NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F097344

Metagenome Family F097344

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097344
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 52 residues
Representative Sequence MFTILELAAVVIACSVGWFLVGWTIGYKEGVKDGFNRGRAAGMRAATDYVRSL
Number of Associated Samples 80
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 81.73 %
% of genes near scaffold ends (potentially truncated) 27.88 %
% of genes from short scaffolds (< 2000 bps) 62.50 %
Associated GOLD sequencing projects 74
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (88.462 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(21.154 % of family members)
Environment Ontology (ENVO) Unclassified
(59.615 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(53.846 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 60.49%    β-sheet: 0.00%    Coil/Unstructured: 39.51%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF13539Peptidase_M15_4 23.08
PF01844HNH 8.65
PF03406Phage_fiber_2 5.77
PF04860Phage_portal 2.88
PF03354TerL_ATPase 0.96
PF16778Phage_tail_APC 0.96
PF05257CHAP 0.96
PF04586Peptidase_S78 0.96
PF05869Dam 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG3740Phage head maturation proteaseMobilome: prophages, transposons [X] 0.96
COG4626Phage terminase-like protein, large subunit, contains N-terminal HTH domainMobilome: prophages, transposons [X] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.08 %
UnclassifiedrootN/A1.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002408|B570J29032_108791806Not Available511Open in IMG/M
3300002835|B570J40625_100162947All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2510Open in IMG/M
3300003277|JGI25908J49247_10008989All Organisms → cellular organisms → Bacteria3141Open in IMG/M
3300005805|Ga0079957_1003118All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14230Open in IMG/M
3300005990|Ga0073921_1065260All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes680Open in IMG/M
3300006484|Ga0070744_10027187All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1694Open in IMG/M
3300006802|Ga0070749_10027239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3586Open in IMG/M
3300006805|Ga0075464_10016311All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3775Open in IMG/M
3300006805|Ga0075464_10042747All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2474Open in IMG/M
3300006805|Ga0075464_10160099All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1325Open in IMG/M
3300006805|Ga0075464_10238676All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1085Open in IMG/M
3300006875|Ga0075473_10323092All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes624Open in IMG/M
3300007363|Ga0075458_10071811All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1082Open in IMG/M
3300008117|Ga0114351_1041114All Organisms → Viruses → Predicted Viral2946Open in IMG/M
3300008266|Ga0114363_1036573All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2504Open in IMG/M
3300008266|Ga0114363_1128882All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage867Open in IMG/M
3300008450|Ga0114880_1040986All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2010Open in IMG/M
3300008450|Ga0114880_1099476All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1127Open in IMG/M
3300008450|Ga0114880_1171587All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage758Open in IMG/M
3300008999|Ga0102816_1003526All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4680Open in IMG/M
3300009068|Ga0114973_10006818All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7653Open in IMG/M
3300009068|Ga0114973_10535809All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage604Open in IMG/M
3300009081|Ga0105098_10000441All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14128Open in IMG/M
3300009081|Ga0105098_10286537All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage787Open in IMG/M
3300009085|Ga0105103_10093920All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1552Open in IMG/M
3300009085|Ga0105103_10896481All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes520Open in IMG/M
3300009155|Ga0114968_10051983All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2637Open in IMG/M
3300009155|Ga0114968_10056699All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2503Open in IMG/M
3300009155|Ga0114968_10076624All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2086Open in IMG/M
3300009158|Ga0114977_10007884All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6758Open in IMG/M
3300009159|Ga0114978_10157630All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1458Open in IMG/M
3300009180|Ga0114979_10006761All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7540Open in IMG/M
3300009183|Ga0114974_10146117All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1482Open in IMG/M
3300009183|Ga0114974_10206818All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1195Open in IMG/M
3300009185|Ga0114971_10139305All Organisms → Viruses → Predicted Viral1466Open in IMG/M
3300009187|Ga0114972_10336495All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage885Open in IMG/M
3300010885|Ga0133913_11590731All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1650Open in IMG/M
3300011115|Ga0151514_10647All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14692Open in IMG/M
3300011335|Ga0153698_1135All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage33468Open in IMG/M
3300012013|Ga0153805_1050518All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage705Open in IMG/M
3300012663|Ga0157203_1006196All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2214Open in IMG/M
3300012665|Ga0157210_1028670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage877Open in IMG/M
3300013005|Ga0164292_10310772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1075Open in IMG/M
3300013005|Ga0164292_10341612All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1013Open in IMG/M
3300013006|Ga0164294_10003319All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14340Open in IMG/M
3300013014|Ga0164295_10358948All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1105Open in IMG/M
3300017723|Ga0181362_1064639Not Available748Open in IMG/M
3300017736|Ga0181365_1038529All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1203Open in IMG/M
3300017784|Ga0181348_1303500All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300019784|Ga0181359_1138619All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage849Open in IMG/M
3300019784|Ga0181359_1158113All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage770Open in IMG/M
3300020172|Ga0211729_10157173All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage774Open in IMG/M
3300020205|Ga0211731_10527106All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1182Open in IMG/M
3300020205|Ga0211731_10794605All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage573Open in IMG/M
3300020205|Ga0211731_11100568All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1625Open in IMG/M
3300020517|Ga0208854_1016837All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1137Open in IMG/M
3300021108|Ga0214162_1000735All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7390Open in IMG/M
3300021141|Ga0214163_1010348All Organisms → Viruses → Predicted Viral3115Open in IMG/M
3300024346|Ga0244775_10005592All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12709Open in IMG/M
3300025543|Ga0208303_1094414All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes641Open in IMG/M
3300025896|Ga0208916_10000828All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage13932Open in IMG/M
3300025896|Ga0208916_10023266All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2460Open in IMG/M
3300027121|Ga0255074_1038649All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage593Open in IMG/M
3300027138|Ga0255064_1024654All Organisms → Viruses → Predicted Viral1016Open in IMG/M
3300027156|Ga0255078_1041640All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage949Open in IMG/M
3300027488|Ga0255084_1091466All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300027683|Ga0209392_1000145All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage13998Open in IMG/M
3300027693|Ga0209704_1029754All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1438Open in IMG/M
3300027733|Ga0209297_1063627All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1640Open in IMG/M
3300027736|Ga0209190_1028863All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2999Open in IMG/M
3300027754|Ga0209596_1007808All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7486Open in IMG/M
3300027754|Ga0209596_1137103All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1103Open in IMG/M
3300027759|Ga0209296_1004876All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8692Open in IMG/M
3300027763|Ga0209088_10103449All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1303Open in IMG/M
3300027956|Ga0209820_1023352All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1587Open in IMG/M
3300027963|Ga0209400_1053219All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2084Open in IMG/M
(restricted) 3300028571|Ga0247844_1037003All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3158Open in IMG/M
3300031758|Ga0315907_10273983All Organisms → Viruses → Predicted Viral1393Open in IMG/M
3300031772|Ga0315288_10664098All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage991Open in IMG/M
3300031834|Ga0315290_10934741All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage734Open in IMG/M
3300031997|Ga0315278_10296733All Organisms → Viruses → Predicted Viral1670Open in IMG/M
3300031999|Ga0315274_10158817All Organisms → cellular organisms → Bacteria2857Open in IMG/M
3300032046|Ga0315289_10894059All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage764Open in IMG/M
3300032050|Ga0315906_10202031All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1869Open in IMG/M
3300032116|Ga0315903_10203913All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1755Open in IMG/M
3300032116|Ga0315903_10217195All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1683Open in IMG/M
3300032177|Ga0315276_12277629All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage547Open in IMG/M
3300033996|Ga0334979_0053545All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2610Open in IMG/M
3300034012|Ga0334986_0040357All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3024Open in IMG/M
3300034061|Ga0334987_0003987All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14130Open in IMG/M
3300034062|Ga0334995_0035409All Organisms → cellular organisms → Bacteria4237Open in IMG/M
3300034062|Ga0334995_0519587All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage711Open in IMG/M
3300034066|Ga0335019_0584016All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage656Open in IMG/M
3300034068|Ga0334990_0644717All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage553Open in IMG/M
3300034104|Ga0335031_0806183All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage525Open in IMG/M
3300034106|Ga0335036_0058621All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2920Open in IMG/M
3300034106|Ga0335036_0141731All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1720Open in IMG/M
3300034106|Ga0335036_0255281All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1185Open in IMG/M
3300034106|Ga0335036_0326280All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1011Open in IMG/M
3300034106|Ga0335036_0575002All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage688Open in IMG/M
3300034122|Ga0335060_0099768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1752Open in IMG/M
3300034167|Ga0335017_0173832All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1247Open in IMG/M
3300034283|Ga0335007_0002767All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage13942Open in IMG/M
3300034355|Ga0335039_0317807All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage820Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater21.15%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake19.23%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous9.62%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment6.73%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake5.77%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment5.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.81%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.85%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater3.85%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.88%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater2.88%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.92%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.96%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.96%
Surface IceEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice0.96%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.96%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.96%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300005990Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_30-Apr-14EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011115Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016MayEnvironmentalOpen in IMG/M
3300011335Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - GumanEnvironmentalOpen in IMG/M
3300012013Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface IceEnvironmentalOpen in IMG/M
3300012663Freshwater microbial communities from Indian River, Ontario, Canada - S50EnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020517Freshwater microbial communities from Lake Mendota, WI - 30NOV2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021108Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300021141Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027121Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300027138Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300027156Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027488Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8dEnvironmentalOpen in IMG/M
3300027683Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028571 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034167Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J29032_10879180633300002408FreshwaterMFTILELAMVVIACSAGWFLVGWSIGYKQGVKDGFNR
B570J40625_10016294713300002835FreshwaterMFTILELAMVVIACSAGWFLVGWSIGYKQGVKDGFNRGRAAGMRAATDYVRSL*
JGI25908J49247_1000898963300003277Freshwater LakeMFTILELAMVVIACSAGWCLVGWSIGYKQGVKDGFNRGRAAGMRAATDYVRSL*
Ga0079957_100311853300005805LakeMFTILELAVVVVACSVGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERVRSY*
Ga0073921_106526023300005990SandMFTILELAAVVIACSAGWCLVGWSIGYKQGVKDGFNRGRAAGMRAATDYVRSL*
Ga0070744_1002718713300006484EstuarineMFTILELAIISIVMSFAWCLVGWSIGYKQGVKDGFNRGRAAGMRAATDYVRSL*
Ga0070749_1002723953300006802AqueousMFTVVELAGAVILASVGWCLVGWSIGFKAGMKDGYNRGRAAGLRWATDRVRNS*
Ga0075464_1001631163300006805AqueousMFTILELAAVVIACSVGWFLVGWTIGYKQGVKDGWQRGRAAGLRWATDRVRNS*
Ga0075464_1004274753300006805AqueousMISIEKMLVLLLVSNVGWLLVGWTIGYKEGVKDGFNRGRAAGMRAATDYVRSL*
Ga0075464_1016009923300006805AqueousMFTVLEMAAVALLCSVGWFLVGWSIGFKEGVKEGFNRGRAAGIRAATDRVRSF*
Ga0075464_1023867633300006805AqueousTRERISRSPESGANMFTVLELAAVVIVASIGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERIKSY*
Ga0075473_1032309223300006875AqueousMFTVLEMAIAVFIAGIGWFLVGWTIGYKEGVKDGFNRGR
Ga0075458_1007181133300007363AqueousMFTVLEMAIAVFIAGIGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERLRSY*
Ga0114351_104111433300008117Freshwater, PlanktonMFTVLEMAGAVFLASVGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERVRSY*
Ga0114363_103657373300008266Freshwater, PlanktonSGANMFTVLEMAIAVFIAGIGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERLRSY*
Ga0114363_112888213300008266Freshwater, PlanktonMFTILEMAIAVFIASIGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERLRSY*
Ga0114880_104098663300008450Freshwater LakeLEMAIAVFIAGIGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERLRSY*
Ga0114880_109947613300008450Freshwater LakeMFTVLELAGAVILASIGWFLVGWSIGFKEGVKDGFNRGRSAGLRAATNYVKSL*
Ga0114880_117158723300008450Freshwater LakePESGANMFTVLEMAIAVFIAGIGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERVRSY*
Ga0102816_100352673300008999EstuarineMFTILELAMVVIACSAAWCLVGWSIGYKQGVKDGFNRGRAAGMRAATDYVRSL*
Ga0114973_1000681883300009068Freshwater LakeMFTVLELAGAVILASIGWFLVGWSIGFKEGVKDGFNRGRAAGLRWATDRVRNS*
Ga0114973_1053580913300009068Freshwater LakeMISIEKVLLVVIVSNVGWLLVGWSMGFKQGVKDGFNRGRAAGLRWATDRVRNS*
