Metagenome Family F097440

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F097440
Family Type	Metagenome
Number of Sequences	104
Average Sequence Length	43 residues
Representative Sequence	MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF
Number of Associated Samples	84
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	21.36 %
% of genes near scaffold ends (potentially truncated)	95.19 %
% of genes from short scaffolds (< 2000 bps)	70.19 %
Associated GOLD sequencing projects	79
AlphaFold2 3D model prediction	No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (98.077 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (8.654 % of family members)
Environment Ontology (ENVO)	Unclassified (38.462 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (63.462 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 16.28% Coil/Unstructured: 83.72%
Feature Viewer

Powered by Feature Viewer

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF01761	DHQ_synthase	41.35
PF02880	PGM_PMM_III	24.04
PF00408	PGM_PMM_IV	14.42
PF04545	Sigma70_r4	5.77
PF04546	Sigma70_ner	2.88
PF07949	YbbR	2.88
PF01545	Cation_efflux	1.92
PF01713	Smr	1.92
PF13662	Toprim_4	0.96
PF13905	Thioredoxin_8	0.96
PF02457	DAC	0.96
PF06723	MreB_Mbl	0.96
PF02518	HATPase_c	0.96

COG ID	Name	Functional Category	% Frequency in 104 Family Scaffolds
COG0033	Phosphoglucomutase/phosphomannomutase	Carbohydrate transport and metabolism [G]	38.46
COG1109	Phosphomannomutase	Carbohydrate transport and metabolism [G]	38.46
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	2.88
COG4856	Cyclic di-AMP synthase regulator CdaR, YbbR domain	Signal transduction mechanisms [T]	2.88
COG0053	Divalent metal cation (Fe/Co/Zn/Cd) efflux pump	Inorganic ion transport and metabolism [P]	1.92
COG1230	Co/Zn/Cd efflux system component	Inorganic ion transport and metabolism [P]	1.92
COG3965	Predicted Co/Zn/Cd cation transporter, cation efflux family	Inorganic ion transport and metabolism [P]	1.92
COG1077	Cell shape-determining ATPase MreB, actin-like superfamily	Cell cycle control, cell division, chromosome partitioning [D]	0.96

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	99.04 %
Unclassified	root	N/A	0.96 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	99.04 %
Unclassified	root	N/A	0.96 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	98.08 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.96 %
Unclassified	root	N/A	0.96 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	22.12 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	12.50 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.96 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.96 %
Unclassified	root	N/A	0.96 %

Name	Rank	Taxonomy	Distribution
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	15.38 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	12.50 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	2.88 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.96 %
Candidatus Omnitrophica	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica	0.96 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.96 %
Unclassified	root	N/A	0.96 %

Name	Rank	Taxonomy	Distribution
Blastocatellales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales	15.38 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	12.50 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.88 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.96 %
Candidatus Omnitrophica	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica	0.96 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.96 %
Unclassified	root	N/A	0.96 %

Name	Rank	Taxonomy	Distribution
Pyrinomonadaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae	15.38 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	12.50 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.88 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.96 %
Candidatus Omnitrophica	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica	0.96 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.96 %
Unclassified	root	N/A	0.96 %

Name	Rank	Taxonomy	Distribution
Pyrinomonas	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas	13.46 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	12.50 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.88 %
unclassified Pyrinomonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae	1.92 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.96 %
Candidatus Omnitrophica	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica	0.96 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.96 %
