| Basic Information | |
|---|---|
| Family ID | F097462 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 49 residues |
| Representative Sequence | IDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 8.65 % |
| % of genes near scaffold ends (potentially truncated) | 87.50 % |
| % of genes from short scaffolds (< 2000 bps) | 90.38 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.115 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (7.692 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.269 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.538 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 6.85% β-sheet: 0.00% Coil/Unstructured: 93.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF13620 | CarboxypepD_reg | 33.65 |
| PF03992 | ABM | 4.81 |
| PF13517 | FG-GAP_3 | 4.81 |
| PF00069 | Pkinase | 2.88 |
| PF06580 | His_kinase | 1.92 |
| PF13551 | HTH_29 | 0.96 |
| PF13414 | TPR_11 | 0.96 |
| PF02371 | Transposase_20 | 0.96 |
| PF00581 | Rhodanese | 0.96 |
| PF07676 | PD40 | 0.96 |
| PF04143 | Sulf_transp | 0.96 |
| PF02602 | HEM4 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 11.54 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 1.92 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 1.92 |
| COG1587 | Uroporphyrinogen-III synthase | Coenzyme transport and metabolism [H] | 0.96 |
| COG2391 | Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains | General function prediction only [R] | 0.96 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.12 % |
| Unclassified | root | N/A | 2.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c0944660 | Not Available | 1526 | Open in IMG/M |
| 3300003994|Ga0055435_10259558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300005093|Ga0062594_100953368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
| 3300005295|Ga0065707_10018613 | All Organisms → cellular organisms → Bacteria | 1980 | Open in IMG/M |
| 3300005328|Ga0070676_10322552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1054 | Open in IMG/M |
| 3300005328|Ga0070676_10818109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300005334|Ga0068869_101259143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300005343|Ga0070687_100383083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 917 | Open in IMG/M |
| 3300005344|Ga0070661_100817642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300005353|Ga0070669_100038130 | All Organisms → cellular organisms → Bacteria | 3488 | Open in IMG/M |
| 3300005354|Ga0070675_100550042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1044 | Open in IMG/M |
| 3300005439|Ga0070711_100244340 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
| 3300005466|Ga0070685_10546652 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300005471|Ga0070698_100774448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 903 | Open in IMG/M |
| 3300005543|Ga0070672_100257504 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300005560|Ga0066670_10714359 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005564|Ga0070664_101931670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300005574|Ga0066694_10319152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300005719|Ga0068861_100878959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300005764|Ga0066903_100420625 | All Organisms → cellular organisms → Bacteria | 2212 | Open in IMG/M |
| 3300005764|Ga0066903_107553256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300005844|Ga0068862_100005998 | All Organisms → cellular organisms → Bacteria | 10117 | Open in IMG/M |
| 3300006354|Ga0075021_10996969 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300006844|Ga0075428_102206814 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300006846|Ga0075430_100464757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1044 | Open in IMG/M |
| 3300006847|Ga0075431_100113431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2798 | Open in IMG/M |
| 3300006852|Ga0075433_10044232 | All Organisms → cellular organisms → Bacteria | 3868 | Open in IMG/M |
| 3300006853|Ga0075420_101231075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300009098|Ga0105245_11702039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300009147|Ga0114129_12471286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300009148|Ga0105243_12670531 | Not Available | 539 | Open in IMG/M |
| 3300009157|Ga0105092_10197923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1122 | Open in IMG/M |
| 3300009174|Ga0105241_12035744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300009174|Ga0105241_12263904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300009177|Ga0105248_13138998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300010046|Ga0126384_10818253 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300010358|Ga0126370_10271259 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300010361|Ga0126378_11377523 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300010398|Ga0126383_10912407 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300010400|Ga0134122_11130335 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300011416|Ga0137422_1161997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300011439|Ga0137432_1082902 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300011441|Ga0137452_1114042 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300012208|Ga0137376_11571803 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012355|Ga0137369_10750070 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300012469|Ga0150984_101153147 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300012483|Ga0157337_1040347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300012495|Ga0157323_1018094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300012519|Ga0157352_1061218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 586 | Open in IMG/M |
| 3300012683|Ga0137398_10459251 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300012897|Ga0157285_10298179 | Not Available | 547 | Open in IMG/M |
| 3300012912|Ga0157306_10178648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300012914|Ga0157297_10179429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300012958|Ga0164299_11453125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300013306|Ga0163162_11808055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300013308|Ga0157375_12263752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300015077|Ga0173483_10189758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
| 3300015201|Ga0173478_10042997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1439 | Open in IMG/M |
| 3300015371|Ga0132258_10113910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6410 | Open in IMG/M |
| 3300015371|Ga0132258_10113988 | All Organisms → cellular organisms → Bacteria | 6408 | Open in IMG/M |
| 3300015371|Ga0132258_13183918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1133 | Open in IMG/M |
| 3300015373|Ga0132257_102502407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300015374|Ga0132255_100034411 | All Organisms → cellular organisms → Bacteria | 6454 | Open in IMG/M |
| 3300016371|Ga0182034_11191650 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300021082|Ga0210380_10058571 | All Organisms → cellular organisms → Bacteria | 1670 | Open in IMG/M |
| 3300021082|Ga0210380_10203533 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300025160|Ga0209109_10252865 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300025893|Ga0207682_10135528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1102 | Open in IMG/M |
| 3300025907|Ga0207645_10548877 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300025911|Ga0207654_10817795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300025923|Ga0207681_10348186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1185 | Open in IMG/M |
| 3300025923|Ga0207681_10810189 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300025926|Ga0207659_11392634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300025927|Ga0207687_11090932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300025930|Ga0207701_10256738 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300025930|Ga0207701_10356147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1265 | Open in IMG/M |
| 3300025930|Ga0207701_10498339 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300025936|Ga0207670_10095305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2113 | Open in IMG/M |
| 3300025936|Ga0207670_10652959 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300025938|Ga0207704_10264339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1299 | Open in IMG/M |
| 3300025938|Ga0207704_10372029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1119 | Open in IMG/M |
| 3300025942|Ga0207689_11236247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300026023|Ga0207677_11000089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300026023|Ga0207677_11052649 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300026035|Ga0207703_10051508 | All Organisms → cellular organisms → Bacteria | 3337 | Open in IMG/M |
| 3300026035|Ga0207703_10256258 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300026067|Ga0207678_11624321 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300026118|Ga0207675_100888105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 907 | Open in IMG/M |
| 3300026121|Ga0207683_11186500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300027614|Ga0209970_1112525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300027731|Ga0209592_1082560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1182 | Open in IMG/M |
| 3300027880|Ga0209481_10281356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
| 3300028812|Ga0247825_10656501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300031716|Ga0310813_12172998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300031740|Ga0307468_100269585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1212 | Open in IMG/M |
| 3300031892|Ga0310893_10552713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300031908|Ga0310900_11059046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300031940|Ga0310901_10146896 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300031943|Ga0310885_10593433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300032003|Ga0310897_10276968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300032076|Ga0306924_12552328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300032211|Ga0310896_10259848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 882 | Open in IMG/M |
| 3300033433|Ga0326726_10401272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1301 | Open in IMG/M |
| 3300033551|Ga0247830_10717872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.73% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 6.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.85% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.92% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.92% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.96% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011416 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2 | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_09446601 | 2228664021 | Soil | NVNLGHTHANIAVDVLNLANANTPTSYQQNYGDGRQYLQPLTILNPRLXRFNVTVEF |
| Ga0055435_102595582 | 3300003994 | Natural And Restored Wetlands | KRANFAVDVLNLFNANTGTAFQQNYGDGSQYLWPTAILNPRFVRFNVTVDF* |
| Ga0062594_1009533682 | 3300005093 | Soil | MGGTRVNLAADILNLTNANTPTSYQQNYGDGRQYLQPLAILNPRFVRLNVTVDF* |
| Ga0065707_100186133 | 3300005295 | Switchgrass Rhizosphere | KLLNIGGTRTNVAIDILNLFNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF* |
| Ga0070676_103225522 | 3300005328 | Miscanthus Rhizosphere | IGGTRTNVAIDILNLFNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF* |
| Ga0070676_108181091 | 3300005328 | Miscanthus Rhizosphere | KLFNIGGTRTNVAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF* |
| Ga0068869_1012591432 | 3300005334 | Miscanthus Rhizosphere | DLRVGKLLNIGGTRTNVAIDILNLFNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF* |
| Ga0070687_1003830831 | 3300005343 | Switchgrass Rhizosphere | LNLFNANTATAYQQNYGDGTQYLQPLQVLNPRFVRFNVTVDF* |
| Ga0070661_1008176421 | 3300005344 | Corn Rhizosphere | ADIAVDLVNLFNANTPTSYQQMYGDGTHYLEPLTILNPRFVRLNVTMEF* |
| Ga0070669_1000381303 | 3300005353 | Switchgrass Rhizosphere | QVDLRVGKLFNIGGTRTNVAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF* |
| Ga0070675_1005500422 | 3300005354 | Miscanthus Rhizosphere | RTNVAIDILNLFNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF* |
| Ga0070711_1002443401 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LAIDVLNLFNSNTGTMFQQNYGDGSQFLNPTQILNPRFVRFNVTVDF* |
| Ga0070685_105466522 | 3300005466 | Switchgrass Rhizosphere | GKNLTMGGTRVNLAADILNLTNANTPTSYQQNYGDGRQYLQPLAILNPRFVRLNVTVDF* |
| Ga0070698_1007744481 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | NIALDLLNLFNANTGTAFQQTFGDGSGYLAPTAILNPRFVRCNVTLDF* |
| Ga0070672_1002575042 | 3300005543 | Miscanthus Rhizosphere | MRVGKNLTMGGTRVNLAADVLNLSNANTPTSYQQNYGDGRQYLQPLAILNPRLLRLNVTVEF* |
| Ga0066670_107143592 | 3300005560 | Soil | QVDARIGKILKFGRTNTNVAIDVLNLFNSNTGTAFMQNFDANYLVPTQILNPRFVRFNVTVDF* |
| Ga0070664_1019316702 | 3300005564 | Corn Rhizosphere | KNLHIGGARASIAVDVLNVANANTPTSYQQTYGDGTQYLQPLTILNPRFARFNVTVDF* |
| Ga0066694_103191521 | 3300005574 | Soil | LTAGADRHTNIAVDLLNLFNANTGTNFQMNYGDGSGYLTPTAILNPRIVKFNVTVDF* |
| Ga0068861_1008789592 | 3300005719 | Switchgrass Rhizosphere | ANTATAYQQNYGDGTQYLQPLQVLNPRFVRFNVTVDF* |
| Ga0066903_1004206252 | 3300005764 | Tropical Forest Soil | ILNLFNSNTGTMFQQNYGDGSGYLAPTAILNPRFVRLNVTVDF* |
| Ga0066903_1075532561 | 3300005764 | Tropical Forest Soil | NTGTMFQLNYGDGSQYLNPTQILNPRFVRFNVTVDF* |
| Ga0068862_1000059981 | 3300005844 | Switchgrass Rhizosphere | IDLLNLFNANTGTMFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF* |
| Ga0075021_109969691 | 3300006354 | Watersheds | FNANTGTAFQQNYGDGPQYLNPTAILNPRFVRFNVTVDF* |
| Ga0075428_1022068141 | 3300006844 | Populus Rhizosphere | AVDLLNLFNANTPTSYQQNYGDGTQYLQPLTILNPRFVRFNVTMDF* |
| Ga0075430_1004647572 | 3300006846 | Populus Rhizosphere | VGKIFNIGGTRTNVAIDLLNLFNANTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMEF |
| Ga0075431_1001134312 | 3300006847 | Populus Rhizosphere | VAIDLLNLFNANTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMEF* |
| Ga0075433_100442321 | 3300006852 | Populus Rhizosphere | IDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF* |
| Ga0075420_1012310752 | 3300006853 | Populus Rhizosphere | VAIDLLNLFNANTGTAFEQNYGDGSQYLRPTQILNPRFVRFKVTMEF* |
| Ga0105245_117020392 | 3300009098 | Miscanthus Rhizosphere | LFNAHTPTSYQQTYGDGTQYLQPLTILNPRFARFNVTVDF* |
| Ga0114129_124712862 | 3300009147 | Populus Rhizosphere | KILRLGRYRTSLAVDFLNIFNSNTGTMFQQNYGDGTGYLVPLTILNPRLARINVTVDF* |
| Ga0105243_126705312 | 3300009148 | Miscanthus Rhizosphere | LFNANTGTAFQQTFGDGSGYLAPTAILNPRFVRCNVTLDF* |
| Ga0105092_101979232 | 3300009157 | Freshwater Sediment | LYRIRVGLVLHTNVGIDLLNLFNANTGTAFEQNGDGSQYLRPTQILNPRFVRFNVTMDF* |
| Ga0105241_120357441 | 3300009174 | Corn Rhizosphere | IDLLNLFNANTATAYQQNYGDGTQYLQPLQVLNPRFVRFNVTVDF* |
| Ga0105241_122639041 | 3300009174 | Corn Rhizosphere | RVGKLFNIGGTRTNVAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF* |
| Ga0105248_131389981 | 3300009177 | Switchgrass Rhizosphere | LFNSNTGTSFNQTYGDGTSYLRPTAILTPRFVRANVTFTF* |
| Ga0126384_108182531 | 3300010046 | Tropical Forest Soil | SNTGTAFQQNYGDGSGYLVPTAILNPRFIRFNVTVDF* |
