| Basic Information | |
|---|---|
| Family ID | F097310 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MSKMKELLDEIINCDLCNGKGWLFAGNAIDYDVESCECNPNELEVNY |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 78.85 % |
| % of genes near scaffold ends (potentially truncated) | 24.04 % |
| % of genes from short scaffolds (< 2000 bps) | 85.58 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (48.077 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (26.923 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.962 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (66.346 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.28% β-sheet: 4.26% Coil/Unstructured: 74.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 2.88 |
| PF10902 | WYL_2 | 0.96 |
| PF04577 | Glyco_transf_61 | 0.96 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.96 |
| PF05118 | Asp_Arg_Hydrox | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.46 % |
| Unclassified | root | N/A | 36.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000882|FwDRAFT_10000226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6629 | Open in IMG/M |
| 3300000882|FwDRAFT_10005955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1490 | Open in IMG/M |
| 3300000928|OpTDRAFT_10220741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300003277|JGI25908J49247_10044423 | Not Available | 1184 | Open in IMG/M |
| 3300003388|JGI25910J50241_10051115 | All Organisms → Viruses → Predicted Viral | 1283 | Open in IMG/M |
| 3300003393|JGI25909J50240_1029223 | Not Available | 1218 | Open in IMG/M |
| 3300003394|JGI25907J50239_1036464 | Not Available | 1036 | Open in IMG/M |
| 3300003404|JGI25920J50251_10004413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5036 | Open in IMG/M |
| 3300003404|JGI25920J50251_10042791 | Not Available | 1248 | Open in IMG/M |
| 3300003411|JGI25911J50253_10012722 | All Organisms → Viruses → Predicted Viral | 3190 | Open in IMG/M |
| 3300003429|JGI25914J50564_10115421 | Not Available | 659 | Open in IMG/M |
| 3300003493|JGI25923J51411_1046755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
| 3300003497|JGI25925J51416_10015163 | All Organisms → Viruses → Predicted Viral | 2303 | Open in IMG/M |
| 3300004124|Ga0066178_10163691 | Not Available | 630 | Open in IMG/M |
| 3300004836|Ga0007759_10205330 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
| 3300005069|Ga0071350_1045285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1672 | Open in IMG/M |
| 3300005517|Ga0070374_10088315 | Not Available | 1615 | Open in IMG/M |
| 3300005580|Ga0049083_10023378 | All Organisms → Viruses → Predicted Viral | 2224 | Open in IMG/M |
| 3300005580|Ga0049083_10242739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300005581|Ga0049081_10216861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300005583|Ga0049085_10101550 | Not Available | 992 | Open in IMG/M |
| 3300005584|Ga0049082_10028808 | All Organisms → Viruses → Predicted Viral | 1937 | Open in IMG/M |
| 3300005584|Ga0049082_10325264 | Not Available | 510 | Open in IMG/M |
| 3300005662|Ga0078894_11558957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300005662|Ga0078894_11734840 | Not Available | 511 | Open in IMG/M |
| 3300005955|Ga0073922_1043795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300006040|Ga0073914_10006417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1950 | Open in IMG/M |
| 3300006484|Ga0070744_10170468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300006484|Ga0070744_10250105 | Not Available | 501 | Open in IMG/M |
| 3300007547|Ga0102875_1124914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
| 3300007559|Ga0102828_1003289 | Not Available | 3019 | Open in IMG/M |
| 3300007562|Ga0102915_1150354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| 3300007585|Ga0102916_1174997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300007606|Ga0102923_1028206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1761 | Open in IMG/M |
| 3300007621|Ga0102872_1096664 | Not Available | 793 | Open in IMG/M |
| 3300007621|Ga0102872_1181034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300007627|Ga0102869_1211511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300007658|Ga0102898_1162736 | Not Available | 526 | Open in IMG/M |
| 3300008052|Ga0102893_1031109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1633 | Open in IMG/M |
| 3300008107|Ga0114340_1211151 | Not Available | 638 | Open in IMG/M |
| 3300008116|Ga0114350_1153938 | Not Available | 636 | Open in IMG/M |
| 3300008262|Ga0114337_1089521 | All Organisms → Viruses → Predicted Viral | 3178 | Open in IMG/M |
| 3300008262|Ga0114337_1159839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1590 | Open in IMG/M |
| 3300008950|Ga0102891_1085890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 957 | Open in IMG/M |
| 3300008996|Ga0102831_1171488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
| 3300008999|Ga0102816_1132793 | Not Available | 768 | Open in IMG/M |
| 3300009002|Ga0102810_1217887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300009026|Ga0102829_1052902 | Not Available | 1221 | Open in IMG/M |
| 3300009026|Ga0102829_1192420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300009068|Ga0114973_10382053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
| 3300009152|Ga0114980_10813281 | Not Available | 519 | Open in IMG/M |
| 3300009155|Ga0114968_10216976 | All Organisms → Viruses → Predicted Viral | 1101 | Open in IMG/M |
| 3300009161|Ga0114966_10447581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
| 3300009187|Ga0114972_10279847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
| 3300012663|Ga0157203_1001153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6659 | Open in IMG/M |
| 3300013372|Ga0177922_11171058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
| 3300019784|Ga0181359_1123300 | Not Available | 924 | Open in IMG/M |
| 3300020151|Ga0211736_10227362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300020160|Ga0211733_10019121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 829 | Open in IMG/M |
| 3300020161|Ga0211726_10560524 | Not Available | 631 | Open in IMG/M |
| 3300021079|Ga0194055_10182782 | Not Available | 851 | Open in IMG/M |
| 3300021519|Ga0194048_10007053 | Not Available | 5276 | Open in IMG/M |
| 3300021602|Ga0194060_10053746 | All Organisms → Viruses → Predicted Viral | 2334 | Open in IMG/M |
| 3300021962|Ga0222713_10289253 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300022752|Ga0214917_10006047 | Not Available | 12715 | Open in IMG/M |
| 3300023174|Ga0214921_10469859 | Not Available | 611 | Open in IMG/M |
| 3300024343|Ga0244777_10398425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
| 3300024346|Ga0244775_10197746 | All Organisms → Viruses → Predicted Viral | 1687 | Open in IMG/M |
| 3300024346|Ga0244775_10276961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1394 | Open in IMG/M |
| 3300024346|Ga0244775_10637717 | Not Available | 862 | Open in IMG/M |
| 3300024346|Ga0244775_11272102 | Not Available | 570 | Open in IMG/M |
| 3300024348|Ga0244776_10236960 | All Organisms → Viruses → Predicted Viral | 1276 | Open in IMG/M |
| 3300024485|Ga0256318_1102513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300024531|Ga0255228_1125569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300026415|Ga0256298_1052088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300026425|Ga0256300_1039018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| 3300026429|Ga0255253_1067761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300026435|Ga0256297_1048629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300027219|Ga0208167_1066522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| 3300027258|Ga0208558_1051218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300027278|Ga0208439_1093891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300027294|Ga0208441_1028625 | All Organisms → Viruses → Predicted Viral | 1338 | Open in IMG/M |
| 3300027302|Ga0255096_1001028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12217 | Open in IMG/M |
| 3300027468|Ga0209247_1018244 | Not Available | 948 | Open in IMG/M |
| 3300027534|Ga0255125_1090411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
| 3300027563|Ga0209552_1000209 | Not Available | 18535 | Open in IMG/M |
| 3300027563|Ga0209552_1038744 | Not Available | 1380 | Open in IMG/M |
| 3300027563|Ga0209552_1069822 | Not Available | 970 | Open in IMG/M |
| 3300027586|Ga0208966_1030475 | All Organisms → Viruses → Predicted Viral | 1571 | Open in IMG/M |
| 3300027621|Ga0208951_1042456 | Not Available | 1348 | Open in IMG/M |
| 3300027621|Ga0208951_1082844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300027627|Ga0208942_1115959 | Not Available | 748 | Open in IMG/M |
| 3300027679|Ga0209769_1148192 | Not Available | 743 | Open in IMG/M |
| 3300027707|Ga0209443_1061130 | Not Available | 1505 | Open in IMG/M |
| 3300027756|Ga0209444_10040689 | All Organisms → Viruses → Predicted Viral | 2159 | Open in IMG/M |
| 3300027760|Ga0209598_10171234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 944 | Open in IMG/M |
| 3300027764|Ga0209134_10131689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
| 3300027772|Ga0209768_10411779 | Not Available | 534 | Open in IMG/M |
| 3300027804|Ga0209358_10146470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1266 | Open in IMG/M |
| 3300027804|Ga0209358_10260688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 868 | Open in IMG/M |
| 3300027892|Ga0209550_10196255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1382 | Open in IMG/M |
| 3300027963|Ga0209400_1005322 | Not Available | 8870 | Open in IMG/M |
| 3300027971|Ga0209401_1130108 | All Organisms → Viruses → Predicted Viral | 1004 | Open in IMG/M |
| 3300031963|Ga0315901_11246474 | Not Available | 500 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 26.92% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 21.15% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 9.62% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.69% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 7.69% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 5.77% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.85% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.92% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 1.92% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.96% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.96% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005069 | Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024 | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
| 3300006040 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_30-Apr-14 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007585 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
| 3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
| 3300007658 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 | Environmental | Open in IMG/M |
| 3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009002 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300021079 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-9m | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024485 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024531 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026415 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026425 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026429 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026435 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027219 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027258 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027278 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes) | Environmental | Open in IMG/M |
| 3300027294 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027302 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8d | Environmental | Open in IMG/M |
| 3300027468 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027534 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FwDRAFT_1000022620 | 3300000882 | Freshwater And Marine | MAKMKELLDEILNCDLCNGKGWVFFGNAKEYDVESCECNPNELEVNY* |
| FwDRAFT_100059555 | 3300000882 | Freshwater And Marine | MSKMKQLLDEIINCDLCNGKGWQFFGNAEEYDVESCECNPNELEVNY* |
| OpTDRAFT_102207411 | 3300000928 | Freshwater And Marine | LDEIINCDLCNGKGWQFFGNAEEYDVESCECNPNELEVNY* |
| JGI25908J49247_100444232 | 3300003277 | Freshwater Lake | MGKMKELFTEIANCDLCNGKGWLFFGDATNYDVESCECNPKELEINY* |
| JGI25910J50241_100511152 | 3300003388 | Freshwater Lake | MGKMKELFTEIINCDLCNGKGWLFAGNAIDXDVXXCECNPKELEVNY* |
| JGI25909J50240_10292232 | 3300003393 | Freshwater Lake | MGKMKQLFTEIANCDLCNGKGWLFFGDATNYDVESCECNPKELEINY* |
| JGI25907J50239_10364644 | 3300003394 | Freshwater Lake | MGKMKXLFTEIANCDLCNGKGWLFFGDATNYDVESCECNPKELEINY* |
| JGI25920J50251_1000441310 | 3300003404 | Freshwater Lake | MGKMKXLFTEIXNCDLCNGKGWLFFGXATNYDVESCECNPKELEINY* |
| JGI25920J50251_100427913 | 3300003404 | Freshwater Lake | MGKMKELFTEIINCDLCNGKGWLFAGNAIDYDVESCECNPKELEVNY* |
| JGI25911J50253_100127226 | 3300003411 | Freshwater Lake | MGKMKELFTEIINCDLCNGKGWLFAGNAIDXDVESCECNPKELEVNY* |
| JGI25914J50564_101154213 | 3300003429 | Freshwater Lake | MSKMKELLDEILNCDLCNGKGWVFFGNATEYDVEACECNPNELEVNY* |
| JGI25923J51411_10467553 | 3300003493 | Freshwater Lake | MSKMKQLLDEIINCDLCNGKGWLFAGNAIDYDVEACECNPNGLEVNY* |
| JGI25925J51416_100151634 | 3300003497 | Freshwater Lake | MSKMKELLDEILNCDLCNGKGWVFFGNAXEYDVEACECNPNELEVNY* |
| Ga0066178_101636913 | 3300004124 | Freshwater Lake | MGKMKELFTEIVNCDLCNGKGWLFFGDATNYDVESCECNPKELEINY* |
| Ga0007759_102053302 | 3300004836 | Freshwater Lake | MAKVKQLLDEILNCDLCNGKGWQFFGNAIEYDVEACECNPNELEVDF* |
| Ga0071350_10452855 | 3300005069 | Freshwater | MAKMKQLLDEIINCDLCNGKGWQFFGNATEYDVEACECNPNELEVNY* |
| Ga0070374_100883153 | 3300005517 | Freshwater Lake | MGKMKELFTEIVNCDLCNGKGWLFFGNATNYDVESCECNPKELEINY* |
| Ga0049083_100233787 | 3300005580 | Freshwater Lentic | MAKMKELLDEILNCDLCNGKGWLFFGDATNYDVESCECNPKELETNY* |
| Ga0049083_102427391 | 3300005580 | Freshwater Lentic | MGKMKELFTEIINCDLCNGKGWLFAGNAVEYDVEACECNPHSLEVNN* |
| Ga0049081_102168614 | 3300005581 | Freshwater Lentic | MAKMKQLLDEIINCDLCNGKGWQFYGNATEYDVEACECNPSELEVNY* |
| Ga0049085_101015504 | 3300005583 | Freshwater Lentic | MGKMKELFTEIINCDLCNGKGWLFAGNAIDYDVEVCECNPKELEVNY* |
| Ga0049082_100288083 | 3300005584 | Freshwater Lentic | MAKVKQLLDEILNCDLCNGKGWLFAGNAIDYDVEACECNPNELEVNY* |
| Ga0049082_103252641 | 3300005584 | Freshwater Lentic | MGKMKELFTEIINCDLCNGKGWLFFGNAKDYDVEACECNPKELEVNN* |
| Ga0078894_115589571 | 3300005662 | Freshwater Lake | INCDLCNGKGWQFFGNATEYDVEACECNPNDLEVNY* |
| Ga0078894_117348402 | 3300005662 | Freshwater Lake | MAKVKQLLDEILNCDLCNGKGWVFFGNAKEYDVESCECNPNELQVNY* |
| Ga0073922_10437952 | 3300005955 | Sand | MAKMKQLLDEIINCDLCNGKGWQFYGNATEYDVEACECNPNELEVNY* |
| Ga0073914_100064171 | 3300006040 | Sand | INCDLCNGKGWLFAGNATDYDVESCICNPQELEINY* |
| Ga0070744_101704682 | 3300006484 | Estuarine | MSKMKQLLDEIINCDLCNGKGWQFFGNATDYDVEACECNPNELEVNY* |
| