Basic Information | |
---|---|
Family ID | F097315 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 46 residues |
Representative Sequence | EIVVIKLSKLVKDSDAGTEIATDDIVAALQSVAEELAGAGVVVEAERA |
Number of Associated Samples | 77 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 9.62 % |
% of genes near scaffold ends (potentially truncated) | 71.15 % |
% of genes from short scaffolds (< 2000 bps) | 79.81 % |
Associated GOLD sequencing projects | 71 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (75.000 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (25.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (67.308 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (74.038 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.74% β-sheet: 18.42% Coil/Unstructured: 61.84% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF10431 | ClpB_D2-small | 8.65 |
PF01909 | NTP_transf_2 | 2.88 |
PF01467 | CTP_transf_like | 2.88 |
PF07460 | NUMOD3 | 0.96 |
PF04055 | Radical_SAM | 0.96 |
PF00793 | DAHP_synth_1 | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.96 % |
Unclassified | root | N/A | 24.04 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001851|RCM31_10186614 | Not Available | 995 | Open in IMG/M |
3300002202|metazooDRAFT_1235831 | Not Available | 524 | Open in IMG/M |
3300002835|B570J40625_100058531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5326 | Open in IMG/M |
3300002835|B570J40625_100067941 | All Organisms → cellular organisms → Bacteria | 4773 | Open in IMG/M |
3300004792|Ga0007761_11160780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
3300005582|Ga0049080_10087277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1065 | Open in IMG/M |
3300005662|Ga0078894_10584076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
3300006484|Ga0070744_10140205 | Not Available | 695 | Open in IMG/M |
3300006805|Ga0075464_10567252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
3300007544|Ga0102861_1028088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1420 | Open in IMG/M |
3300007597|Ga0102919_1272879 | Not Available | 527 | Open in IMG/M |
3300008110|Ga0114343_1013570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5321 | Open in IMG/M |
3300008110|Ga0114343_1086276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1116 | Open in IMG/M |
3300008113|Ga0114346_1066949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2589 | Open in IMG/M |
3300008120|Ga0114355_1032330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3929 | Open in IMG/M |
3300008267|Ga0114364_1027233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4508 | Open in IMG/M |
3300008996|Ga0102831_1132752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
3300009152|Ga0114980_10649904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300009155|Ga0114968_10179243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1239 | Open in IMG/M |
3300009155|Ga0114968_10257936 | Not Available | 988 | Open in IMG/M |
3300009158|Ga0114977_10431671 | Not Available | 730 | Open in IMG/M |
3300009161|Ga0114966_10648096 | Not Available | 584 | Open in IMG/M |
3300009183|Ga0114974_10195229 | Not Available | 1239 | Open in IMG/M |
3300009684|Ga0114958_10478106 | Not Available | 599 | Open in IMG/M |
3300010158|Ga0114960_10453293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300010160|Ga0114967_10092591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1776 | Open in IMG/M |
3300010160|Ga0114967_10191545 | Not Available | 1106 | Open in IMG/M |
3300010354|Ga0129333_10732061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
3300010885|Ga0133913_10275918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4459 | Open in IMG/M |
3300010885|Ga0133913_10828032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2409 | Open in IMG/M |
3300010885|Ga0133913_11031074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2125 | Open in IMG/M |
3300010885|Ga0133913_12688973 | Not Available | 1204 | Open in IMG/M |
3300010885|Ga0133913_13277159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1066 | Open in IMG/M |
3300010885|Ga0133913_13277896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1066 | Open in IMG/M |
3300010885|Ga0133913_13282479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1065 | Open in IMG/M |
3300010885|Ga0133913_13354201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1051 | Open in IMG/M |
3300011010|Ga0139557_1002622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3997 | Open in IMG/M |
3300013004|Ga0164293_10333133 | Not Available | 1041 | Open in IMG/M |
3300013005|Ga0164292_10378096 | Not Available | 950 | Open in IMG/M |
3300013006|Ga0164294_10582767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
3300013286|Ga0136641_1183448 | Not Available | 557 | Open in IMG/M |
3300013295|Ga0170791_11246415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
3300013372|Ga0177922_10227411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1437 | Open in IMG/M |
3300017722|Ga0181347_1074684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
3300017723|Ga0181362_1061269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
3300017754|Ga0181344_1074315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1000 | Open in IMG/M |
3300017777|Ga0181357_1107442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1054 | Open in IMG/M |
3300017777|Ga0181357_1158337 | Not Available | 830 | Open in IMG/M |
3300017778|Ga0181349_1137801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 887 | Open in IMG/M |
3300017778|Ga0181349_1236402 | Not Available | 616 | Open in IMG/M |
3300017780|Ga0181346_1064229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1467 | Open in IMG/M |
3300017780|Ga0181346_1155199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 854 | Open in IMG/M |
3300017784|Ga0181348_1093391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1181 | Open in IMG/M |
3300017784|Ga0181348_1115742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1034 | Open in IMG/M |
3300017785|Ga0181355_1174492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
3300018048|Ga0181606_10497753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300018868|Ga0187844_10015159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4090 | Open in IMG/M |
3300019784|Ga0181359_1025600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2258 | Open in IMG/M |
3300020160|Ga0211733_10789994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
3300020160|Ga0211733_10806373 | Not Available | 756 | Open in IMG/M |
3300020161|Ga0211726_10593109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
3300020161|Ga0211726_10663242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1057 | Open in IMG/M |
3300020161|Ga0211726_10712462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
3300020161|Ga0211726_10963850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1323 | Open in IMG/M |
3300020162|Ga0211735_11458564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
3300020172|Ga0211729_10799717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2582 | Open in IMG/M |
3300020172|Ga0211729_11110448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
3300021963|Ga0222712_10657163 | Not Available | 597 | Open in IMG/M |
3300022179|Ga0181353_1015262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1986 | Open in IMG/M |
3300022190|Ga0181354_1209606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300022407|Ga0181351_1165140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
3300023174|Ga0214921_10000048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 225080 | Open in IMG/M |
3300023174|Ga0214921_10415655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300023184|Ga0214919_10023287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6787 | Open in IMG/M |
3300024346|Ga0244775_10110453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2334 | Open in IMG/M |
3300024346|Ga0244775_10786067 | Not Available | 762 | Open in IMG/M |
3300024346|Ga0244775_10912233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
3300025358|Ga0208504_1003652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2579 | Open in IMG/M |
3300027608|Ga0208974_1144061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
3300027631|Ga0208133_1145920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300027708|Ga0209188_1272113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300027746|Ga0209597_1148004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
3300027749|Ga0209084_1017375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4007 | Open in IMG/M |
3300027759|Ga0209296_1277727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
3300027816|Ga0209990_10463468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300027974|Ga0209299_1311888 | Not Available | 545 | Open in IMG/M |
3300028393|Ga0304728_1215701 | Not Available | 659 | Open in IMG/M |
3300028393|Ga0304728_1234510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300028394|Ga0304730_1223482 | Not Available | 696 | Open in IMG/M |
3300031787|Ga0315900_10063721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3793 | Open in IMG/M |
3300031787|Ga0315900_10849710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300032173|Ga0315268_12342867 | Not Available | 548 | Open in IMG/M |
3300032605|Ga0316232_1330052 | Not Available | 562 | Open in IMG/M |
3300034061|Ga0334987_0016224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6807 | Open in IMG/M |
3300034061|Ga0334987_0018667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6277 | Open in IMG/M |
3300034093|Ga0335012_0215360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1011 | Open in IMG/M |
3300034108|Ga0335050_0486078 | Not Available | 531 | Open in IMG/M |
3300034117|Ga0335033_0086874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1828 | Open in IMG/M |
3300034120|Ga0335056_0716568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300034272|Ga0335049_0328034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1026 | Open in IMG/M |
3300034279|Ga0335052_0400515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
3300034279|Ga0335052_0628482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300034284|Ga0335013_0772242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300034356|Ga0335048_0331917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 25.00% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.27% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.35% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.50% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.81% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 4.81% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.88% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.92% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.92% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.92% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.96% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.96% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.96% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.96% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.96% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.96% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.96% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.96% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.96% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
3300002202 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012 | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
RCM31_101866143 | 3300001851 | Marine Plankton | VSKLVKDSADTGTIVADDVVAALQSVAEELLGDAVVVEVERA* |
metazooDRAFT_12358311 | 3300002202 | Lake | LSKLVKDSDAGGEIATADIVAALQSVAEELAGAGVVVEAERA* |
B570J40625_1000585313 | 3300002835 | Freshwater | MAKIYEEVIIIKLSKLVKESDAGTTIASDDVVAAIATVAEELAGAGVVVEAERA* |
B570J40625_1000679417 | 3300002835 | Freshwater | VVIKLSKLVKDTDAGSEIATADIVAALQSVAEELVGAGVVVEADRA* |
Ga0007761_111607801 | 3300004792 | Freshwater Lake | VVIKLSKLIRDDDAGGEIATADIVAALQSVAEELAGAGVVVEADKA* |
Ga0049080_100872773 | 3300005582 | Freshwater Lentic | MAKIHQETVVITLSKLIKDNDAGVEIATADIVAALQSVAEELAGAGVVVEADKA* |
Ga0078894_105840763 | 3300005662 | Freshwater Lake | TTVDAIATDDIVTALQSVAEELAGAGVVVEADRA* |
Ga0070744_101402052 | 3300006484 | Estuarine | MAKIYEEVVVIKLSKLIKDSDPGTDIATADIVAALQSVAEELAGVGVVVEAERAQ* |
Ga0075464_105672521 | 3300006805 | Aqueous | KDTDAGSNIATPDIVAALQSVAEELVGAGVVVEADKA* |
Ga0102861_10280884 | 3300007544 | Estuarine | MAKIYTESVVITFSKLIRDDADVQAIATDDIVAALQSVAEELAGAGVVVEADRA* |
Ga0102919_12728792 | 3300007597 | Estuarine | MAKIYTESVVITFSKLIRDDADVQAIATDDIVVALQSVAEELAGAGVVVEADRA* |
Ga0114343_10135706 | 3300008110 | Freshwater, Plankton | LVKDSDAGTEIATDDIVAALQSVAEELAGTGVVVEAERA* |
Ga0114343_10862764 | 3300008110 | Freshwater, Plankton | EIVVIKLSKLVKDSDAGTEIATDDIVAALQSVAEELAGAGVVVEAERA* |
Ga0114346_10669495 | 3300008113 | Freshwater, Plankton | VVIKLSKLVKDSDAGTEIATDDIVAALQSVAEELAGTGVVVEAERA* |
Ga0114355_10323303 | 3300008120 | Freshwater, Plankton | VIKLSKLVKDSDQGGEIATPDIVAALQSVAEELAGAGVVVEAERA* |
Ga0114364_10272336 | 3300008267 | Freshwater, Plankton | KDDAAVDTIATDDIVTALQSVAEELAGAGVVVEADRA* |
Ga0102831_11327522 | 3300008996 | Estuarine | MAKIQEEVVVIKLSKLIRDNADVQAIATDDIVAALQSVAEELAGAGVVVEADRA* |
Ga0114980_106499041 | 3300009152 | Freshwater Lake | EEVVVIKLSKLVKDNDAGGEIATADIVAALQSVAEELAGAGVVVEADKA* |
Ga0114968_101792434 | 3300009155 | Freshwater Lake | IKLSKLIKENDAGAPIATDDIVAALASVAEELAGPSVIVEVDRA* |
Ga0114968_102579363 | 3300009155 | Freshwater Lake | VIKLSKLVKDNGDVEIIATEGIISALASVAEELAGAGIIVEAERA* |
Ga0114977_104316712 | 3300009158 | Freshwater Lake | MAKIHQETVVITLSKLIKDNDAGVEIATADIVAALQSVAEELVGAGVVVEADRA* |
Ga0114966_106480962 | 3300009161 | Freshwater Lake | IKLSKLVKDSDTGTEIVSDDTVTALQAVVEELTGAGIIVEVERA* |
Ga0114974_101952292 | 3300009183 | Freshwater Lake | MAKIYEEVVVIKLSKLVKNEDAGSEIATTDIVAALQSVAEELVGAGVVVEADKA* |
Ga0114958_104781061 | 3300009684 | Freshwater Lake | KLSKLVKDSDAGTEIVSDDTVTALQAVVEELAGAGIIVEVERA* |
Ga0114960_104532933 | 3300010158 | Freshwater Lake | KLSKLIRDDADVQAIATDDIVTALQSVAEELAGAGVVVEADRA* |
Ga0114967_100925911 | 3300010160 | Freshwater Lake | EEIVVIKLSKLIRDSDAGNEIISDDTITALQAVVEELTGAGIVVEVERA* |
Ga0114967_101915453 | 3300010160 | Freshwater Lake | VIKLSKLVKDSDAGTEIVSDDTVTALQAVVEELTGAGIIVEVERA* |
Ga0129333_107320611 | 3300010354 | Freshwater To Marine Saline Gradient | LSKLIRDNTTVDAIATDDIVTALQSVAEELAGAGVVVEADRA* |
Ga0133913_102759186 | 3300010885 | Freshwater Lake | KLVKDTDAGSDIATADIVAALQSVAEELVGAGVVVEADKA* |
Ga0133913_108280321 | 3300010885 | Freshwater Lake | LSKLVKDTDAGSDIATPDIVAALQSVAEELVGAGVVVEADRA* |
Ga0133913_110310745 | 3300010885 | Freshwater Lake | VIKLSKLVRESDVGVEIATDDIVSALQSVAEELAGAGIVVEAERA* |
Ga0133913_126889732 | 3300010885 | Freshwater Lake | MAKIYEEIVVIKLSKLIKDSDASTEIATPDIVAALQSVAEELAGAGVVVEAERA* |
Ga0133913_132771591 | 3300010885 | Freshwater Lake | KLSKLVKDSDAGTEIASDDIVAALQSVAEELAGAGVVVEAERA* |
Ga0133913_132778964 | 3300010885 | Freshwater Lake | SKLIRDDADVQAIATDDIVVALQSVAEELAGAGVVVEADRA* |
Ga0133913_132824793 | 3300010885 | Freshwater Lake | VIKLSKLVKDSDAGTEIVSDDTVTALQAVVEELTGAGIVVEVERA* |
Ga0133913_133542014 | 3300010885 | Freshwater Lake | SKLVKDSDAGGEIATADIVAALQSVAEELAGAGVVVEADKA* |
Ga0139557_10026222 | 3300011010 | Freshwater | MAKIYTESVVITFSKLIRDDTTVDAIATDDIVTALQSVAEELAGAGVVVEADRA* |
Ga0164293_103331333 | 3300013004 | Freshwater | MAKIHTESVVITFSKLVKESDSGATIATADIVSALAQVAEELAGAGVVVEVESAQ* |
Ga0164292_103780961 | 3300013005 | Freshwater | EEIVVIKLSKLVKDSDAGGEIATPDIVAALQSVAEELAGAGVVVEADKA* |
Ga0164294_105827671 | 3300013006 | Freshwater | VVVIKLSKLIRDDADVQAIATDDIVAALQSVAEELAGAGVVVEADRA* |
Ga0136641_11834482 | 3300013286 | Freshwater | DNTDIITTDDIIAALASVAEELAGPGVVVEAERA* |
Ga0170791_112464151 | 3300013295 | Freshwater | HEEIVVIKLSKLVRDTDAGTEIATADIVTALQSVAEELAGTGVVVEAERA* |
Ga0177922_102274111 | 3300013372 | Freshwater | MAKIHQETVVITLSKLIKDNDAGVEIATADIVAALQSVAEELAGAGVVVEADKVQ* |
Ga0181347_10746841 | 3300017722 | Freshwater Lake | KLIRDDTTVDAIATDDIVTALQSVAEELAGAGVVVEADRA |
Ga0181362_10612691 | 3300017723 | Freshwater Lake | RDDAGDDIATADIVAALQSVAEELTGPGVVVEADKVQ |
Ga0181344_10743151 | 3300017754 | Freshwater Lake | IVVIKLSKLVKDDAEVDAIATDDIVTALQSVAEELAGAGVVVEADRA |
Ga0181357_11074421 | 3300017777 | Freshwater Lake | MAKIHQETVVITLSKLIKDNDAGVEIATADIVAALQSVAEELVGAGVVV |
Ga0181357_11583372 | 3300017777 | Freshwater Lake | MAKIYSQSIVITFSKLVKDDVIPEPIPTPDIISSLASVAEELAGPGVVIEIERA |
Ga0181349_11378011 | 3300017778 | Freshwater Lake | VITLSKLIKDNDAGTEIATADIVAALQSVAEELVGAGVVVEADKVK |
Ga0181349_12364021 | 3300017778 | Freshwater Lake | IKLSKLVKDSDAGTEIVSDDTVTALQAVVEELTGAGIIVEVERA |
Ga0181346_10642293 | 3300017780 | Freshwater Lake | MVKIHEETVVITLSKLIKDNDAGIEIATADIVAALQSVAEELAGAGVVVEADKA |
Ga0181346_11551993 | 3300017780 | Freshwater Lake | LIRDDTTVDAIATDDIVTALQSVAEELAGAGVVVEADRA |
Ga0181348_10933911 | 3300017784 | Freshwater Lake | EKRKEKKLSKLIRDDTTVDAIATDDIVTALQSVAEELAGAGVVVEADRA |
Ga0181348_11157423 | 3300017784 | Freshwater Lake | AKIHQETVVITLSKLIKDNDAGVEIATADIVAALQSVAEELAGAGVVVEADKA |
Ga0181355_11744921 | 3300017785 | Freshwater Lake | RDTDAGTEIATADIVTALQSVAEELAGTGVVVEAERA |
Ga0181606_104977533 | 3300018048 | Salt Marsh | RDDATVEAIATDDIVAALQSVAEELAGAGVVVEADRA |
Ga0187844_100151592 | 3300018868 | Freshwater | MAKIHEELVVIKLSKLIKDAAPGGKLSTDDMLIALQAVAEELADSDIIVEIQQV |
Ga0181359_10256004 | 3300019784 | Freshwater Lake | MAKIHQETVVITLSKLIKDNDAGVEIATADIVAALQSVAEELAGAGVVVEADKA |
Ga0211733_107899943 | 3300020160 | Freshwater | IKLSKLVRDSDSVTVLAVDDVVLALQSVAEELLGAGVVVEAERAE |
Ga0211733_108063731 | 3300020160 | Freshwater | MAKIHEELVVIKLSKLVRDDAEVDTIATDDIVAALQSVAEELAGAGV |
Ga0211726_105931091 | 3300020161 | Freshwater | TDAGSDIATADIVAALQSVAEELVGAGVVVEADRA |
Ga0211726_106632421 | 3300020161 | Freshwater | MAKIHEEIVVIKLSKLVRDSDVGIEIATDDIVSALQSVAEELAGAG |
Ga0211726_107124623 | 3300020161 | Freshwater | EVVVIKLSKLVKDTDAGSDIATADIVAALQSVAEELVGAGVVVEADRA |
Ga0211726_109638503 | 3300020161 | Freshwater | VIKLSKLVKDTDAGDEIATADIVAALQSVAEELAGTGVVVEADKA |
Ga0211735_114585641 | 3300020162 | Freshwater | EELVVIKLSKLVKDNDAGDTIATPDIVAALQSVAEELAGAGVVVEADRAQ |
Ga0211729_107997175 | 3300020172 | Freshwater | VKDTDAGSDIATADIVAALQSVAEELVGAGVVVEADRA |
Ga0211729_111104481 | 3300020172 | Freshwater | SKLVKDTDAGSDIATADIVAALQSVAEELVGAGVVVEADKA |
Ga0222712_106571631 | 3300021963 | Estuarine Water | MAKIHEEIIVIKLSKLIKDSDVGSEIANDDVVAALQSVAEELAGAGVVV |
Ga0181353_10152624 | 3300022179 | Freshwater Lake | VKDSDAGTEIATDDIVAALQSVAEELAGAGVVVEAERA |
Ga0181354_12096062 | 3300022190 | Freshwater Lake | RKIVITLSKLVKDNASTEAIATEELVSALASVAEELAGAGIVVEANRA |
Ga0181351_11651402 | 3300022407 | Freshwater Lake | MAKIYEEVVVIKLSKLIKDSDPGTDIATADIVAALQSVAEELAGAGVVVEAERAQ |
Ga0214921_10000048163 | 3300023174 | Freshwater | MAKIQEEVVVIKLSKLIRDTDAGSEIATTDIVAALQSVAEELAGAGVVVEADKA |
Ga0214921_104156551 | 3300023174 | Freshwater | IKLSKLIRDNDAGGEIATADIVAALQSVAEELAGAGVVVEADKA |
Ga0214919_100232874 | 3300023184 | Freshwater | MAKIYTESIVITLSKLVRDSDVNAEIISDDTVQALQAVVEELTGAGIVVELERA |
Ga0244775_101104533 | 3300024346 | Estuarine | MAKIYEEVVVIKLSKLIKDSDPGTDIATADIVAALQSVAEELAGVGVV |
Ga0244775_107860672 | 3300024346 | Estuarine | MAKIYEEVVVIKLSKLIKDSDPGTDIATSDIVAALQSVAEELAGAGVVVEAERAQ |
Ga0244775_109122331 | 3300024346 | Estuarine | IKDTDAGIEIANAEIVAALQSVAEELAGAGVVVETDRA |
Ga0208504_10036522 | 3300025358 | Freshwater | MAQIYEEVIVIKLSKLLSNDAVGTAIATKDLEDALTAVAEELAGVGVVVEVERA |
Ga0208974_11440613 | 3300027608 | Freshwater Lentic | KLSKLVKDTDAGGEIATTDIVAALQSVAEELVGAGVVVEADKA |
Ga0208133_11459202 | 3300027631 | Estuarine | KIHEEIVVIKLSKLIKDSDSGSILANDEFVSALQSVAEELAGSGIVIEAERAQY |
Ga0209188_12721132 | 3300027708 | Freshwater Lake | VRDSDAGTEIATDDIVLALQSVAEELAGTGIVVEAERAQ |
Ga0209597_11480042 | 3300027746 | Freshwater Lake | EVIVITLSKLVKNDETPDAVATDDLVSALASVAEELAGAGIVVEANRA |
Ga0209084_10173754 | 3300027749 | Freshwater Lake | VIKLSKLVRDSDVNVEIISDDTVSALQAVVEELTGAGIVVELERA |
Ga0209296_12777271 | 3300027759 | Freshwater Lake | MAKIHQETVVITLSKLIKDNDAGVEIATADIVAALQSVAEELVGAGVVVEADRA |
Ga0209990_104634682 | 3300027816 | Freshwater Lake | IVVIKLSKLVKDSDAGTEIATDDIVAALQSVAEELAGTGVVVEAERA |
Ga0209299_13118881 | 3300027974 | Freshwater Lake | MAKIHEEVVVIKLSKLIKDSAAGEKLATDDMTAALQAVAEELAAAGVVV |
Ga0304728_12157011 | 3300028393 | Freshwater Lake | KLVKDSDAGTEIVSDDTVTALQAVVEELTGAGIIVEVERA |
Ga0304728_12345101 | 3300028393 | Freshwater Lake | KLSKLIRDDADVQAIATDDIVTALQSVAEELAGAGVVVEADRA |
Ga0304730_12234821 | 3300028394 | Freshwater Lake | EEIVVIKLSKLIRDSDAGNEIISDDTITALQAVVEELTGAGIVVEVERA |
Ga0315900_100637211 | 3300031787 | Freshwater | SKLVKDSDAGTEIATDDIVAALQSVAEELAGTGVVVEAERA |
Ga0315900_108497101 | 3300031787 | Freshwater | VIKLSKLIKDSDPGTDIATADIVAALQSVAEELAGAGVVVEAERAQ |
Ga0315268_123428671 | 3300032173 | Sediment | IHEEIVVIKLSKLIKDTDLGSVLASDEFVSALQSVAEELAGSGIVIEAERAQY |
Ga0316232_13300521 | 3300032605 | Freshwater | IKLSKLVKDTDNSDIITTDDIISSLASVAEELAGAGVVVEAERA |
Ga0334987_0016224_1248_1412 | 3300034061 | Freshwater | MAKIYEEVIIIKLSKLVKESDAGTTIASDDVVAAIATVAEELAGAGVVVEAERA |
Ga0334987_0018667_6137_6274 | 3300034061 | Freshwater | VIKLSKLVKDTDAGDEIATADIVAALQSVAEELAGAGVVVEADKA |
Ga0335012_0215360_889_1008 | 3300034093 | Freshwater | LVRDTDAGDEIATADIVAALQSVAEELAGAGVVVEADKA |
Ga0335050_0486078_372_530 | 3300034108 | Freshwater | KIYEEIVVIKLSKLIKDDTTPDTVATDDVLSALASVAEELAGPGVVVEVERA |
Ga0335033_0086874_2_112 | 3300034117 | Freshwater | DNDNTDIITTDDIIAALASVAEELAGAGVVVEAERA |
Ga0335056_0716568_354_491 | 3300034120 | Freshwater | LIKLSKLVKDTDAGDEIATADIVAALQSVAEELVGAGVVVEADRA |
Ga0335049_0328034_2_118 | 3300034272 | Freshwater | VRDTDAGDEIATADIVAALQSVAEELAGAGVVVEADKA |
Ga0335052_0400515_1_114 | 3300034279 | Freshwater | KDTDAGTEIATADIVTALQSVAEELAGTGVVVEAERA |
Ga0335052_0628482_377_514 | 3300034279 | Freshwater | VIKLSKLVKDTDAGDEIATADIVAALQSVAEELVGAGVVVEADRA |
Ga0335013_0772242_1_114 | 3300034284 | Freshwater | KDTDAGSEIATPDIVAALQSVAEELAGAGVVVEADKA |
Ga0335048_0331917_638_775 | 3300034356 | Freshwater | VIKLSKLVRDTDAGTEIATADIVTALQSVAEELAGTGVVVEAERA |
⦗Top⦘ |