Basic Information | |
---|---|
Family ID | F097416 |
Family Type | Metagenome |
Number of Sequences | 104 |
Average Sequence Length | 45 residues |
Representative Sequence | MKGTARPGLSRREFLAGASALGGVAIASAAAPMQITTMAPFEKLPPYGN |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 90.38 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 92.31 % |
Associated GOLD sequencing projects | 80 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.26 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (64.423 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.615 % of family members) |
Environment Ontology (ENVO) | Unclassified (52.885 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (60.577 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 15.58% β-sheet: 0.00% Coil/Unstructured: 84.42% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF04239 | DUF421 | 4.81 |
PF13602 | ADH_zinc_N_2 | 4.81 |
PF13620 | CarboxypepD_reg | 3.85 |
PF07676 | PD40 | 2.88 |
PF00069 | Pkinase | 2.88 |
PF03929 | PepSY_TM | 1.92 |
PF00753 | Lactamase_B | 1.92 |
PF10009 | DUF2252 | 1.92 |
PF12543 | DUF3738 | 0.96 |
PF00561 | Abhydrolase_1 | 0.96 |
PF13535 | ATP-grasp_4 | 0.96 |
PF13428 | TPR_14 | 0.96 |
PF07687 | M20_dimer | 0.96 |
PF01872 | RibD_C | 0.96 |
PF13147 | Obsolete Pfam Family | 0.96 |
PF07883 | Cupin_2 | 0.96 |
PF13442 | Cytochrome_CBB3 | 0.96 |
PF10518 | TAT_signal | 0.96 |
PF11954 | DUF3471 | 0.96 |
PF03786 | UxuA | 0.96 |
PF13360 | PQQ_2 | 0.96 |
PF05050 | Methyltransf_21 | 0.96 |
PF01322 | Cytochrom_C_2 | 0.96 |
PF12796 | Ank_2 | 0.96 |
PF13172 | Obsolete Pfam Family | 0.96 |
PF02775 | TPP_enzyme_C | 0.96 |
PF11738 | DUF3298 | 0.96 |
PF02744 | GalP_UDP_tr_C | 0.96 |
PF01979 | Amidohydro_1 | 0.96 |
PF03551 | PadR | 0.96 |
PF01436 | NHL | 0.96 |
PF13091 | PLDc_2 | 0.96 |
PF13408 | Zn_ribbon_recom | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 11.54 |
COG2323 | Uncharacterized membrane protein YcaP, DUF421 family | Function unknown [S] | 4.81 |
COG3182 | PepSY-associated TM region | Function unknown [S] | 1.92 |
COG3295 | Uncharacterized conserved protein | Function unknown [S] | 1.92 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.96 |
COG1312 | D-mannonate dehydratase | Carbohydrate transport and metabolism [G] | 0.96 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.96 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.96 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.96 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.96 |
COG3909 | Cytochrome c556 | Energy production and conversion [C] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 64.42 % |
Unclassified | root | N/A | 35.58 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000787|JGI11643J11755_11276422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29 | 503 | Open in IMG/M |
3300000953|JGI11615J12901_10401370 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300001686|C688J18823_10590258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
3300003319|soilL2_10080950 | All Organisms → cellular organisms → Bacteria | 4374 | Open in IMG/M |
3300004114|Ga0062593_101272494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
3300004157|Ga0062590_101947313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
3300004157|Ga0062590_102485117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300004633|Ga0066395_10020821 | All Organisms → cellular organisms → Bacteria | 2606 | Open in IMG/M |
3300005333|Ga0070677_10900633 | Not Available | 511 | Open in IMG/M |
3300005345|Ga0070692_10958502 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300005355|Ga0070671_101824380 | Not Available | 540 | Open in IMG/M |
3300005356|Ga0070674_100764101 | Not Available | 832 | Open in IMG/M |
3300005440|Ga0070705_101659483 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
3300005455|Ga0070663_102039359 | Not Available | 516 | Open in IMG/M |
3300005456|Ga0070678_100909742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
3300005459|Ga0068867_100417582 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300005459|Ga0068867_101819904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
3300005543|Ga0070672_100393666 | Not Available | 1187 | Open in IMG/M |
3300005546|Ga0070696_101366835 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300005548|Ga0070665_101597464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
3300005564|Ga0070664_100909573 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300005564|Ga0070664_102081628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300005577|Ga0068857_100736572 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300005617|Ga0068859_102739308 | Not Available | 542 | Open in IMG/M |
3300005618|Ga0068864_101733197 | Not Available | 630 | Open in IMG/M |
3300005764|Ga0066903_107860689 | Not Available | 548 | Open in IMG/M |
3300005840|Ga0068870_10022749 | All Organisms → cellular organisms → Bacteria | 3083 | Open in IMG/M |
3300005840|Ga0068870_11036608 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300005844|Ga0068862_101782145 | Not Available | 625 | Open in IMG/M |
3300006046|Ga0066652_101087654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
3300006358|Ga0068871_102157384 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300006844|Ga0075428_102481698 | Not Available | 531 | Open in IMG/M |
3300006846|Ga0075430_101278762 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300006871|Ga0075434_101525466 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300006903|Ga0075426_10578696 | Not Available | 837 | Open in IMG/M |
3300009098|Ga0105245_10659776 | Not Available | 1077 | Open in IMG/M |
3300009147|Ga0114129_10693424 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
3300009148|Ga0105243_11874739 | Not Available | 632 | Open in IMG/M |
3300009176|Ga0105242_12361895 | Not Available | 579 | Open in IMG/M |
3300009177|Ga0105248_13405469 | Not Available | 505 | Open in IMG/M |
3300009610|Ga0105340_1081476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1284 | Open in IMG/M |
3300010358|Ga0126370_12042138 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300010366|Ga0126379_11911016 | Not Available | 697 | Open in IMG/M |
3300010399|Ga0134127_12741493 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300010403|Ga0134123_13157797 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300012179|Ga0137334_1151472 | Not Available | 525 | Open in IMG/M |
3300012200|Ga0137382_10869144 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300012683|Ga0137398_11135555 | Not Available | 537 | Open in IMG/M |
3300012892|Ga0157294_10008832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1691 | Open in IMG/M |
3300012910|Ga0157308_10192652 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300012989|Ga0164305_11642224 | Not Available | 575 | Open in IMG/M |
3300013297|Ga0157378_12338453 | Not Available | 586 | Open in IMG/M |
3300015372|Ga0132256_100573043 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
3300015373|Ga0132257_100343242 | Not Available | 1803 | Open in IMG/M |
3300018070|Ga0184631_10262817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 714 | Open in IMG/M |
3300018476|Ga0190274_10227924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1667 | Open in IMG/M |
3300018476|Ga0190274_12179527 | Not Available | 651 | Open in IMG/M |
3300021082|Ga0210380_10137340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1093 | Open in IMG/M |
3300025923|Ga0207681_10257926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1364 | Open in IMG/M |
3300025923|Ga0207681_11032766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
3300025927|Ga0207687_11632404 | Not Available | 553 | Open in IMG/M |
3300025930|Ga0207701_11027849 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300025931|Ga0207644_11461639 | Not Available | 574 | Open in IMG/M |
3300025933|Ga0207706_10113556 | Not Available | 2383 | Open in IMG/M |
3300025935|Ga0207709_10398764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29 | 1051 | Open in IMG/M |
3300025937|Ga0207669_10509430 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300025941|Ga0207711_10080345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2848 | Open in IMG/M |
3300025941|Ga0207711_10568267 | Not Available | 1058 | Open in IMG/M |
3300025942|Ga0207689_10354254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1220 | Open in IMG/M |
3300025945|Ga0207679_10743492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 892 | Open in IMG/M |
3300025960|Ga0207651_10203764 | Not Available | 1587 | Open in IMG/M |
3300025960|Ga0207651_11743271 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300025972|Ga0207668_12074982 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300026023|Ga0207677_10067822 | All Organisms → cellular organisms → Bacteria | 2501 | Open in IMG/M |
3300026067|Ga0207678_11819320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
3300026088|Ga0207641_10005685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10614 | Open in IMG/M |
3300026088|Ga0207641_10917513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
3300026095|Ga0207676_10469746 | Not Available | 1189 | Open in IMG/M |
3300026116|Ga0207674_10210890 | Not Available | 1891 | Open in IMG/M |
3300026116|Ga0207674_10424771 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
3300026116|Ga0207674_11958437 | Not Available | 551 | Open in IMG/M |
3300027695|Ga0209966_1112946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
3300028380|Ga0268265_11306405 | Not Available | 726 | Open in IMG/M |
3300028380|Ga0268265_11311099 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300028819|Ga0307296_10701595 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300031538|Ga0310888_10380819 | Not Available | 824 | Open in IMG/M |
