Plants	Host-Associated → Plants	21.15%
Aquatic	Environmental → Aquatic	7.69%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	68.27%
Rhizosphere	Host-Associated → Plants → Rhizosphere	10.58%
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.62%
Sediment	Environmental → Aquatic → Sediment	3.85%
Freshwater	Environmental → Aquatic → Freshwater	1.92%
Marine	Environmental → Aquatic → Marine	1.92%
Peat	Environmental → Terrestrial → Peat	0.96%
Cave	Environmental → Terrestrial → Cave	0.96%
Floodplain	Environmental → Terrestrial → Floodplain	0.96%
Roots	Host-Associated → Plants → Roots	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	50.00%
Loam	Environmental → Terrestrial → Soil → Loam	10.58%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.65%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.73%
Sand	Environmental → Terrestrial → Soil → Sand	4.81%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.85%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.85%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.88%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.92%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.96%
Lake	Environmental → Aquatic → Freshwater → Lake	0.96%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.96%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.96%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.96%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	29.81%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	8.65%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.65%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	7.69%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.73%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.77%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.81%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	4.81%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.85%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.88%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.92%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.92%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.96%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.96%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.96%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.96%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.96%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.96%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.96%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.96%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	9.62%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	9.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	5.77%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	4.81%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	4.81%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.85%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.85%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	3.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.85%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.88%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	2.88%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.88%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.92%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.92%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.92%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.92%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.96%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.96%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.96%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.96%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.96%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.96%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.96%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.96%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.96%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.96%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.96%
Sandy Soil	Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil	0.96%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.96%
Bio-Ooze	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze	0.96%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.96%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.96%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.96%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2065487018	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
2199352025	Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL	Environmental	Open in IMG/M
3300001139	Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005183	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1	Environmental	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005888	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103	Environmental	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)	Host-Associated	Open in IMG/M
3300009087	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009804	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40	Environmental	Open in IMG/M
3300009837	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300011442	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012906	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300014324	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1	Environmental	Open in IMG/M
3300015259	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D	Environmental	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018054	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300019458	Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG	Environmental	Open in IMG/M
3300021088	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300025558	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)	Environmental	Open in IMG/M
3300026318	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)	Environmental	Open in IMG/M
3300026320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)	Environmental	Open in IMG/M
3300026328	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)	Environmental	Open in IMG/M
3300026333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)	Environmental	Open in IMG/M
3300026371	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B	Environmental	Open in IMG/M
3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes)	Host-Associated	Open in IMG/M
3300027384	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes)	Environmental	Open in IMG/M
3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes)	Host-Associated	Open in IMG/M
3300027654	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027669	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes)	Environmental	Open in IMG/M
3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)	Host-Associated	Open in IMG/M
3300027725	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027952	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes)	Environmental	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300031229	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38	Environmental	Open in IMG/M
3300031248 (restricted)	Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031798	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300032044	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300033432	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction	Environmental	Open in IMG/M
3300034354	Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.36
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.36
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F097549

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPINP_01944830	2065487018	Soil	MADIVLGIGSSHSPMLSTPWEAFAGHADRDRGRVPEFE
deepsgr_02773760	2199352025	Soil	MAEVTLGIGTSHSPMLSTPHEALAALADLDRARLPDFAAKARASEAWIAGSLTLR
JGI10220J13317_101422561	3300001139	Soil	MAQITLGIGSSHSPMLSTPYEAFAGLGDLDRARLR
Ga0062591_1009120052	3300004643	Soil	LADIVLGIGTSHSPMLSTPHEAFAGHRERDQQRVPEFAALARER
Ga0068993_100377991	3300005183	Natural And Restored Wetlands	MAEVTLGIGSSHSPMLSTPHEAFAGLTELDRARLPDFDVKAREN
Ga0065707_106429631	3300005295	Switchgrass Rhizosphere	MAEIVLGIGTSHSPMLSTPHEAFAGHRERDQQRVPEFAALAKERAARVAPE
Ga0070662_1016541652	3300005457	Corn Rhizosphere	MADIVLGIGSSHSPMLSTPWEAFAGHADRDRARVPEFEALAGAK
Ga0070681_112530641	3300005458	Corn Rhizosphere	MAQLTLGIGSSHSPMLSTPHEAFDGLGDLDRTRLPEFAAKARESAAWIG
Ga0070699_1002208721	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	MAEVAFGIGSSHSPMLSTPYEAFSGLADLDRARLPEFEEKARRNVSWTA
Ga0070699_1019181972	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	MAEVTLGIGTSHSPMLSTPHEALAALADLDRARLPDFAAKARASAGWID
Ga0070664_1010160122	3300005564	Corn Rhizosphere	VAQVALGIGTSHSPMLSTPYESFAALGELDRTRLP*
Ga0066905_1001551833	3300005713	Tropical Forest Soil	MADIVLGIGTSHSPMLSTPHEAFAGHRERDQQRVPEFAALVRERAERVAPELAPAV
Ga0066905_1006454681	3300005713	Tropical Forest Soil	MAEVTLGIGTSHSPMLSTPYEAFAGLGDFDRARLPDFAAKAHENAART
Ga0066905_1017178512	3300005713	Tropical Forest Soil	MAQITLGIGSSHSPMLSTPYEAFAGLGDLDRARLPEFPAKARESAGWID
Ga0066903_1022300681	3300005764	Tropical Forest Soil	MAEVTLGIGTSHSPMLSTPHEALAGLADLDRARLPEF
Ga0068860_1005837052	3300005843	Switchgrass Rhizosphere	MAEVTLGIGTSHSPMLSTPHEALAALADLDRARLPDFAAKARASEAWI
Ga0068860_1013334091	3300005843	Switchgrass Rhizosphere	MADIVLGIGSSHSPMLSTPWEAFAGHADRDRGRVPEFEALARDKA
Ga0075289_10850492	3300005888	Rice Paddy Soil	MAQVTLGIGSSHSPMLSTPYEAFAGLGELDRGRLPEFAAKAR
Ga0075024_1005465491	3300006047	Watersheds	MAQVTLGIGSSHSPMLSTPHEAFAGLGDLDRARLPEFAARARE
Ga0097621_1011653762	3300006237	Miscanthus Rhizosphere	MAQVALGIGTSHSPMLSTPYESFAALGELDRTRLP
Ga0066665_116817931	3300006796	Soil	MAEVTLGIGTSHSPMLSTPHEALAALADLDRARLPDFAAKARASEAW
Ga0075434_1003588421	3300006871	Populus Rhizosphere	MAEVTLGIGTSHSPMLSTPHEALTGLAELDRARLPEFAARARESA
Ga0075424_1000469684	3300006904	Populus Rhizosphere	MAEVTLGIGTSHSPMLSTPHEALTGLAELDRARLPEFAARARESAG
Ga0075424_1024782032	3300006904	Populus Rhizosphere	MAQITLGIGSSHSPMLSTPHEALGALADLDRARLP
Ga0075436_1001077161	3300006914	Populus Rhizosphere	MAEVTLGIGTSHSPMLSTPHEALAGLAELDRARLPEFAARARESA
Ga0097620_1010541561	3300006931	Switchgrass Rhizosphere	MADIVLGIGTSHSPMLSTPHEAFAGHRERDQQRVPQFAALARDNAAR
Ga0105107_111340381	3300009087	Freshwater Sediment	MAEVTLGIGSSHSPMLSTPHEAFTGLADLDRARLPEFAEKARENAKWIGR
Ga0114129_124807491	3300009147	Populus Rhizosphere	MAEIVLGIGTSHSPMLSTPHEAFAGHRERDQQRVPEFAALAKERAARVAPEL
Ga0126374_108449902	3300009792	Tropical Forest Soil	MADIVLGIGTSHSPMLSTPHEAFAGHRERDQQRVPEFAALARERAARVAPELAPA
Ga0105063_10482682	3300009804	Groundwater Sand	MAEVAFGIGSSHSPMLSTPYEAFSGLADLDRARLPEFEEKA
Ga0105058_11063891	3300009837	Groundwater Sand	MGEVTLGIGTSHSPMLSTPPEALAGLGDLDRGRLAEFARKARENASW
Ga0126373_102495082	3300010048	Tropical Forest Soil	MAEVTLGIGTSHSPMLSTPHEALSGLADLDRARLPEFAARAGES
Ga0126373_125732021	3300010048	Tropical Forest Soil	MAEITLGIGTSHSPMLSTPPEALTGLGDLDRERLPE
Ga0099796_100830782	3300010159	Vadose Zone Soil	MAQITLGIGSSHSPMLSTPYEAFAGLGNLDRARLPDFAARARE
Ga0134064_102746131	3300010325	Grasslands Soil	MAEITLGIGTSHSPMLSTPPEALAGLGDLDRGRLAEFAGKARENAAWI
Ga0126370_102641641	3300010358	Tropical Forest Soil	MAEVTLGIGTSHSPMLSTPHEALAGLADLDRTRLPEFAA
Ga0126370_112702432	3300010358	Tropical Forest Soil	MAEVTLGIGTSHSPMLSTPHEAFAQLADLDRARLP
Ga0126376_114087381	3300010359	Tropical Forest Soil	MAEVTLGIGTSHSPMLSTPHEALAVLADLDRARLPE
Ga0126379_112579162	3300010366	Tropical Forest Soil	MAEVTLGIGTSHSPMLSTPHEALAGLADLDRARLPEFAARARESAGWIE
Ga0134124_105389892	3300010397	Terrestrial Soil	MADIVLGIGSSHSPMLSTPWEAFAGHADRDRGRVPEFEAL
Ga0134122_100024551	3300010400	Terrestrial Soil	MAQVALGIGTSHSPMLSTPYESFAALGELDRTRLPEFAVMAGRNRSR
Ga0134122_104081701	3300010400	Terrestrial Soil	MADIVLGIGSSHSPMLSTPWEAFAGHADRDRARVPDFEALARDKAAWIGREL
Ga0137391_114607001	3300011270	Vadose Zone Soil	MAEVTLGIGSSHSPMLSAPHEALAQLGELDRGRLPEFAAKTRE
Ga0137393_103163422	3300011271	Vadose Zone Soil	MAEITLGIGTSHSPMLSTPHEALAGLGDLDRGRLAEFAGK
Ga0137437_13447202	3300011442	Soil	MAEVTLGIGTSHSPMLSTPHEAFAGLAELDRARLPEFDVKARES
Ga0137388_115548242	3300012189	Vadose Zone Soil	MAEVTLGIGTSHSPMLSTPHEAFDRLGELDRVLLP*
Ga0137376_110248861	3300012208	Vadose Zone Soil	MAEVTLGIGTSHSPMLSTPHEAFDRLGELDRGRLPEFAAKARENA
Ga0137372_109386031	3300012350	Vadose Zone Soil	MAEITLGIGTSHSPMLSTPPEALAGLGDLDRGRLAEFAGKARENAAW
Ga0137361_100106881	3300012362	Vadose Zone Soil	MAEVTLGIGTSHSPMLSTPHEAFDRLGELDRGRLPEFAAKA
Ga0137390_117828172	3300012363	Vadose Zone Soil	MAEITLGIGTSHSPMLSTPHEAFDRLGELDRGRLPEFAAKARE
Ga0157295_102929141	3300012906	Soil	MAQITLGIGSSHSPMLSTPYEAFAGLGDLDRARLREFAAKA
Ga0137404_102322692	3300012929	Vadose Zone Soil	MAEVTLGIGTSHSPMLSTPHEAFDRLGELDRGRLPEFSAKARENAS*
Ga0126375_110700732	3300012948	Tropical Forest Soil	MAEVTLGIGTSHSPMLSTPYEAFAGLGDLDRARLPDFAAKVHENGARTGRE
Ga0164299_101041423	3300012958	Soil	MAQVALGIGTSHSPMLSTPYESFAALGELDRTRLPE
Ga0126369_121069462	3300012971	Tropical Forest Soil	MAEVTLGIGTSHSPMLSTPYEALAGLADLDRARLP
Ga0126369_122011411	3300012971	Tropical Forest Soil	MAEIVLAIGSSHSPMLSTPHEGFAGHADRDRSRVPNFDALARDKAGWIGRELAP
Ga0157371_100479891	3300013102	Corn Rhizosphere	LADIVLGIGTSHSPMLSTPHEAFAGHRERDQQRVPEFAALARERAA
Ga0075352_11016772	3300014324	Natural And Restored Wetlands	MAEVTLGIGSSHSPMLSTPHEAFAGLTELDRARLPEF
Ga0180085_10254321	3300015259	Soil	MAEVTLGLGSSHSPMLSTPHEAFAGLGDLDRARLPEFAARAHESAAWI
Ga0132255_1022925622	3300015374	Arabidopsis Rhizosphere	MAQVALGIGTSHSPMLSTPYESFAALGELDRTRLPEFAV
Ga0184621_102075062	3300018054	Groundwater Sediment	MAEVTLGIGSSHSPMLSTPHEAFAGLADMDRARLSEFAAKAR
Ga0190265_110367703	3300018422	Soil	MAEVTLGIGSSHSPMLSTPYEAFAGLAELDRGRLP
Ga0187892_100236057	3300019458	Bio-Ooze	MAEVALGIGTSHSPMLSTPYEAFAGLAELDRARLPEFDEKARVHASRI
Ga0210404_107894662	3300021088	Soil	MAEIILGIGSSHSPMLSTPHEAFAGHAERDRARVGDFDALARGKA
Ga0182009_100344452	3300021445	Soil	VAQVALGIGTSHSPMLSTPYESFAALGELDRTRLP
Ga0210139_10137522	3300025558	Natural And Restored Wetlands	MAEVTLGIGTSHSPMLSTPHEAFAGLADLDRARLPDFDAKARENAPWI
Ga0207663_110329192	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MAEVTLGIGTSHSPMLSTPHEALAALADLDRARLPDF
Ga0207659_110295382	3300025926	Miscanthus Rhizosphere	MAQVALGIGTSHSPMLSTPYESFAALGELDRTRLPEFAVMA
Ga0207690_100053919	3300025932	Corn Rhizosphere	MAQVALGIGTSHSPMLSTPYESFAALGELDRTRLPEFAVMAGRNRSRV
Ga0207686_110615842	3300025934	Miscanthus Rhizosphere	MAEVTLGIGTSHSPMLSTPHEALAALADLDRARLPDFAAK
Ga0207640_114828321	3300025981	Corn Rhizosphere	MADIVLGIGSSHSPMLSTPWEAFAGHADRDRARVPEFEALAGAKAAWIGRELGP
Ga0207639_113531341	3300026041	Corn Rhizosphere	MAEVTLGIGTSHSPMLSTPHEALAALADLDRARLPDFAAKA
Ga0207708_115631391	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MAQITLGIGSSHSPMLSTPYKAFAGLGDLDRARLREFA
Ga0209240_10976341	3300026304	Grasslands Soil	MAQVTLGIGSSHSPMLSTPYEAFAGLGDLDRARLPEFAAKARASA
Ga0209471_10499993	3300026318	Soil	MAEITLGIGTSHSPMLSTPPEALAGLGDLDRGRLAEF
Ga0209131_11784321	3300026320	Grasslands Soil	MAQITLGIGSSHSPMLSTPYEAFAGLGNLDRARLPDFAARARESATWIG
Ga0209802_10589022	3300026328	Soil	MAEITLGIGTSHSPMLSTPPEALAGLGDLDRGRLAEFA
Ga0209158_11989722	3300026333	Soil	MAQVTLGIGSSHSPMLSTPYEAFAGLGDLDRARLPEFAAKARAS
Ga0257179_10376771	3300026371	Soil	MAEVALGIGTSHSPMLSTPYEAFAGLAELDRARLPEFDEKVRE
Ga0209969_10243772	3300027360	Arabidopsis Thaliana Rhizosphere	MAQITLGIGSSHSPMLSTPYEAFAGLGDLDRARLREFAAKAREC
Ga0209854_10983172	3300027384	Groundwater Sand	MAEVALGIGSSHSPMLSTPYEVFSGLADLDRVRLPEFEEKARQNVSWTARELRQD
Ga0209970_10302891	3300027614	Arabidopsis Thaliana Rhizosphere	MAQITLGIGSSHSPMLSTPYEAFAGLGDLDRARLREFAAK
Ga0209799_10427141	3300027654	Tropical Forest Soil	MAEVTLGIGTSHSPMLSTPHEALAGLADLDRARLPEFAAKSREN
Ga0208981_11415411	3300027669	Forest Soil	MAQITLGIGSSHSPMLSTPHEAFAGLGDLDRARLPEFAAKARECAAW
Ga0209966_11660522	3300027695	Arabidopsis Thaliana Rhizosphere	LADIVLGIGTSHSPMLSTPHEAFAGHRERDQQRVPEFAALARE
Ga0209178_10200531	3300027725	Agricultural Soil	MAQVALGIGTSHSPMLSTPYESFAALGELDRTRLPEFAVMAGRNRSRVA
Ga0209180_103532873	3300027846	Vadose Zone Soil	MAEVTLGIGTSHSPMLSTPHEAFAQLADLDRARLPDYAAK
Ga0209889_10116484	3300027952	Groundwater Sand	MAEVAFGIGSSHSPMLSTPYEAFSGLADLDRARLPEFEEKARQN
Ga0268264_106319292	3300028381	Switchgrass Rhizosphere	MADIVLGIGSSHSPMLSTPWEAFAGHADRDRGRVPEFEALARDKAAWIDRELDPH
Ga0247828_102522672	3300028587	Soil	MADIVLGIGSSHSPMLSTPWEAFAGHADRDRARVPEFEALAGAKASH
Ga0307312_108313952	3300028828	Soil	MAQITLGIGSSHSPMLSTPHEAFAGLGDLDRARLPE
Ga0299913_117788421	3300031229	Soil	MAQISLGVGSSHSPMLSTPHEAFGGHADRDRARVPAFARLARDKAGWIDREL
(restricted) Ga0255312_10295291	3300031248	Sandy Soil	MAEVTLGIGSSHSPMLSTPHEAFAGLGDLDRARLPEFA
Ga0307469_108110562	3300031720	Hardwood Forest Soil	MAEIILGIGSSHSPMLSTPHEAFAGHAERDRARVGDF
Ga0307468_1005853923	3300031740	Hardwood Forest Soil	MAEVTLGIGSSHSPMLSTPYEAFAGLGDLDRARLPEFAARARESAAW
Ga0307468_1013877491	3300031740	Hardwood Forest Soil	MAEIVLGIGTSHSPMLSTPHEDFAGHADRDRARVPQFEALAREN
Ga0318523_100595901	3300031798	Soil	MAEVTLGIGTSHSPMLSTPHEALAGLADLDRARLPE
Ga0307473_100330582	3300031820	Hardwood Forest Soil	MAEVTLGIGTSHSPMLSTPHEALAALADLDRARLPDFAAKARASEAWID
Ga0307473_108997732	3300031820	Hardwood Forest Soil	MAEIILGIGSSHSPMLSTPHEAFAGHAERDRARVGDFDALARGKAAWIGREL
Ga0318558_101249101	3300032044	Soil	MAEVTLGIGTSHSPMLSTPHEALAGLADLDRARLPEFAARARESAGW
Ga0315287_126236751	3300032397	Sediment	MANIVLGIGSSHSPMLSTPWEAFAGHADRDRARVPDF
Ga0335082_113418991	3300032782	Soil	MAQVTLGMGSSHSPMLSTPYEAFAGLADLDRARLPDFAVKARESAGWIGR
Ga0326729_10612771	3300033432	Peat Soil	MAEVTLGIGSSHSPMLSTPYEAFAELADLDRARLPDFAVKARENAAW
Ga0364943_0168495_687_794	3300034354	Sediment	MADIVLGIGSSHSPMLSTPWDAFAGHADRDRGRVPE

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign