NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097467

Metagenome / Metatranscriptome Family F097467

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097467
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 40 residues
Representative Sequence KPFTVKLTESLEADTELVDEFCLEGEKDYERLQRSRGK
Number of Associated Samples 94
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.15 %
% of genes from short scaffolds (< 2000 bps) 93.27 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.577 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(11.539 % of family members)
Environment Ontology (ENVO) Unclassified
(49.038 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(56.731 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.24%    β-sheet: 0.00%    Coil/Unstructured: 75.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF13360PQQ_2 5.77
PF13564DoxX_2 5.77
PF08450SGL 4.81
PF07586HXXSHH 4.81
PF13620CarboxypepD_reg 2.88
PF03972MmgE_PrpD 1.92
PF07519Tannase 1.92
PF01795Methyltransf_5 1.92
PF07978NIPSNAP 1.92
PF12796Ank_2 1.92
PF03781FGE-sulfatase 1.92
PF02322Cyt_bd_oxida_II 0.96
PF027395_3_exonuc_N 0.96
PF01396zf-C4_Topoisom 0.96
PF00782DSPc 0.96
PF00689Cation_ATPase_C 0.96
PF05638T6SS_HCP 0.96
PF01850PIN 0.96
PF05163DinB 0.96
PF02720DUF222 0.96
PF01494FAD_binding_3 0.96
PF14067LssY_C 0.96
PF00135COesterase 0.96
PF00583Acetyltransf_1 0.96
PF13857Ank_5 0.96
PF08028Acyl-CoA_dh_2 0.96
PF07635PSCyt1 0.96
PF13519VWA_2 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 4.81
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 4.81
COG027516S rRNA C1402 N4-methylase RsmHTranslation, ribosomal structure and biogenesis [J] 1.92
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.92
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 1.92
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 1.92
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 0.96
COG0474Magnesium-transporting ATPase (P-type)Inorganic ion transport and metabolism [P] 0.96
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.96
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.96
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.96
COG1294Cytochrome bd-type quinol oxidase, subunit 2Energy production and conversion [C] 0.96
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.96
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.96
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.96
COG3157Type VI protein secretion system component Hcp (secreted cytotoxin)Intracellular trafficking, secretion, and vesicular transport [U] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.58 %
UnclassifiedrootN/A14.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_115253680All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300000956|JGI10216J12902_116889093All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300001686|C688J18823_10613104All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300005293|Ga0065715_10915365All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300005332|Ga0066388_101201532All Organisms → cellular organisms → Bacteria1296Open in IMG/M
3300005345|Ga0070692_11343963All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005353|Ga0070669_100412593All Organisms → cellular organisms → Bacteria1107Open in IMG/M
3300005355|Ga0070671_101874865All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium533Open in IMG/M
3300005364|Ga0070673_101403667Not Available657Open in IMG/M
3300005436|Ga0070713_102242789All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300005441|Ga0070700_101456731All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300005459|Ga0068867_101076300Not Available733Open in IMG/M
3300005471|Ga0070698_101412380All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300005552|Ga0066701_10776947All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium571Open in IMG/M
3300005617|Ga0068859_102136097All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300005718|Ga0068866_10075066All Organisms → cellular organisms → Bacteria → Acidobacteria1799Open in IMG/M
3300005719|Ga0068861_100667949All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300005719|Ga0068861_101585061All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300005841|Ga0068863_100485206All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1216Open in IMG/M
3300005841|Ga0068863_101983911All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium592Open in IMG/M
3300005844|Ga0068862_102539402All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300006354|Ga0075021_10578189Not Available716Open in IMG/M
3300006871|Ga0075434_100615677All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300006969|Ga0075419_10688699All Organisms → cellular organisms → Bacteria → Acidobacteria724Open in IMG/M
3300009012|Ga0066710_104455819All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300009162|Ga0075423_11344585All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium764Open in IMG/M
3300009177|Ga0105248_13271829All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300009553|Ga0105249_10599333All Organisms → cellular organisms → Bacteria → Acidobacteria1156Open in IMG/M
3300010043|Ga0126380_10477144All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium951Open in IMG/M
3300010043|Ga0126380_10891721All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium738Open in IMG/M
3300010046|Ga0126384_11978566All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300010323|Ga0134086_10477187All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300010375|Ga0105239_10974024All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium975Open in IMG/M
3300010399|Ga0134127_13521692All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300011333|Ga0127502_10332100Not Available699Open in IMG/M
3300011440|Ga0137433_1270711All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300011444|Ga0137463_1275613All Organisms → cellular organisms → Bacteria → Acidobacteria622Open in IMG/M
3300012189|Ga0137388_10676172All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300012203|Ga0137399_11689400All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300012212|Ga0150985_113010790All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300012883|Ga0157281_1041780All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300012904|Ga0157282_10055876Not Available981Open in IMG/M
3300012905|Ga0157296_10240904Not Available601Open in IMG/M
3300012906|Ga0157295_10091394All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300012922|Ga0137394_10496081All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1037Open in IMG/M
3300012922|Ga0137394_10518558All Organisms → cellular organisms → Bacteria → Acidobacteria1012Open in IMG/M
3300012931|Ga0153915_10750213All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1129Open in IMG/M
3300012948|Ga0126375_11343411All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300012951|Ga0164300_10754167All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium597Open in IMG/M
3300012976|Ga0134076_10162953All Organisms → cellular organisms → Bacteria → Acidobacteria919Open in IMG/M
3300013100|Ga0157373_11258048All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300013297|Ga0157378_11426823All Organisms → cellular organisms → Bacteria → Acidobacteria736Open in IMG/M
3300013307|Ga0157372_13375110All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300014325|Ga0163163_10587992All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1176Open in IMG/M
3300014325|Ga0163163_11582702All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300014326|Ga0157380_10838144All Organisms → cellular organisms → Bacteria → Acidobacteria940Open in IMG/M
3300014969|Ga0157376_13001805All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300015371|Ga0132258_10668721All Organisms → cellular organisms → Bacteria2613Open in IMG/M
3300015374|Ga0132255_105891196All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300018060|Ga0187765_10558226Not Available733Open in IMG/M
3300018468|Ga0066662_11121667All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300018476|Ga0190274_11215863Not Available838Open in IMG/M
3300018476|Ga0190274_12856258Not Available579Open in IMG/M
3300018482|Ga0066669_12205692Not Available523Open in IMG/M
3300021080|Ga0210382_10526621All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300021445|Ga0182009_10356330All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300022718|Ga0242675_1083265All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300025165|Ga0209108_10020896All Organisms → cellular organisms → Bacteria3702Open in IMG/M
3300025920|Ga0207649_10618324Not Available834Open in IMG/M
3300025924|Ga0207694_11308743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales613Open in IMG/M
3300025926|Ga0207659_11044049All Organisms → cellular organisms → Bacteria → Acidobacteria703Open in IMG/M
3300025927|Ga0207687_10448771All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1069Open in IMG/M
3300025928|Ga0207700_11990012All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium508Open in IMG/M
3300025930|Ga0207701_10186206All Organisms → cellular organisms → Bacteria → Acidobacteria1829Open in IMG/M
3300025934|Ga0207686_10045180All Organisms → cellular organisms → Bacteria2709Open in IMG/M
3300025936|Ga0207670_11469985Not Available579Open in IMG/M
3300025938|Ga0207704_11228106Not Available640Open in IMG/M
3300025938|Ga0207704_11772715All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300025942|Ga0207689_10190623All Organisms → cellular organisms → Bacteria1691Open in IMG/M
3300025945|Ga0207679_10313935All Organisms → cellular organisms → Bacteria → Acidobacteria1355Open in IMG/M
3300026088|Ga0207641_11911214All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium595Open in IMG/M
3300026088|Ga0207641_11937261All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300026095|Ga0207676_10065311All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2897Open in IMG/M
3300026095|Ga0207676_10121546All Organisms → cellular organisms → Bacteria2203Open in IMG/M
3300026118|Ga0207675_100788136All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300026296|Ga0209235_1166090All Organisms → cellular organisms → Bacteria → Acidobacteria844Open in IMG/M
3300027695|Ga0209966_1007587Not Available1906Open in IMG/M
3300028379|Ga0268266_10475339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Altererythrobacter → unclassified Altererythrobacter → Altererythrobacter sp. Root6721191Open in IMG/M
3300031226|Ga0307497_10698998All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium523Open in IMG/M
3300031545|Ga0318541_10813778All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300031720|Ga0307469_11154562All Organisms → cellular organisms → Bacteria → Acidobacteria730Open in IMG/M
3300031858|Ga0310892_10683980All Organisms → cellular organisms → Bacteria → Acidobacteria702Open in IMG/M
3300031995|Ga0307409_102799374All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300032000|Ga0310903_10352646All Organisms → cellular organisms → Bacteria → Acidobacteria738Open in IMG/M
3300032017|Ga0310899_10003229All Organisms → cellular organisms → Bacteria4291Open in IMG/M
3300032039|Ga0318559_10524885All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300032075|Ga0310890_10409075All Organisms → cellular organisms → Bacteria → Acidobacteria1009Open in IMG/M
3300032122|Ga0310895_10681797All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300032180|Ga0307471_104115615All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium514Open in IMG/M
3300032261|Ga0306920_100535186All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1737Open in IMG/M
3300033407|Ga0214472_10446295All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1208Open in IMG/M
3300033413|Ga0316603_10673547All Organisms → cellular organisms → Bacteria → Acidobacteria965Open in IMG/M
3300033475|Ga0310811_11357934All Organisms → cellular organisms → Bacteria555Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere11.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.81%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.88%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.92%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.92%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.96%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.96%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.96%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.96%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011333Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_11525368023300000956SoilYTRPFTVNLTQNLEADTELVDEFCLEGESDYERLQRSRGK*
JGI10216J12902_11688909323300000956SoilPFTVKQMEYFEPDTELIDEFCVENEKSYERMLRSRGFEQQ*
C688J18823_1061310433300001686SoilTVRQTEYFELDTELIDEFCIENEKSYERMQRSRGQ*
Ga0065715_1091536513300005293Miscanthus RhizosphereKVYTRPFTVNLTQNLEADTELVDEFCLEGENDYERLQRSRGK*
Ga0066388_10120153223300005332Tropical Forest SoilMRRCTRSSFTANLTKSLEADTDLIDEFCLEGEKDYERLQRLRGK*
Ga0070692_1134396313300005345Corn, Switchgrass And Miscanthus RhizosphereYTKPFTVKQTEYLETDTELIEEFCIENEKSYDRMLRSRELEKK*
Ga0070669_10041259333300005353Switchgrass RhizosphereYTRPFTVTLAQDFEPDTDLVDEFCLEGENSYQRMIRSRGK*
Ga0070671_10187486513300005355Switchgrass RhizospherePKTYTKPFTVKLTQLIELDTELVDEICAEGEQSYARMIRSRGK*
Ga0070673_10140366723300005364Switchgrass RhizospherePFTVKQTEYLEVDTELIEEFCVENEKSFERMQRSREFDKK*
Ga0070713_10224278913300005436Corn, Switchgrass And Miscanthus RhizosphereKVYTKPFTVTLNDTFEADTELVDEICLEGEKDYDRLQRSRGK*
Ga0070700_10145673113300005441Corn, Switchgrass And Miscanthus RhizosphereTIDDPKVYTRPFTVNLTQNLEADTELVDEFCLEGEKDYERLQRSREK*
Ga0068867_10107630013300005459Miscanthus RhizosphereDPKNYTKPFTVKLAQDIEPDTELVDEFCLEAENSYQRMIRSRGK*
Ga0070698_10141238013300005471Corn, Switchgrass And Miscanthus RhizosphereKNYTKPFTVKLAQDIEPDTELVDEFCLEGENSYQRMIRSRGK*
Ga0066701_1077694713300005552SoilVNLTESLEADTDLIDEFCLEGEKDYDRLQRLRGK*
Ga0068859_10213609713300005617Switchgrass RhizosphereVKLTQLIELDTELVDEFCLEGEQSYERMIRSRGK*
Ga0068864_10047517233300005618Switchgrass RhizosphereVSMRQGIELDTELVDEVCLENEKSYARMQQTRGK*
Ga0068866_1007506613300005718Miscanthus RhizosphereDPKNYTRPFTVNLTQSLEADTELVDEFCLEGEKDYDRLQRSRGK*
Ga0068861_10066794913300005719Switchgrass RhizosphereIDDPKHYSKPFTVKLTQVIELDTELVDEFCLEGEQSYERMLKSRGK*
Ga0068861_10158506123300005719Switchgrass RhizospherePFTVNLTQNLEVDTDLIDEFCLENEKSYDRMQRSRGK*
Ga0068863_10048520613300005841Switchgrass RhizosphereDDPKTYTRPFTVKLTQLIELDTELVDEFCLEGEQSHERMLRSRGK*
Ga0068863_10198391123300005841Switchgrass RhizosphereTIDDPKVYTRPFTVNLTQSLEADTELVDEFCLEGEKDYDRLQRSRGK*
Ga0068862_10253940223300005844Switchgrass RhizosphereKVYTKPFTVTLTESLEADTDLSDEFCLEGEKDYDRLQRSRGK*
Ga0075021_1057818923300006354WatershedsPFTVKLTDTLEADTELVDEFCLEGEKDYERLQRSRAK*
Ga0075434_10061567743300006871Populus RhizosphereIELTIDDPKVYTKLFTVNLTESLEADTDLVDEFCLEGEKDYERLQRSRGK*
Ga0075419_1068869913300006969Populus RhizosphereKPFTVNLSQHIELDTELVDEFCLENEKSYERMQRSRGLE*
Ga0066710_10445581923300009012Grasslands SoilVYTKPFTVTLTESLEADTELVDEFCLEGERDYERLQRSRGT
Ga0075423_1134458513300009162Populus RhizosphereKVYTKPFTVTLTENLEADTDLSDEFCLEGEKDYDRLQRSRDK*
Ga0105248_1327182913300009177Switchgrass RhizosphereKTYTRPFTVNLTQTIEPDTELVDEFCLEGEQDYERLQRSRGK*
Ga0105249_1059933313300009553Switchgrass RhizosphereFTVNLKDSLEPDTELVDEFCLEGEKDYERLQRSRAK*
Ga0126380_1047714423300010043Tropical Forest SoilYTKPFTVNLTESLEADTDLVDEFCLEGEKDYERLQRSRSK*
Ga0126380_1089172123300010043Tropical Forest SoilKPFTVNLVQTLEADTELVDEFCLENEKSYERMQRSRGK*
Ga0126384_1197856613300010046Tropical Forest SoilYTKPFTVNLTESLEADTDLVDEFCLEGEKDYDRLQRSRGK*
Ga0134086_1047718713300010323Grasslands SoilPKVYTKPFTVNLTENLEADTELVDEFCLEGEKDYERLQRSRGR*
Ga0105239_1097402413300010375Corn RhizospherePFTVTLNETIEPDTELADEFCAEGEKDYERLQRSRGK*
Ga0134127_1352169213300010399Terrestrial SoilDPKNYTSPFTVKLAQDLEPDTELVDEFCAEGENSYQRMIRSRGK*
Ga0127502_1033210013300011333SoilKNYTKPFTVQLTQLIELDTELVDEICLEGEQSYERMIRSRGK*
Ga0137433_127071123300011440SoilFTVKLAQNFSPDMEFIDEFCLENEKSYDRMIRSRGK*
Ga0137463_127561323300011444SoilRICQQRVIEINTELIDECCLENEKSYQRMQTTRGK*
Ga0137388_1067617213300012189Vadose Zone SoilVNLTESLEADTELVDEFCLEGEKDYERLQRSRGK*
Ga0137399_1168940013300012203Vadose Zone SoilVNLTQNLEADTELVDEFCLEGEKDYERLQRSRGK*
Ga0150985_11301079013300012212Avena Fatua RhizosphereKVYTKPFTVKQTEYLEVDTDLIEEFCVENEKSYDRMQRSREFDNAK*
Ga0157281_104178013300012883SoilDPKHYSKPFTVKLTQVIELDTELVDEFCLEGEQSYERMLRSRGK*
Ga0157282_1005587613300012904SoilPKVYTKPFTVKLTQSIELDTELVDEICAEGEQSYERMIRSRGK*
Ga0157296_1024090433300012905SoilVKLTQSIELDTELVDEICAEGEQSYERMIRSRGK*
Ga0157295_1009139413300012906SoilTVNLTQNIELDTDLIDEFCLENEKSYERMIRSRDK*
Ga0137394_1049608113300012922Vadose Zone SoilVTLNETLEADTELADEVCAEGEKDYERLQRSRAK*
Ga0137394_1051855813300012922Vadose Zone SoilTTRTCESLEADTELVDEFCLEGEKDYERLQRIRGK*
Ga0153915_1075021333300012931Freshwater WetlandsKPFTVKLTESLEADTELVDEFCLEGEKDYERLQRSRGK*
Ga0126375_1134341123300012948Tropical Forest SoilVNLTESLEADTDLIDEFCLEGEKDYERLQRSRGK*
Ga0164300_1075416723300012951SoilFTVNLTQSLEADTELVDEFCLEGEKDYDRLQRSRGK*
Ga0134076_1016295323300012976Grasslands SoilVYTKPFTVNLTESLEADTDLIDEFCLEGEKDYEPLQQLRGK*
Ga0157373_1125804813300013100Corn RhizosphereFTVKQTEYLEVDTELIEEFCVENEKSYERMQRSREFDKK*
Ga0157378_1142682323300013297Miscanthus RhizosphereTVRMDQIIELDTELIDEFCLENEKSYDRMQRSRGK*
Ga0157372_1337511023300013307Corn RhizosphereLTIDDPKNYTRPFTVMLTDTFEPDTELVDEFCLEGEKDYQRLQESRGK*
Ga0163163_1058799213300014325Switchgrass RhizosphereVYTKPFTVKLTQSIELDTELVDEICAEGEQSYERMIRSRGK*
Ga0163163_1158270223300014325Switchgrass RhizosphereIEDPKVYTKAFTVNLTQTLEADTELVDEFCLEGEKDYERLQRSRGK*
Ga0157380_1083814423300014326Switchgrass RhizosphereVRMDQVIELDTDLIDEFCLENEKSYERMQRSRGK*
Ga0157376_1300180513300014969Miscanthus RhizosphereKVYTRPFTVMLTQTIEPDTELVDEFCLEGEKDFELLQRGRGK*
Ga0132258_1066872113300015371Arabidopsis RhizosphereDPKTYTRPFTVKLTQLIELNTELVDEFCLEGEQSHERMIRSRGK*
Ga0132255_10589119623300015374Arabidopsis RhizosphereDDPKVYTRPFTVTLNESLEADTELIDEFCLEGEKDYERLQRSRGK*
Ga0187765_1055822623300018060Tropical PeatlandYTKPFTVNLVQTLEADTELADEFCLENEKSYDRMQRSRGK
Ga0066662_1112166713300018468Grasslands SoilTVNLTQNLDADTELVDEFCLEGEKDYERLQRSRGK
Ga0190274_1121586313300018476SoilVYTKPFTVKLTQLIELDTELVDEICAEGEQSYERMIRSRGK
Ga0190274_1285625813300018476SoilKVYTKPFTVKLTQLIELDTELVDEICAEGEQSYERMIRSRGK
Ga0066669_1220569223300018482Grasslands SoilDDPKVYTRPFTVNLTQSLEADTELVDEFCLEGEKDYERLQRSRGK
Ga0210382_1052662113300021080Groundwater SedimentFTVNLTQNLEADTELLDEFCLEGEKDYERLQRSRGK
Ga0182009_1035633013300021445SoilPFTVTLNDTFEADTELVDEICLEGEKDYDRLQRSRGK
Ga0242675_108326523300022718SoilVYTKPFTVKLTDNLEADTELVDEFCLEGEKDYDRLQRSRGK
Ga0209108_1002089613300025165SoilTVKLTQDFEPDTELVDEFCLEHENSYERMIRSRGK
Ga0207649_1061832423300025920Corn RhizosphereFTVKQTEYLEVDTELIEEFCVENEKSFERMQRSREFDKK
Ga0207694_1130874323300025924Corn RhizosphereTKPFTVKLTQLIELDTELVDEICAEGEQSYARMIRSRGK
Ga0207659_1104404923300025926Miscanthus RhizospherePWTVRMDQVIELDTDLIDEFCLENEKSYERMQRSRGK
Ga0207687_1044877123300025927Miscanthus RhizosphereKTYTKPFTVKLSETLEADTELVDEFCLEGEKDYERLQRSRGK
Ga0207700_1199001213300025928Corn, Switchgrass And Miscanthus RhizosphereKVYTKPFTVTLNDTFEADTELVDEICLEGEKDYDRLQRSRGK
Ga0207701_1018620613300025930Corn, Switchgrass And Miscanthus RhizosphereTKPFTISLSQHIEIDTELVDEFCLENEKSYERMQRSRGLE
Ga0207686_1004518033300025934Miscanthus RhizospherePKTYTRPFTVKLTQLIELNTELVDEFCLEGEQSYERMIRSRGK
Ga0207670_1146998523300025936Switchgrass RhizosphereTVNLTQNIELDTDLIDEFCLENEKSYERMIRSRDK
Ga0207704_1122810623300025938Miscanthus RhizosphereFTVKLAQDIEPDTELVDEFCLEAENSYQRMIRSRGK
Ga0207704_1177271523300025938Miscanthus RhizosphereKVYTRPFTVNLTQNLEADTELVDEFCLEGEKDYERLQRSRGK
Ga0207689_1019062333300025942Miscanthus RhizosphereINLSQHIELDTELVDEFCLENEKSYERMQRSRGLE
Ga0207679_1031393513300025945Corn RhizosphereTKPFTVKLSQHIELDTELVDEFCLENEKSYERMQRSRGLE
Ga0207641_1191121423300026088Switchgrass RhizosphereTVRMDQTIELDTELIDEFCLENEKSYERMIRSRTAK
Ga0207641_1193726113300026088Switchgrass RhizosphereKAFTVNLTQTLEADTELVDEFCLEGEKDYERLQRSRGK
Ga0207676_1006531113300026095Switchgrass RhizosphereYTRPFTVKLTQLIELDTELVDEFCLEGEQSYERMIRSRGK
Ga0207676_1012154643300026095Switchgrass RhizosphereKPFTVQLQQVIEPDTELVDEFCLEGENSYARMIRSRGK
Ga0207675_10078813613300026118Switchgrass RhizosphereIDDPKHYSKPFTVKLTQVIELDTELVDEFCLEGEQSYERMLKSRGK
Ga0209235_116609023300026296Grasslands SoilVYTKPFTVNLTESLEADTDLIDEFCLEGEKDYEPLQQLRGK
Ga0209966_100758743300027695Arabidopsis Thaliana RhizosphereKPFTVSLSQHIELDTELVDEFCLENEKSYERMQRSRGLE
Ga0268266_1047533933300028379Switchgrass RhizosphereKPFTVKLSDTLEADTELVDEFCLEGEKDYDRLQRSRGK
Ga0307497_1069899813300031226SoilYTKPFTVTLTEGLEPDTELADEVCAEGEKDYERLQRSRGK
Ga0318541_1081377823300031545SoilTKPFTVTLSEQLEADTEIVDEFCAEGEKDYERLQRSRGK
Ga0307469_1115456223300031720Hardwood Forest SoilPFTVTLTDTLEADTELVDEFCLEGEKDYDRLQRSRGK
Ga0310892_1068398013300031858SoilFTVKLSQHIELDTELVDEFCLENEKSYERMQRSRGLE
Ga0307409_10279937423300031995RhizospherePFTVKMSQDIEVDTEIIDEFCLENEKSYERMQRSRGK
Ga0310903_1035264613300032000SoilSRPFTVNLTQIIELDTELVDEFCLENEKSHERMIRSRGK
Ga0310899_1000322953300032017SoilTVKLSQHIELDTELVDEFCLENEKSYERMQRSRGLE
Ga0318559_1052488523300032039SoilTSPFTVNLGLTLEVDTELVDEFCLEGEKSYERMLRSRGK
Ga0310890_1040907513300032075SoilRPFTVNLTQNIELDTELVDEFCLENEKSHERMIRSRGK
Ga0310895_1068179713300032122SoilTKPFTVSLSQHLELDTELVDEFCLENEKSYERMQRSRGLE
Ga0307471_10411561523300032180Hardwood Forest SoilKPFTVTLNESLEPDTELVDEFCAEGEKDYERLQRSRGK
Ga0306920_10053518613300032261SoilSPFTVNLGLTLEVDTELVDEFCLEGEKSYERMLRSRGK
Ga0214472_1044629523300033407SoilTNYTEPFTVTLAQDFEPDTELVDEFCLENEKSYDRMIRSRDKDK
Ga0316603_1067354723300033413SoilPFTVKLTQDFEPDTELVDEFCLENENSYERMIRSRGK
Ga0310811_1135793423300033475SoilDDPKVYTKPFTVKLTDSLETDTDLVDEFCLEGERDYERLQRSRGK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.