| Ga0126370_102712591 | 3300010358 | Tropical Forest Soil | VAIDILNLFNSNTGTAFQQNYGDGSGFLAPTAILNPRFVRFNVTVDF* |
| Ga0126378_113775232 | 3300010361 | Tropical Forest Soil | DRINQVDARFGKILKFGRSSTNVAIDVLNLFNSNTGTAFQQNYGDGTGYLVPTAILNPRFVRLNVTVDF* |
| Ga0126383_109124071 | 3300010398 | Tropical Forest Soil | LFNSNTGTMFQQNYGDGSGYLAPTAILNPRFVRLNVTVDF* |
| Ga0134122_111303352 | 3300010400 | Terrestrial Soil | GSRRANIAIDVLNLFNANTGTAFTQMYGDGSTFLNPTAILNPRFVRFNVTVDF* |
| Ga0137422_11619971 | 3300011416 | Soil | NLFNANTPTSYQQTYGDGTQYLQPLSILNPRFARFNVTVDF* |
| Ga0137432_10829021 | 3300011439 | Soil | LFNANTPTSYQQTYGDGTQYLQPLSILNPRFARFNVTVDF* |
| Ga0137452_11140422 | 3300011441 | Soil | DLLNLFNANTPTSYQQTYGDGTQYLQPLSILNPRFARFNVTVDF* |
| Ga0137376_115718031 | 3300012208 | Vadose Zone Soil | NLFNANTGYQFQQNYGDGSGYLTPTMILTPRFVKFNVTVDF* |
| Ga0137369_107500702 | 3300012355 | Vadose Zone Soil | GKKRTSIAVDLLNLFNANTGYQFQQNYGDGSGYLTPTMILTPRFIKFNVTVDF* |
| Ga0150984_1011531472 | 3300012469 | Avena Fatua Rhizosphere | VNFGTKRANFAVDVLNLFNANTGTNFNQNYDANYLNPTQILNPRFVRFNVTVDF* |
| Ga0157337_10403471 | 3300012483 | Arabidopsis Rhizosphere | FNANTGTMFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF* |
| Ga0157323_10180941 | 3300012495 | Arabidopsis Rhizosphere | NTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF* |
| Ga0157352_10612182 | 3300012519 | Unplanted Soil | FNANTPTSYQQTYGDGTQFLQPLTILNPRLLRFNVTLDF* |
| Ga0137398_104592511 | 3300012683 | Vadose Zone Soil | LNLGSKRANIAIDVLNLFNSNTGTAFQQTFGTAFLNPTAILNPRFVRFNVTVDF* |
| Ga0157285_102981792 | 3300012897 | Soil | NANTPTSYQQTYGDGTQYLQPLTILNPRFARFNVTVDF* |
| Ga0157306_101786481 | 3300012912 | Soil | MRFGKNLTMGGTRVNLAADILNLTNANTPTSYQQNYGDGRQYLQPLAILNPRFVRLNVTVDF* |
| Ga0157297_101794292 | 3300012914 | Soil | GTRTNVAIDILNLFNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF* |
| Ga0164299_114531252 | 3300012958 | Soil | FNANTGTNFNQNYDANYLNPTQILNPRFVRFNMTVDF* |
| Ga0163162_118080552 | 3300013306 | Switchgrass Rhizosphere | MRFGKIVKAGRARANIGVDLLNLLNANTPTSYQQNYGVDGTQYLQPLSILSPRVLRLNVTLDF* |
| Ga0157375_122637521 | 3300013308 | Miscanthus Rhizosphere | TNVAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF* |
| Ga0173483_101897581 | 3300015077 | Soil | NTPTAYQSNFGDGSGYLAPTAILNPRLARLSVTIDF* |
| Ga0173478_100429971 | 3300015201 | Soil | DLRVGKLFNIGGTRTNVAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF* |
| Ga0132258_101139104 | 3300015371 | Arabidopsis Rhizosphere | DARFGKILNFGSKRANISIDVLNLFNANTGTAFQQNYGDGSAYLNPTQILNARFVRFNVTVDF* |
| Ga0132258_101139888 | 3300015371 | Arabidopsis Rhizosphere | NANTPTSYQQNYGDGTQYLQPLTILNPRFARFNVTLDF* |
| Ga0132258_131839182 | 3300015371 | Arabidopsis Rhizosphere | FNIGGTRTNVAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF* |
| Ga0132257_1025024071 | 3300015373 | Arabidopsis Rhizosphere | IDVLNLFNSNTGTMFQLNYGDGTQYLNPTQILNPRFVRFNVTVDF* |
| Ga0132255_1000344111 | 3300015374 | Arabidopsis Rhizosphere | SKRANIAVDLLNLFNANTPTSYQQNYGDGTQYLQPLTILNPRFARFNVTLDF* |
| Ga0182034_111916502 | 3300016371 | Soil | DARFGKIFNFGKTRANIALDVLNLLNANTGTAFQQNYGDGSQYLNPTSILTPRILRVNVTMDF |
| Ga0210380_100585712 | 3300021082 | Groundwater Sediment | MGGTRVNLAADILNLANANTPTSYQQNYGDGRQYLQPLAILNPRFVRLNVTVDF |
| Ga0210380_102035332 | 3300021082 | Groundwater Sediment | LNLFNANTGTMFQQNYDGSTYLNPTQILNPRFVRFNVTVDF |
| Ga0209109_102528652 | 3300025160 | Soil | AVDLLNLFNANTPTAYQQNFGDGSQYLQPQTILNPRFVRFNVTVDF |
| Ga0207682_101355282 | 3300025893 | Miscanthus Rhizosphere | MGGTRVNLAADILNLTNANTPTSYQQNYGDGRQYLQPLAILNPRFVRLNVTVDF |
| Ga0207645_105488771 | 3300025907 | Miscanthus Rhizosphere | NLLNANTGTMFQQNYDGSTYLNPTQILNPRFVRFNVTVDF |
| Ga0207654_108177951 | 3300025911 | Corn Rhizosphere | RVGKLFNIGGTRTNVAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMD |
| Ga0207681_103481862 | 3300025923 | Switchgrass Rhizosphere | ILNLFNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF |
| Ga0207681_108101892 | 3300025923 | Switchgrass Rhizosphere | TYVAIDILNLFNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF |
| Ga0207659_113926341 | 3300025926 | Miscanthus Rhizosphere | TGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF |
| Ga0207687_110909321 | 3300025927 | Miscanthus Rhizosphere | WYRSSLAVDFLNIFNANTPTAYQSNFGDGSGYLATTAILNPRLARLSVTIDF |
| Ga0207701_102567381 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | TPTAYQSNFGDGSGYLAPTAILNPRLARLSVTIDF |
| Ga0207701_103561473 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | DILNLTNANTPTSYQQNYGDGRQYLQPLAILNPRFVRLNVTVDF |
| Ga0207701_104983391 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | GRARANIGVDLLNLLNANTPTSYQQNYGVDGTQYLKPLSILSPRVLRLNVTLDF |
| Ga0207670_100953051 | 3300025936 | Switchgrass Rhizosphere | LLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF |
| Ga0207670_106529592 | 3300025936 | Switchgrass Rhizosphere | VDLRVGKLFNIGGTRTNVAIDLLNLFNANTGTMFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF |
| Ga0207704_102643391 | 3300025938 | Miscanthus Rhizosphere | TNANTPTSYQQNYGDGRQYLQPLAILNPRFVRLNVTVDF |
| Ga0207704_103720291 | 3300025938 | Miscanthus Rhizosphere | KLFNIGGTRTNVAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF |
| Ga0207689_112362471 | 3300025942 | Miscanthus Rhizosphere | NLFNANTGTMFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF |
| Ga0207677_110000891 | 3300026023 | Miscanthus Rhizosphere | IDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF |
| Ga0207677_110526491 | 3300026023 | Miscanthus Rhizosphere | LFNSNTGTAFQTNYGNGSGYLAPTAILNPRLARFNVTIDF |
| Ga0207703_100515081 | 3300026035 | Switchgrass Rhizosphere | DLVTLINANTPTSYQQNYGDGTQYLQPLTILNPRFARFNVTLDF |
| Ga0207703_102562582 | 3300026035 | Switchgrass Rhizosphere | TGTAFQTNYGDGSGYLAPTAILNPRLARINVTVDF |
| Ga0207678_116243212 | 3300026067 | Corn Rhizosphere | VDVLNVGNANTPTSYQQTYGDGTQYLQPLTILNPRFARFNVTVDF |
| Ga0207675_1008881051 | 3300026118 | Switchgrass Rhizosphere | IVNLGSKRANIAIDLLNLFNANTATAYQQNYGDGTQYLQPLQVLNPRFVRFNVTVDF |
| Ga0207683_111865002 | 3300026121 | Miscanthus Rhizosphere | AIDLLNLFNANTGTMFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF |
| Ga0209970_11125251 | 3300027614 | Arabidopsis Thaliana Rhizosphere | VAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF |
| Ga0209592_10825602 | 3300027731 | Freshwater Sediment | GKLLNIGGTRTNIAIDLLNLFNSNTGTAFEQNYGDGSGYLRPTQILNPRFVRFNVTMDF |
| Ga0209481_102813561 | 3300027880 | Populus Rhizosphere | VAIDLLNLFNANTGTAFEQNYGDGSQYLRPTQILNPRFVRFKVTMEF |
| Ga0247825_106565012 | 3300028812 | Soil | MRFGKNLTMGGTRVNLAADILNLTNANTPTSYQQNYGDGRQYLQPLAILNPRFVRLNVTVDF |
| Ga0310813_121729981 | 3300031716 | Soil | NVAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF |
| Ga0307468_1002695851 | 3300031740 | Hardwood Forest Soil | DLRVGKLLNIGGTRTNVAIDILNLFNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF |
| Ga0310893_105527132 | 3300031892 | Soil | SNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF |
| Ga0310900_110590461 | 3300031908 | Soil | FNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF |
| Ga0310901_101468962 | 3300031940 | Soil | VGKLFNIGGTRTNVAIDLLNLFNANTGTMFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF |
| Ga0310885_105934331 | 3300031943 | Soil | RTNVAIDILNLFNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF |
| Ga0310897_102769682 | 3300032003 | Soil | GGTRTNVAIDLLNLFNANTGTMFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF |
| Ga0306924_125523282 | 3300032076 | Soil | RFGKIFNFGKTRANIALDVLNLLNANTGTAFQQNYGDGSQYLNPTSILTPRILRVNVTMD |
| Ga0310896_102598481 | 3300032211 | Soil | NLFNANTPTSYQQNYGDGTQYLQPLTILNPRFARFNVTLDF |
| Ga0326726_104012721 | 3300033433 | Peat Soil | NTGTAFQLNYGDGSQYLNPTQILNPRFVRFNVTVDF |
| Ga0247830_107178721 | 3300033551 | Soil | GGTRVNLAADILNLTNANTPTSYQQNYGDGRQYLQPLAILNPRFVRLNVTVDF |
| ⦗Top⦘ |