3300031548|Ga0307408_101133072 | Not Available | 727 | Open in IMG/M |
3300031680|Ga0318574_10432981 | Not Available | 769 | Open in IMG/M |
3300031708|Ga0310686_112764422 | Not Available | 502 | Open in IMG/M |
3300031720|Ga0307469_10119933 | All Organisms → cellular organisms → Bacteria | 1900 | Open in IMG/M |
3300031847|Ga0310907_10799051 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300031858|Ga0310892_11099159 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300031943|Ga0310885_10896542 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300032000|Ga0310903_10040431 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
3300032003|Ga0310897_10265794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
3300032005|Ga0307411_11270761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
3300032075|Ga0310890_10075642 | All Organisms → cellular organisms → Bacteria | 2027 | Open in IMG/M |
3300032075|Ga0310890_11647085 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300032144|Ga0315910_10239506 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
3300032157|Ga0315912_10618746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
3300032157|Ga0315912_10748852 | Not Available | 778 | Open in IMG/M |
3300032205|Ga0307472_100561428 | Not Available | 999 | Open in IMG/M |
3300032211|Ga0310896_10063224 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
3300034147|Ga0364925_0176348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 782 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 7.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.77% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.77% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.88% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.88% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.92% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.92% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.92% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.92% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.96% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300018070 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1 | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI11643J11755_112764221 | 3300000787 | Soil | MKGTATPGLSRREFLAGXSALGGVAIASAASAQITTIAPYDKLPP |
JGI11615J12901_104013703 | 3300000953 | Soil | MKGPGTPGISRREFLAGASALGGVAIASAASAQITTLAPFEKLP |
C688J18823_105902583 | 3300001686 | Soil | MKGTATPGLSRREFLAGASALGGVAIASAAAPPQITTP |
soilL2_100809503 | 3300003319 | Sugarcane Root And Bulk Soil | MSAVSRREFLAGASAIGGSAIASPALAQITTMAAFEKLPPY |
Ga0062593_1012724941 | 3300004114 | Soil | MKGTARPGLSRREFLAGASALGGVAIASAAAPMQITTMAPFEKLPPYGNNTL |
Ga0062590_1019473132 | 3300004157 | Soil | MKGTATPGLSRREFLAGASAVGGVAIASAAAPTQITTMAPFEKLPPYGN |
Ga0062590_1024851171 | 3300004157 | Soil | MKGTATPGLSRREFLAGASALGGVTMASGAAPTQITTMAPFEKLP |
Ga0066395_100208215 | 3300004633 | Tropical Forest Soil | MKGTATLGLSRRAFLASASALGSVAIKSSAAPDQITTLAPFEKLPPYGNNTLP |
Ga0070677_109006332 | 3300005333 | Miscanthus Rhizosphere | MKATEPPGLSRRAFLAGASALGRATIAFAAAPTQITTMARFEKLPPYGNNTL |
Ga0070692_109585022 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MKGTAWPGLSRREFLAGASVFGGVAIAAVAAPAQITTLAPFEKLPPY |
Ga0070671_1018243801 | 3300005355 | Switchgrass Rhizosphere | MRTSRFSRREFLAGTSAVLGMAIAPPAAPAQITTTAPFEKLPPYGNGTLPAGV |
Ga0070674_1007641011 | 3300005356 | Miscanthus Rhizosphere | MKGTATPGLSRREFLVGASAIGGVAIASAAPPAQITTMAPFEKL |
Ga0070705_1016594831 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSTAATGLSRREFLAGASAIGGVAIASRPEPVEGSAAGAAQITTMAPFEKLPPYGNNTL |
Ga0070663_1020393592 | 3300005455 | Corn Rhizosphere | MKSTATPGLSRRGFLAGASAFGAVAIASAAAPPQTTTLAPFEKLPPYGNNT |
Ga0070678_1009097422 | 3300005456 | Miscanthus Rhizosphere | VNDTGMRGFSRREFLVGASAVGGVVLASAAVSAQITTMAPFEKLPP |
Ga0068867_1004175821 | 3300005459 | Miscanthus Rhizosphere | MTESAKPGLSRREFLAGASAMGSVAIMSAAAPAQITTLAPFEKLPPYGNN |
Ga0068867_1018199041 | 3300005459 | Miscanthus Rhizosphere | MRGTSTPGLSRRALLAGASAFGGVAIASTAVQAQIATLTRFERLPPYGNN |
Ga0070672_1003936661 | 3300005543 | Miscanthus Rhizosphere | MKGTATSGLSRREFLAGASALGSATIASAAASAQITTMAPFEKLPPYGNNTLPA |
Ga0070696_1013668352 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSTAATGLSRREFLAGASAIGGVAIASRPEPVEGSAAAPAQITTMAPFEKLPPYGNN |
Ga0070665_1015974641 | 3300005548 | Switchgrass Rhizosphere | MKGTATPGLSRREFLAGASALGGVAIASAAAPMQITTMVPFE |
Ga0070664_1009095732 | 3300005564 | Corn Rhizosphere | MKGRTTPGLSRRQFLAGASALGSVAMASAAAPAQITTTAPFEKLPPYGN |
Ga0070664_1020816281 | 3300005564 | Corn Rhizosphere | MRGFSRREFLVGASAVGGVVLASAAVSAQITTLAPFEKLPPYGNNTLPAGV |
Ga0068857_1007365721 | 3300005577 | Corn Rhizosphere | MTSTAATGLSRREFLAGASAIGGVAIASRPEPVEGSAAAPAQITTMAPFEKLPPYG |
Ga0068859_1027393082 | 3300005617 | Switchgrass Rhizosphere | MPRLSRREFLAGVSAVGGVAIASAAAPAQITTLAPFAKLPPYGNDTLPAGVTARL |
Ga0068864_1017331972 | 3300005618 | Switchgrass Rhizosphere | MKGTATPGLSRREFLAGASAVGGVAIASAAAPTQITTMAPFEKLPPYGNN |
Ga0066903_1078606891 | 3300005764 | Tropical Forest Soil | MNRTSTSGLSRRDFLAGASALGGAAIASAATAQITTMAPFEKLPP |
Ga0068870_100227491 | 3300005840 | Miscanthus Rhizosphere | MAGLSRREFLVATSALGGVAIAPAAATAQITTLAPFEKLPPYGN |
Ga0068870_110366082 | 3300005840 | Miscanthus Rhizosphere | MGESAKPGLSRREFLAGASALGSVAIASAAAPAQITTLAPFEKLPPYGNNTL |
Ga0068862_1017821452 | 3300005844 | Switchgrass Rhizosphere | MKGRATSGLSRREFLAGTSAFGAVTIAAARVQITTLAPFEKLPPYGN |
Ga0066652_1010876541 | 3300006046 | Soil | MKGTATPGLSRRQFLAGASALGGVAIASGAAPMQITTMAPFEKLSP |
Ga0068871_1021573842 | 3300006358 | Miscanthus Rhizosphere | MKGTATPGLSRRQFLAGASALGGVAIASAADPMQITTLAPFAKLPPY |
Ga0075428_1024816981 | 3300006844 | Populus Rhizosphere | MTGLSRRAFLAGVSALGGGAVASAAAPAQITTMAPF |
Ga0075430_1012787622 | 3300006846 | Populus Rhizosphere | MKGTATPGLSRREFLAGASALGGVAIASAAASAQITTMA |
Ga0075434_1015254661 | 3300006871 | Populus Rhizosphere | MRQKFSRRQFLAGASALGGVAIASAAPAQITTMAPF |
Ga0075426_105786961 | 3300006903 | Populus Rhizosphere | MKGTATPGLSRRAFLASASALGSVAIKSSAAPDQIATLAPFEKLPPYGN |
Ga0105245_106597761 | 3300009098 | Miscanthus Rhizosphere | MAGLSRREFLVATPALGGVAIAPAAATAQITTLAPFEKLPPY |
Ga0114129_106934242 | 3300009147 | Populus Rhizosphere | MSESAKPGLSRREFLAGASALGSVAIASAASAQITTLAPSEKLPPY |
Ga0105243_118747392 | 3300009148 | Miscanthus Rhizosphere | MKGTATPGLSRREFLAGASALGGVAIASAAATAQITTMAPFE |
Ga0105242_123618952 | 3300009176 | Miscanthus Rhizosphere | MPALSRREFLAGGSALGGVAIASAAFPAQITTMAPF |
Ga0105248_134054691 | 3300009177 | Switchgrass Rhizosphere | MKGTATPGLSRREFLAGASAVGGVAIASAAAPTQITTIAPFE |
Ga0105340_10814762 | 3300009610 | Soil | MKGTATPGLSRREFLAGASAVGGVAIASAAAPTQIT |
Ga0126370_120421382 | 3300010358 | Tropical Forest Soil | MKGRASSPGLSRRAFLASASALGSVAIASSAAPAQITTLAPFEK |
Ga0126379_119110161 | 3300010366 | Tropical Forest Soil | MPIGNMKGTASPGLSRREFLAGASALSGVAIVSAAAAAQITTMAPFEKLPPYGNNT |
Ga0134127_127414931 | 3300010399 | Terrestrial Soil | MTSTAATGLSRREFLAGASAIGGVAIASRPEPVEGSAAAPAQITTMAPFEKLPPYGNNT |
Ga0134123_131577972 | 3300010403 | Terrestrial Soil | MKGDMIRTTTLELSRREFLAGASALGGVAIASAASAQITTL |
Ga0137334_11514722 | 3300012179 | Soil | MKDTATPGLSRREFLAGASAVGGMAIASAAAPAQITT |
Ga0137382_108691441 | 3300012200 | Vadose Zone Soil | MKDTAKPGLSRREFLAGASALGGAAIVSAAAPAQITTMAPFEKLP |
Ga0137398_111355551 | 3300012683 | Vadose Zone Soil | MKGTGNPGLSRREFLAGASALGGAAITSAAPAQITTMAP |
Ga0157294_100088323 | 3300012892 | Soil | MKGTARPGLSRREFLAGASALGGVAIASAAAPMQITTMAPFEKLPPYGN |
Ga0157308_101926522 | 3300012910 | Soil | MKGTTMPGRSRREFLAGASALGSVAIASAATSAQITTMAPFEKLPPYGNTT |
Ga0164305_116422242 | 3300012989 | Soil | MKATEPPGLSRRAFLAGASALGRATIAFAAAPTQITTLAPFEKLPPY |
Ga0157378_123384531 | 3300013297 | Miscanthus Rhizosphere | MQGTATNGLSRREFLAGASALGGVAIASAAAPAQITTMAPFEKLPPYGNNTLPA |
Ga0132256_1005730431 | 3300015372 | Arabidopsis Rhizosphere | MKGRATPGLSRREFLAGASALGGVAIAPRPEPVEGSAASPAQITTLAPFEKL |
Ga0132257_1003432422 | 3300015373 | Arabidopsis Rhizosphere | MHELSRRAFLTATSALGGMALALDPEPVEGSASARAQITTMAPFEKLPPYGNN |
Ga0184631_102628171 | 3300018070 | Groundwater Sediment | MRGTTRPEFSRREFLAGASALGGVAIASAATAAQITTMAPFER |
Ga0190274_102279241 | 3300018476 | Soil | MRGMATPGLSRREFLAGASALGGVTLASAAATAQITTMAPFEKLPSYGNNTL |
Ga0190274_121795271 | 3300018476 | Soil | MKGTARPGLSRREFLAGASALGGVAIASAAAPTQITTMAPF |
Ga0210380_101373401 | 3300021082 | Groundwater Sediment | MRGTTRPEFSRREFLAGASALGGVAMASAAAAQITTMATFEKLP |
Ga0207681_102579261 | 3300025923 | Switchgrass Rhizosphere | VNDTGMRGFSRREFLVGASAVGGVVLASAAVSAQITTLAPFEKLPPYGNNTLPA |
Ga0207681_110327661 | 3300025923 | Switchgrass Rhizosphere | MKGTTTPGLSRREFLAGASALGGVAIASAAAPAQITTMA |
Ga0207687_116324041 | 3300025927 | Miscanthus Rhizosphere | MAGLSRREFLVATSALGGVAIAPAAATAQITTLAPFEKLPPY |
Ga0207701_110278491 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MHELSRRAFLTATSALGGLAIASPARAQITTLASFAKLPPYGNDTLPSGVKPRPV |
Ga0207644_114616392 | 3300025931 | Switchgrass Rhizosphere | MKATEPPGLSRRAFLAGASALGRATIAFAAAPTQITTMARFEKLPPY |
Ga0207706_101135561 | 3300025933 | Corn Rhizosphere | MKHTTTPGVSRREFLGGASAMAGAALASAAPAQIT |
Ga0207709_103987641 | 3300025935 | Miscanthus Rhizosphere | MTGTAMRELSRREFLTGASALGGVAIASAASAQIT |
Ga0207669_105094301 | 3300025937 | Miscanthus Rhizosphere | MKGTATPGLSRREFLAGASALGGVTMASGAAPTQITTM |
Ga0207711_100803454 | 3300025941 | Switchgrass Rhizosphere | MKGTATPGLSRREFLAGASALGGVAIASAASAQITTIAPYDKLPPYG |
Ga0207711_105682671 | 3300025941 | Switchgrass Rhizosphere | MKDTTLPGLSRREFLAGASTLGGVAIASAAAPAQITTLAPFEKLPPYG |
Ga0207689_103542541 | 3300025942 | Miscanthus Rhizosphere | MAKGGVEQGGTMKSTATPGLSRRGFLAGASAFGAVAIASAAAPPQTTTLAPFEKL |
Ga0207679_107434922 | 3300025945 | Corn Rhizosphere | MKGRTTPGLSRRQFLAGASALGSVAMASAAAPAQITTTAPFEKLPPYGNN |
Ga0207651_102037642 | 3300025960 | Switchgrass Rhizosphere | MKGTATPGLSRREFLAGASALGGVAIASAAAPAQI |
Ga0207651_117432711 | 3300025960 | Switchgrass Rhizosphere | MKATEPPGLSRRAFLAGASALGRATIAFAAAPTQITTMARFEKLP |
Ga0207668_120749821 | 3300025972 | Switchgrass Rhizosphere | MHELSRRAFLTATSALGGLAIASPARAQITTLASFAKLPPYGN |
Ga0207677_100678221 | 3300026023 | Miscanthus Rhizosphere | MKSTATPGLSRRGFLAGASAFGAVAIASAAAPPQTTTLAPF |
Ga0207678_118193201 | 3300026067 | Corn Rhizosphere | MKSTATPGLSRRGFLAGASAFGAVAIASAAAPPQTTTLAPFEKL |
Ga0207641_1000568513 | 3300026088 | Switchgrass Rhizosphere | MKGTATPGLSRREFLAGASALGGVAIASAASAQITTI |
Ga0207641_109175131 | 3300026088 | Switchgrass Rhizosphere | MKSTATPGLSRRGFLAGASAFGAVAIASAAAPPQTTTLAPFE |
Ga0207676_104697462 | 3300026095 | Switchgrass Rhizosphere | MKGTVTPGLSRREFLAGASALGGVALASAAAPAQITTMAPFEKLPPYGNN |
Ga0207674_102108901 | 3300026116 | Corn Rhizosphere | MHELSRRAFLTATSALGGMALALDPEPVEGSASARAQITTMAPFEKLPPYGNNTL |
Ga0207674_104247713 | 3300026116 | Corn Rhizosphere | MTSTAATGLSRREFLAGASAIGGVAIASRPEPVEGSAAAPAQITTMAPFEKLPPYGN |
Ga0207674_119584371 | 3300026116 | Corn Rhizosphere | MKRSATSGLSRREFLAGASAVGGVAIASAAAPTQITTIAP |
Ga0209966_11129461 | 3300027695 | Arabidopsis Thaliana Rhizosphere | VKDTGTPGLSRREFLAGASALGSVAIASAAAPAQIT |
Ga0268265_113064051 | 3300028380 | Switchgrass Rhizosphere | MKHTTTPGLSRREFLGAASGIAGAAIASAASAQITTMAPFEKLPPYGNNT |
Ga0268265_113110991 | 3300028380 | Switchgrass Rhizosphere | MTGTAMRELSRREFLTGASALGGVAIASAASAQITTLAPFEKLPP |
Ga0307296_107015952 | 3300028819 | Soil | MKHTTTPGLSRREFLGGASGIAGAAIASAASAQITTMAPFEKL |
Ga0310888_103808192 | 3300031538 | Soil | MKGSATPNLSRREFLAGASALGGAAIASAASAQITTMATFEK |
Ga0307408_1011330721 | 3300031548 | Rhizosphere | MKGTATPGLSRREFLAGASALGGVAIASAASPAQITTMAP |
Ga0318574_104329812 | 3300031680 | Soil | MSTTTVGFSRREFLAGASAFGGAAIASAGSTTQIT |
Ga0310686_1127644221 | 3300031708 | Soil | MKGTATPGLSRREFLAGASALGGAAIASAAAPTQIT |
Ga0307469_101199331 | 3300031720 | Hardwood Forest Soil | MKGTATPGLSRRAFLGGASALGSVAIASSAAPAQITTLAPLEKLPPYGNN |
Ga0310907_107990512 | 3300031847 | Soil | MKGTTRPEFSRREFLAGASALGGMTMASAAAAAQVTTMAPF |
Ga0310892_110991591 | 3300031858 | Soil | MKGTKPGLSRREFLAGASALGGVAIASAASAQITTLAPFEKLPPYGNNT |
Ga0310885_108965422 | 3300031943 | Soil | MKGTTRPEFSRREFLAGASALGGVAMASAAGAVQITTMAP |
Ga0310903_100404313 | 3300032000 | Soil | MKGTDTPGFSRREFLAGASALGSVAIASAAAPAQITTLAPFERLPPY |
Ga0310897_102657941 | 3300032003 | Soil | MKGTDTPGFSRREFLAGASALGSMAIASAAAPAQITTLAP |
Ga0307411_112707611 | 3300032005 | Rhizosphere | MKGTITPGLSRREFLAGASALGGVAIAPATAPAQITTMAPFEKLPPYGN |
Ga0310890_100756421 | 3300032075 | Soil | MKGTDTPGFSRREFLAGASALGSVAIASAAAPAQI |
Ga0310890_116470851 | 3300032075 | Soil | MTPGLSRREFLAGASALGGVAIASAASAQITSLARFEKLPPYGNN |
Ga0315910_102395061 | 3300032144 | Soil | MARTATPILSRREFLAGASALGGVVIASATTASQITTLTPFEKLPPY |
Ga0315912_106187461 | 3300032157 | Soil | MKSTATPGVSRRGFLAGASAFGTVAIASAAAPVQITTLATFEKLPP |
Ga0315912_107488521 | 3300032157 | Soil | MKGTATPGLSRRAFLAGASALGGVVSASAAAPAQITTMAPFEKLPPYGN |
Ga0307472_1005614282 | 3300032205 | Hardwood Forest Soil | MKGTATPGLSRRAFLGGASALGSVAIASSAASAQITTLAPFEKLPP |
Ga0310896_100632243 | 3300032211 | Soil | MKGTTRPEFSRREFLAGASALGGMTMASAAAAAQVTTMAPFEKLPPYGNNTLPV |
Ga0364925_0176348_3_116 | 3300034147 | Sediment | MRRQGGIMKGTATPGLSRRAFLAGASALGGVAMASAAA |
⦗Top⦘ |