Unclassified	root	N/A	0.96 %

Name	Rank	Taxonomy	Distribution
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	13.46 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	12.50 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.88 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.92 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.96 %
Candidatus Omnitrophica	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica	0.96 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.96 %
Unclassified	root	N/A	0.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002120\|C687J26616_10053486	All Organisms → cellular organisms → Bacteria	1394	Open in IMG/M
3300003324\|soilH2_10148514	All Organisms → cellular organisms → Bacteria	1443	Open in IMG/M
3300005331\|Ga0070670_100809212	All Organisms → cellular organisms → Bacteria	846	Open in IMG/M
3300005331\|Ga0070670_100838394	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	831	Open in IMG/M
3300005332\|Ga0066388_100031243	All Organisms → cellular organisms → Bacteria	5009	Open in IMG/M
3300005332\|Ga0066388_108403560	All Organisms → cellular organisms → Bacteria	514	Open in IMG/M
3300005334\|Ga0068869_101564622	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	586	Open in IMG/M
3300005335\|Ga0070666_10056837	All Organisms → cellular organisms → Bacteria	2643	Open in IMG/M
3300005336\|Ga0070680_100822566	All Organisms → cellular organisms → Bacteria	800	Open in IMG/M
3300005345\|Ga0070692_10712624	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	676	Open in IMG/M
3300005347\|Ga0070668_101992254	All Organisms → cellular organisms → Archaea	535	Open in IMG/M
3300005367\|Ga0070667_100857561	All Organisms → cellular organisms → Bacteria	844	Open in IMG/M
3300005440\|Ga0070705_100009694	All Organisms → cellular organisms → Bacteria	4796	Open in IMG/M
3300005458\|Ga0070681_10408002	All Organisms → cellular organisms → Bacteria → Acidobacteria	1270	Open in IMG/M
3300005544\|Ga0070686_100012118	All Organisms → cellular organisms → Bacteria	4906	Open in IMG/M
3300005564\|Ga0070664_100048673	All Organisms → cellular organisms → Bacteria	3582	Open in IMG/M
3300005614\|Ga0068856_102514517	All Organisms → cellular organisms → Bacteria	521	Open in IMG/M
3300005615\|Ga0070702_100806210	All Organisms → cellular organisms → Bacteria	726	Open in IMG/M
3300005617\|Ga0068859_100295352	All Organisms → cellular organisms → Bacteria	1713	Open in IMG/M
3300005841\|Ga0068863_101093957	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	801	Open in IMG/M
3300005843\|Ga0068860_100090019	All Organisms → cellular organisms → Bacteria	2922	Open in IMG/M
3300006028\|Ga0070717_11503848	All Organisms → cellular organisms → Bacteria	611	Open in IMG/M
3300006046\|Ga0066652_100895715	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	847	Open in IMG/M
3300006049\|Ga0075417_10450849	All Organisms → cellular organisms → Bacteria	641	Open in IMG/M
3300006358\|Ga0068871_100356152	All Organisms → cellular organisms → Bacteria	1295	Open in IMG/M
3300006806\|Ga0079220_12044913	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica	512	Open in IMG/M
3300006852\|Ga0075433_10192061	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1816	Open in IMG/M
3300006852\|Ga0075433_11381113	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	609	Open in IMG/M
3300006876\|Ga0079217_10196734	All Organisms → cellular organisms → Bacteria	1026	Open in IMG/M
3300006880\|Ga0075429_100163495	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1949	Open in IMG/M
3300006880\|Ga0075429_100180418	All Organisms → cellular organisms → Bacteria	1850	Open in IMG/M
3300006881\|Ga0068865_100700438	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	865	Open in IMG/M
3300006954\|Ga0079219_10628487	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	795	Open in IMG/M
3300006954\|Ga0079219_11618872	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	595	Open in IMG/M
3300006969\|Ga0075419_10155777	All Organisms → cellular organisms → Bacteria → Acidobacteria	1496	Open in IMG/M
3300007004\|Ga0079218_13755562	All Organisms → cellular organisms → Bacteria	516	Open in IMG/M
3300009093\|Ga0105240_10819626	All Organisms → cellular organisms → Bacteria	1007	Open in IMG/M
3300009098\|Ga0105245_10362407	All Organisms → cellular organisms → Bacteria	1439	Open in IMG/M
3300009101\|Ga0105247_10025552	All Organisms → cellular organisms → Bacteria	3564	Open in IMG/M
3300009156\|Ga0111538_10037002	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	6306	Open in IMG/M
3300009156\|Ga0111538_10189981	All Organisms → cellular organisms → Bacteria	2607	Open in IMG/M
3300009157\|Ga0105092_10303498	All Organisms → cellular organisms → Bacteria	901	Open in IMG/M
3300009162\|Ga0075423_12608799	All Organisms → cellular organisms → Bacteria	552	Open in IMG/M
3300009174\|Ga0105241_10106344	All Organisms → cellular organisms → Bacteria	2239	Open in IMG/M
3300009174\|Ga0105241_10465310	All Organisms → cellular organisms → Bacteria	1121	Open in IMG/M
3300009174\|Ga0105241_12051562	All Organisms → cellular organisms → Bacteria	564	Open in IMG/M
3300009177\|Ga0105248_10024469	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	6713	Open in IMG/M
3300009551\|Ga0105238_10130168	All Organisms → cellular organisms → Bacteria	2495	Open in IMG/M
3300009553\|Ga0105249_11147601	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	848	Open in IMG/M
3300010040\|Ga0126308_10564683	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	773	Open in IMG/M
3300010041\|Ga0126312_10669672	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	748	Open in IMG/M
3300010045\|Ga0126311_10119169	All Organisms → cellular organisms → Bacteria	1839	Open in IMG/M
3300010047\|Ga0126382_10664179	All Organisms → cellular organisms → Bacteria	868	Open in IMG/M
3300010166\|Ga0126306_11142895	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	638	Open in IMG/M
3300010375\|Ga0105239_10454965	All Organisms → cellular organisms → Bacteria	1452	Open in IMG/M
3300010399\|Ga0134127_10020217	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	5146	Open in IMG/M
3300010399\|Ga0134127_10387896	All Organisms → cellular organisms → Bacteria	1377	Open in IMG/M
3300010399\|Ga0134127_10580512	All Organisms → cellular organisms → Bacteria	1146	Open in IMG/M
3300010399\|Ga0134127_10650789	All Organisms → cellular organisms → Bacteria	1088	Open in IMG/M
3300010399\|Ga0134127_10771535	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1008	Open in IMG/M
3300010399\|Ga0134127_11348256	All Organisms → cellular organisms → Bacteria	783	Open in IMG/M
3300011270\|Ga0137391_10064230	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	3146	Open in IMG/M
3300012045\|Ga0136623_10021297	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	2760	Open in IMG/M
3300012093\|Ga0136632_10240604	All Organisms → cellular organisms → Bacteria	820	Open in IMG/M
3300012200\|Ga0137382_11335057	All Organisms → cellular organisms → Bacteria	505	Open in IMG/M
3300012208\|Ga0137376_10725354	All Organisms → cellular organisms → Bacteria	857	Open in IMG/M
3300012354\|Ga0137366_10137693	All Organisms → cellular organisms → Bacteria	1840	Open in IMG/M
3300012532\|Ga0137373_10010776	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	9529	Open in IMG/M
3300012922\|Ga0137394_11026605	All Organisms → cellular organisms → Bacteria	685	Open in IMG/M
3300012923\|Ga0137359_11489390	All Organisms → cellular organisms → Bacteria	565	Open in IMG/M
3300012986\|Ga0164304_10976641	All Organisms → cellular organisms → Bacteria	669	Open in IMG/M
3300013297\|Ga0157378_10397385	All Organisms → cellular organisms → Bacteria	1357	Open in IMG/M
3300013308\|Ga0157375_10281252	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1827	Open in IMG/M
3300015371\|Ga0132258_10298495	All Organisms → cellular organisms → Bacteria	3961	Open in IMG/M
3300015371\|Ga0132258_10848255	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	2305	Open in IMG/M
3300015373\|Ga0132257_100078872	All Organisms → cellular organisms → Bacteria	3744	Open in IMG/M
3300015374\|Ga0132255_102286779	All Organisms → cellular organisms → Bacteria	825	Open in IMG/M
3300015374\|Ga0132255_105476087	All Organisms → cellular organisms → Bacteria	537	Open in IMG/M
3300017792\|Ga0163161_10011294	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	6189	Open in IMG/M
3300018061\|Ga0184619_10020761	All Organisms → cellular organisms → Bacteria → Acidobacteria	2697	Open in IMG/M
3300018061\|Ga0184619_10102240	All Organisms → cellular organisms → Bacteria	1288	Open in IMG/M
3300018061\|Ga0184619_10129552	All Organisms → cellular organisms → Bacteria	1145	Open in IMG/M
3300018061\|Ga0184619_10493176	All Organisms → cellular organisms → Bacteria	542	Open in IMG/M
3300018429\|Ga0190272_10047537	All Organisms → cellular organisms → Bacteria	2459	Open in IMG/M
3300018466\|Ga0190268_10333427	All Organisms → cellular organisms → Bacteria	933	Open in IMG/M
3300018466\|Ga0190268_11443699	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	593	Open in IMG/M
3300018920\|Ga0190273_11518904	All Organisms → cellular organisms → Bacteria	593	Open in IMG/M
3300019360\|Ga0187894_10000827	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	41663	Open in IMG/M
3300019487\|Ga0187893_10038490	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	5175	Open in IMG/M
3300021073\|Ga0210378_10080159	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1278	Open in IMG/M
3300022534\|Ga0224452_1185594	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	640	Open in IMG/M
3300022694\|Ga0222623_10279840	All Organisms → cellular organisms → Bacteria	642	Open in IMG/M
3300025899\|Ga0207642_10027030	All Organisms → cellular organisms → Bacteria	2344	Open in IMG/M
3300025912\|Ga0207707_10000335	All Organisms → cellular organisms → Bacteria	49647	Open in IMG/M
3300025925\|Ga0207650_10732694	All Organisms → cellular organisms → Bacteria	836	Open in IMG/M
3300025935\|Ga0207709_10660815	All Organisms → cellular organisms → Bacteria	833	Open in IMG/M
3300025936\|Ga0207670_10229757	All Organisms → cellular organisms → Bacteria	1424	Open in IMG/M
3300025938\|Ga0207704_11461670	All Organisms → cellular organisms → Bacteria	586	Open in IMG/M
3300026116\|Ga0207674_10000077	All Organisms → cellular organisms → Bacteria	104302	Open in IMG/M
3300027637\|Ga0209818_1000011	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	47171	Open in IMG/M
3300027637\|Ga0209818_1047612	All Organisms → cellular organisms → Bacteria	1030	Open in IMG/M
3300027639\|Ga0209387_1000131	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	22013	Open in IMG/M
3300031949\|Ga0214473_10025867	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	6877	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	55.77%
Host-Associated	Host-Associated	44.23%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	46.15%
Plants	Host-Associated → Plants	44.23%
Aquatic	Environmental → Aquatic	9.62%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	44.23%
Rhizosphere	Host-Associated → Plants → Rhizosphere	28.85%
Rhizoplane	Host-Associated → Plants → Rhizoplane	14.42%
Sediment	Environmental → Aquatic → Sediment	5.77%
Freshwater	Environmental → Aquatic → Freshwater	3.85%
Cave	Environmental → Terrestrial → Cave	1.92%
Roots	Host-Associated → Plants → Roots	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	32.69%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	22.12%
Loam	Environmental → Terrestrial → Soil → Loam	11.54%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	9.62%
Soil	Host-Associated → Plants → Rhizosphere → Soil	6.73%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.77%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.81%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.92%
Ice	Environmental → Aquatic → Freshwater → Ice	1.92%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	1.92%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	22.12%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	22.12%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	9.62%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	8.65%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	8.65%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	6.73%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.77%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.81%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.92%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	1.92%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.92%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	1.92%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.96%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.96%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.96%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.96%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	8.65%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	7.69%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	6.73%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	5.77%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	5.77%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	5.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.81%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	4.81%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	3.85%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	3.85%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.85%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.88%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.88%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.88%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.88%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	1.92%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.92%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.92%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.92%