Ga0105098_10000441153300009081Freshwater SedimentMFTILELAVVVVATSVGWFLVGWTIGYKEGVKDGFNRGRAAGMRAATNYVKSL*
Ga0105098_1028653713300009081Freshwater SedimentSRFLESGAKMFTVVELAGAVILASVGWCLVGWSIGFKAGMKDGYNRGRAAGLRWATDRVRNS*
Ga0105103_1009392053300009085Freshwater SedimentMFTILELAVVVVACSVGWFLVGWTIGYKEGVKDGFNRGRAAGLRAAT
Ga0105103_1089648123300009085Freshwater SedimentMFTVLEMAIAVFIAGIGWFLVGWTIGYKEGVKDGFNRGRAAGMRAATNYVKSL*
Ga0114968_1005198313300009155Freshwater LakeMFTVLELAGAVILASIVWFIVGWSIGFKEGVKDGFNRGRAAGLRAATEIVRNS*
Ga0114968_1005669913300009155Freshwater LakeMFTILELAAVVIACSVGWFLVGWTIGYKEGVKDGFNRGRAAGMRAATDYVKSL*
Ga0114968_1007662453300009155Freshwater LakeMFTVVELAGAVILASVGWFLVGWSVGYKQGVKDGFNRGRAAGLRWATDRVRNS*
Ga0114977_1000788483300009158Freshwater LakeMISIEKVLLVVIVSNVGWLLVGWSMGFKQGVKDGFNRGRAAGLRWATDRVKNS*
Ga0114978_1015763023300009159Freshwater LakeMFTVLEMAGAVLLASVGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATDRVRSY*
Ga0114979_10006761103300009180Freshwater LakeMISIEKVLLIVLVSNVGWLLVGWSMGFKQGVKDGFNRGRAAGLRWATDRVRNS*
Ga0114974_1014611733300009183Freshwater LakeMFTVLELAGAVIFASIGWFMVGWSIGFKEGVKDGFNRGRAAGLRAATEIVRNS*
Ga0114974_1020681833300009183Freshwater LakeMFTVLELAGAVILASIGWFLVGWSVGSKSGFKDGYMRGRANAMRDATNRVRNS*
Ga0114971_1013930533300009185Freshwater LakeSHPESGAKMFTVLELAGAVILASIGWFLVGWSIGFKEGVKDGFNRGRAAGLRWATDRVRNS*
Ga0114972_1033649513300009187Freshwater LakeVLELAGAVILASIGWFLVGWSIGFKEGVKDGFNRGRAAGLRWATDRVRNS*
Ga0133913_1159073113300010885Freshwater LakeMFTVLELAAVVIVASVGWFLVGWTIGFKEGVKDGFNRGRAAGLRAATNYVKSL*
Ga0151514_1064753300011115FreshwaterMFTILELAAVVIVASIGWFLVGWTIGFKQGVKDGFNRGRAAGMRAATDYVRSL*
Ga0153698_1135273300011335FreshwaterMFTVLELAGAVILASIGWFLVGWSIGFKEGVKDGFNRGRAAGLRAATNYVKSL*
Ga0153805_105051813300012013Surface IceMFTILELAAVVIACSVGWFLVGWTIGYKEGVKDGFNRGRAAGMRAATDYVRSL*
Ga0157203_100619643300012663FreshwaterMFTILELAMVVIACSAGWFLVGWSIGFKEGVKDGFNRGRAAGLRAATEIVRNS*
Ga0157210_102867013300012665FreshwaterMFTILEMAIAVFIAGIGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERLRSY*
Ga0164292_1031077213300013005FreshwaterMFTVLEMAIAVFIAGIGWFLVGWTIGYKEGVKDGFNRGRAAGL
Ga0164292_1034161233300013005FreshwaterSHPESGAKMFTVLELAGAVILASVGWCLVGWSIGFKAGMKDGYNRGRAAGLRWATDRVRNS*
Ga0164294_10003319123300013006FreshwaterMFTVVEMAGAVFLASVGWFLVGWSIGYKQGVKDGFNRGRAAGLRWATDRVRNS*
Ga0164295_1035894833300013014FreshwaterMFTVLEMAGTVILASIGWFLVGWSIGFKEGVKDGFNRGRAAGLRWATDRVRNS*
Ga0181362_106463943300017723Freshwater LakeMFTILELSLVVIACSVGWFLVGWSMGYKEGVKDGFNRGRAAGMRAATDYVRSL
Ga0181365_103852913300017736Freshwater LakeLAMVVIACSAGWCLVGWSIGYKQGVKDGFNRGRAAGMRAATDYVRSL
Ga0181348_130350023300017784Freshwater LakeMFTILELALVVIGCSVGWFIVGWSIGYKEGVKDGFNRGRAAGMRAATDYVRSL
Ga0181359_113861923300019784Freshwater LakeMFTILELAMVVIACSAGWCLVGWSIGYKQGVKDGFNRGRAAGLRAATDYVRSL
Ga0181359_115811323300019784Freshwater LakeMFTILELAMVVIACSAGWCLVGWSIGYKQGVKDGFNRGRAAGMRAATDYVRSL
Ga0211729_1015717333300020172FreshwaterMFTILELAAVVIACSVGWFLVGWTIGFKEGVKDGFNRGRAAGLRAATE
Ga0211731_1052710633300020205FreshwaterMFTILELAAVVIACSVGWFLVGWTIGYKEGVKDGFNRGRAAGMRAATDYVRSL
Ga0211731_1079460523300020205FreshwaterMFTVLELAGAVILASIGWFMVGWSIGFKEGVKDGFNRGRAAGLRAATEIVRNS
Ga0211731_1110056843300020205FreshwaterMFTVLELAGAVILASIGWFLVGWSIGFKEGVKDGFNRGRAAGLRAATEIVRNS
Ga0208854_101683713300020517FreshwaterMFTILELAMVVIACSAGWFLVGWSIGYKQGVKDGFNRGRAAGMRAATDYVRSL
Ga0214162_100073583300021108FreshwaterMFTILELAAVVIACSAGWFLVGWSIGYKQGVKDGFNRGRAAGLRAATDYVRSL
Ga0214163_101034853300021141FreshwaterMFTVLELLVVVIIASVGWCLVGWSIGFKAGMKDGYNRGRAAGLRWATDRVRNS
Ga0244775_1000559233300024346EstuarineMFTILELAAVVIACSAGWCLVGWSIGYKQGVKDGFNRGRAAGMRAATDYVRSL
Ga0208303_109441413300025543AqueousMFTVVELAGAVILASVGWCLVGWSIGFKAGMKDGYNRGRAAGLRWATDRVRNS
Ga0208916_1000082853300025896AqueousMFTILELAAVVIACSVGWFLVGWTIGYKQGVKDGWQRGRAAGLRWATDRVRNS
Ga0208916_1002326643300025896AqueousMISIEKMLVLVLVSNVGWLLVGWTIGYKEGVKDGFNRGRAAGMRAATDYVRSL
Ga0255074_103864923300027121FreshwaterMFTILELAIISIVMSFAWCLVGWSIGYKQGVKDGWQRGRAAGLRWATDRVRNS
Ga0255064_102465423300027138FreshwaterLELAMVVIACSAGWCLVGWSIGYKQGVKDGFNRGRAAGMRAATDYVRSL
Ga0255078_104164013300027156FreshwaterMFTILELAMVVIACSAGWCLVGWSIGYKQGVKDGWQRGRAAGLRWATDRVRNS
Ga0255084_109146623300027488FreshwaterILELAMVVIACSAGWCLVGWSIGYKQGVKDGWQRGRAAGLRWATDRVRNS
Ga0209392_1000145163300027683Freshwater SedimentMFTILELAVVVVACSVGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERVRSY
Ga0209704_102975433300027693Freshwater SedimentMFTILELAVVVVACSVGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERLRSY
Ga0209297_106362753300027733Freshwater LakeMISIEKVLLVVIVSNVGWLLVGWSMGFKQGVKDGFNRGRAAGLRWATDRVKNS
Ga0209190_102886363300027736Freshwater LakeMFTVLELAGAVILASIGWFLVGWSIGFKEGVKDGFNRGRAAGLRWATDRVRNS
Ga0209596_100780833300027754Freshwater LakeMFTILELAAVVIACSVGWFLVGWTIGYKEGVKDGFNRGRAAGMRAATDYVKSL
Ga0209596_113710333300027754Freshwater LakeSGANMFTVVELAGAVILASVGWFLVGWSVGYKQGVKDGFNRGRAAGLRWATDRVRNS
Ga0209296_100487663300027759Freshwater LakeMISIEKVLLVVIVSNVGWLLVGWSMGFKQGVKDGFNRGRAAGLRWATDRVRNS
Ga0209088_1010344913300027763Freshwater LakeMISIEKVLLIVLVSNVGWLLVGWSMGFKQGVKDGFNRGRAAGLRWATDRVRNS
Ga0209820_102335253300027956Freshwater SedimentMFTILELAVVVVATSVGWFLVGWTIGYKEGVKDGFNRGRAAGMRAATNY
Ga0209400_105321923300027963Freshwater LakeMFTVVELAGAVILASVGWFLVGWSVGYKQGVKDGFNRGRAAGLRWATDRVRNS
(restricted) Ga0247844_103700343300028571FreshwaterMFTILELAAVVIATSIGWFLVGWSIGFKAGIKDGYNRGRAAGLRWATDRVRNS
Ga0315907_1027398333300031758FreshwaterMFTVLEMAGAVFLASVGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERVRSY
Ga0315288_1066409833300031772SedimentMFTILELAAVVIACSVGWFLVGWTIGYKEGVKDGFNRGRAAGMRAATEIVRNS
Ga0315290_1093474113300031834SedimentMFTILELALVVIACSVAWCLVGWTIGYKEGVKDGFNRGRAAGMRAATEIVRNS
Ga0315278_1029673323300031997SedimentMFTILELALVVIACSIAWCLVGWTIGYKEGVKDGFNRGRAAGMRAATEIVRNS
Ga0315274_1015881723300031999SedimentMFTILELALVVIACSVAWCLVGWSIGYKQGVKEGFIRGRSAGLRWATDRVRNS
Ga0315289_1089405923300032046SedimentMFTILELAAVVIASSVGWFLVGWTIGYKEGVKDGFNRGRAAGMRAATEIVRNS
Ga0315906_1020203113300032050FreshwaterHPESGANMFTVLEMAIAVFIAGIGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERLRSY
Ga0315903_1020391363300032116FreshwaterMFTVLEMAIAVFIAGIGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATE
Ga0315903_1021719513300032116FreshwaterLEMAIAVFIAGIGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERLRSY
Ga0315276_1227762923300032177SedimentGANKSHPESGAKMFTILELAMVVIVCSVAWCLVGWSIGYKQGVKEGFIRGRSAGLRWATDRVRNS
Ga0334979_0053545_711_8723300033996FreshwaterMFTILELAAVVIACSAGWFLVGWSIGYKQGVKDGFNRGRAAGMRAATDYVRSL
Ga0334986_0040357_355_5163300034012FreshwaterMFTVLEMAGAVLLASVGWFLVGWTVGFKEGVKDGFNRGRAAGMRAATDYVRSL
Ga0334987_0003987_4280_44413300034061FreshwaterMFTILELAAVVVACSVGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERLRSY
Ga0334995_0035409_2_1393300034062FreshwaterMFTVVELLVVVIIASVGWCLVGWSIGFKAGMKDGYNRGRAAGLRWA
Ga0334995_0519587_377_5383300034062FreshwaterMFTILELAAVVIATSIGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERLRSY
Ga0335019_0584016_234_3953300034066FreshwaterMFTILELSAVVIATSIGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERVRSY
Ga0334990_0644717_2_1333300034068FreshwaterMFTILELAAVVIATSVGWFLVGWTIGYKEGVKDGFNRGRAAGLR
Ga0335031_0806183_3_1493300034104FreshwaterELAAVVVACSVGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERLRSY
Ga0335036_0058621_2364_25253300034106FreshwaterMFTVLEMAGAVFLASVGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERLRSY
Ga0335036_0141731_131_2923300034106FreshwaterMFTVLELAGAVILASVGWCLVGWSIGFKAGMKDGYNRGRAAGLRWATDRVRNS
Ga0335036_0255281_193_3543300034106FreshwaterMFTILELAMVVIACSVVWCLVGWSIGYKQGVKDGFNRGRAAGMRAATDYVRSL
Ga0335036_0326280_115_2763300034106FreshwaterMFTVVEMAGAVILASVGWCLVGWSIGYKAGMKDGYNRGRAAGLRWATDRVRNS
Ga0335036_0575002_542_6853300034106FreshwaterMAIAVFIAGIGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERVRSY
Ga0335060_0099768_1606_17523300034122FreshwaterEMAGAVLLASVGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATERLRSY
Ga0335017_0173832_891_10523300034167FreshwaterMFTVVEMAGAVILASVGWCLVGWSMGYKVGLKDGFNRGRAAGLRWATDRVRNS
Ga0335007_0002767_9745_99063300034283FreshwaterMFTILELAVVVVACSVGWFLVGWTIGYKEGVKDGFNRGRAAGLRAATDRVRSY
Ga0335039_0317807_1_1353300034355FreshwaterMFTVVEMAGAVILASVGWCLVGWSMGYKVGLKDGFNRGRAAGLRW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.