Microbial Mat On Rocks	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks	1.92%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.92%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.96%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.96%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.96%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.96%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.96%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002120	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2	Environmental	Open in IMG/M
3300003324	Sugarcane bulk soil Sample H2	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010040	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55	Environmental	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300012045	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)	Environmental	Open in IMG/M
3300012093	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018061	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental	Open in IMG/M
3300019360	White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG	Environmental	Open in IMG/M
3300019487	White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG	Environmental	Open in IMG/M
3300021073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo	Environmental	Open in IMG/M
3300022534	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1	Environmental	Open in IMG/M
3300022694	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027637	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)	Environmental	Open in IMG/M
3300027639	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)	Environmental	Open in IMG/M
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
C687J26616_100534861	3300002120	Soil	VAMYIVGQERRLVDPPSQVVAGVRTVTTNMNGRDALPR*
soilH2_101485142	3300003324	Sugarcane Root And Bulk Soil	LHGTVVAVYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFA
Ga0070670_1008092122	3300005331	Switchgrass Rhizosphere	MYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFA
Ga0070670_1008383941	3300005331	Switchgrass Rhizosphere	QERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFKD*
Ga0066388_1000312435	3300005332	Tropical Forest Soil	VGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFST*
Ga0066388_1084035601	3300005332	Tropical Forest Soil	MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFA
Ga0068869_1015646221	3300005334	Miscanthus Rhizosphere	IVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI*
Ga0070666_100568371	3300005335	Switchgrass Rhizosphere	YIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPSAI*
Ga0070680_1008225661	3300005336	Corn Rhizosphere	MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF
Ga0070692_107126242	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	GQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFKD*
Ga0070668_1019922541	3300005347	Switchgrass Rhizosphere	MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPS
Ga0070667_1008575612	3300005367	Switchgrass Rhizosphere	MYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRP
Ga0070705_1000096946	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	LHGTGIAMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMS
Ga0070681_104080022	3300005458	Corn Rhizosphere	LHGTGVAVYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVGE*
Ga0070686_1000121181	3300005544	Switchgrass Rhizosphere	VAMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPSAI*
Ga0070664_1000486734	3300005564	Corn Rhizosphere	MYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRM
Ga0068856_1025145172	3300005614	Corn Rhizosphere	LHGTGIAMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDAL
Ga0070702_1008062102	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	LHGTGVAVYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFA
Ga0068859_1002953521	3300005617	Switchgrass Rhizosphere	GQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF*
Ga0068863_1010939572	3300005841	Switchgrass Rhizosphere	GQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVLM*
Ga0068860_1000900194	3300005843	Switchgrass Rhizosphere	GQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAL*
Ga0070717_115038482	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFSVALHSTQQDTAQT
Ga0066652_1008957151	3300006046	Soil	VAMYIVGQERRLVDPPSQVVAGVRTVTTKNEWARRTPTLSRPFALF*
Ga0075417_104508492	3300006049	Populus Rhizosphere	MYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPR
Ga0068871_1003561521	3300006358	Miscanthus Rhizosphere	GQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFLANSFSS*
Ga0079220_120449132	3300006806	Agricultural Soil	MYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF
Ga0075433_101920613	3300006852	Populus Rhizosphere	MYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMS
Ga0075433_113811131	3300006852	Populus Rhizosphere	GQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFY*
Ga0079217_101967342	3300006876	Agricultural Soil	AGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI*
Ga0075429_1001634951	3300006880	Populus Rhizosphere	LLHGTGVAMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF*
Ga0075429_1001804184	3300006880	Populus Rhizosphere	AVYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVYKIP*
Ga0068865_1007004381	3300006881	Miscanthus Rhizosphere	VGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVLM*
Ga0079219_106284871	3300006954	Agricultural Soil	IAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVGE*
Ga0079219_116188721	3300006954	Agricultural Soil	YIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI*
Ga0075419_101557773	3300006969	Populus Rhizosphere	YIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVYKIP*
Ga0079218_137555621	3300007004	Agricultural Soil	MYIVGQEETVGESSVSVVAGVRTVTTNMNGRDVLPRLSRPFA
Ga0105240_108196261	3300009093	Corn Rhizosphere	IAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF*
Ga0105245_103624072	3300009098	Miscanthus Rhizosphere	MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPSAI*
Ga0105247_100255524	3300009101	Switchgrass Rhizosphere	LHGTGVAVYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFK
Ga0111538_100370026	3300009156	Populus Rhizosphere	VAMYIVGQERRLVDPPSQVVAGVRTVTTNMNGRDALPRMSRPFAFY*
Ga0111538_101899814	3300009156	Populus Rhizosphere	IVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAL*
Ga0105092_103034981	3300009157	Freshwater Sediment	MRLAGYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDALPRMSRPF
Ga0075423_126087992	3300009162	Populus Rhizosphere	MYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDALPSMSRPFALSA
Ga0105241_101063441	3300009174	Corn Rhizosphere	VGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAL*
Ga0105241_104653101	3300009174	Corn Rhizosphere	IVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFIQQPT*
Ga0105241_120515621	3300009174	Corn Rhizosphere	MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALP
Ga0105242_109975771	3300009176	Miscanthus Rhizosphere	MHQTFLRGMRVAMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPR
Ga0105248_100244691	3300009177	Switchgrass Rhizosphere	YIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI*
Ga0105238_101301681	3300009551	Corn Rhizosphere	VAMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAL*
Ga0105249_111476011	3300009553	Switchgrass Rhizosphere	IVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVLM*
Ga0126308_105646832	3300010040	Serpentine Soil	IVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFALSTIPV*
Ga0126312_106696721	3300010041	Serpentine Soil	LVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF*
Ga0126311_101191694	3300010045	Serpentine Soil	IVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFALSTIR*
Ga0126382_106641792	3300010047	Tropical Forest Soil	LVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVFLL*
Ga0126306_111428952	3300010166	Serpentine Soil	LVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFALSASR*
Ga0105239_104549652	3300010375	Corn Rhizosphere	QERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI*
Ga0134127_100202171	3300010399	Terrestrial Soil	MYIVGQERRLVNPPSQVVAGVRTVTTKMNGRDALPRMS
Ga0134127_103878962	3300010399	Terrestrial Soil	YIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAICNGPW*
Ga0134127_105805122	3300010399	Terrestrial Soil	VGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFKD*
Ga0134127_106507891	3300010399	Terrestrial Soil	MRVAMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSRPF
Ga0134127_107715352	3300010399	Terrestrial Soil	VGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFIQQPT*
Ga0134127_113482563	3300010399	Terrestrial Soil	VGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSRPF
Ga0137391_100642302	3300011270	Vadose Zone Soil	MRVAMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSRPFAF*
Ga0136623_100212971	3300012045	Polar Desert Sand	MYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF
Ga0136632_102406042	3300012093	Polar Desert Sand	MYIAGQERRLVNPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFGRAFRLH
Ga0137382_113350572	3300012200	Vadose Zone Soil	MYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSRP
Ga0137376_107253541	3300012208	Vadose Zone Soil	MYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPR
Ga0137366_101376933	3300012354	Vadose Zone Soil	VAMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFALLTTRSPTLNP*
Ga0137373_100107762	3300012532	Vadose Zone Soil	MYIVGQERRLVNPPSQVVAGVRTVTTNMNGRDALPRMSRPFAFLAAF*
Ga0137394_110266051	3300012922	Vadose Zone Soil	MYIVGQEETVGESSVSVVAGVRTVTTNMDGRDVLPRLSRPFAF
Ga0137359_114893902	3300012923	Vadose Zone Soil	MYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDALPRMSR
Ga0164304_109766411	3300012986	Soil	MYIVGQERRLVNPPSQVVAGVRTVTTNMNGRDVLPR
Ga0157378_103973851	3300013297	Miscanthus Rhizosphere	IHVAMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSRPFAF*
Ga0157375_102812523	3300013308	Miscanthus Rhizosphere	GQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI*
Ga0132258_102984955	3300015371	Arabidopsis Rhizosphere	VGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFKS*
Ga0132258_108482554	3300015371	Arabidopsis Rhizosphere	VGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFLANSFSS*
Ga0132257_1000788725	3300015373	Arabidopsis Rhizosphere	IVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPLMSRPFAFKS*
Ga0132255_1022867791	3300015374	Arabidopsis Rhizosphere	MYIVGQERRLVDPPSQVVAGVRTVTTNMNGRDALPRMSRPFAFLEAFS
Ga0132255_1054760872	3300015374	Arabidopsis Rhizosphere	MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFLATP
Ga0163161_100112946	3300017792	Switchgrass Rhizosphere	MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPSAI
Ga0184619_100207611	3300018061	Groundwater Sediment	MRVAMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSR
Ga0184619_101022401	3300018061	Groundwater Sediment	MRVAMYIVGQEETVGESSVSVVAGVRTVTTNMDGRDVLPRL
Ga0184619_101295522	3300018061	Groundwater Sediment	MYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSR
Ga0184619_104931762	3300018061	Groundwater Sediment	MYIVGQEETVGESSVSVVAGVRTVTTNMDGRDVLPRL
Ga0190272_100475371	3300018429	Soil	VGQERRLVNPPSQVVAGVRTVTTNMNGRDVLPRLSRPFAFFL
Ga0190268_103334271	3300018466	Soil	MYIVGQERRLVNPPSQVVAGVRTVTTKMDGRDALPRMS
Ga0190268_114436991	3300018466	Soil	IAVYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF
Ga0190273_115189042	3300018920	Soil	VAMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDALPRLSRPFAFLIQPF
Ga0187894_100008271	3300019360	Microbial Mat On Rocks	MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMS
Ga0187893_100384901	3300019487	Microbial Mat On Rocks	MYIVGQERRLVNPPSQVVAGVRTVTTNMNGRDALPRMSRPFAF
Ga0210378_100801592	3300021073	Groundwater Sediment	MYIVGQEETAGESSVSVVAGVRTVTTNMDGRDVLPRLSRPFAFITPS
Ga0224452_11855941	3300022534	Groundwater Sediment	MYIVGQEETVGESSVSVVAGVRTVTTNMDGRDVLPRLSRPFAFSTAIQTSI
Ga0222623_102798402	3300022694	Groundwater Sediment	MYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSRPFA
Ga0207642_100270304	3300025899	Miscanthus Rhizosphere	AMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPSAI
Ga0207707_1000033539	3300025912	Corn Rhizosphere	MYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFALSANASVLS
Ga0207650_107326941	3300025925	Switchgrass Rhizosphere	MYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSR
Ga0207709_106608152	3300025935	Miscanthus Rhizosphere	MYIVGQEEAVGESSVSVVAGVRTVTTNMDRRDALPRLSRLFAFLSS
Ga0207670_102297571	3300025936	Switchgrass Rhizosphere	MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSR
Ga0207704_114616702	3300025938	Miscanthus Rhizosphere	MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRM
Ga0207674_1000007782	3300026116	Corn Rhizosphere	MYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALP
Ga0209818_10000111	3300027637	Agricultural Soil	IAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAIYNG
Ga0209818_10476121	3300027637	Agricultural Soil	IAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI
Ga0209387_100013117	3300027639	Agricultural Soil	YIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAICNG
Ga0214473_100258671	3300031949	Soil	VGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRLSRPFAFYA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F097440

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences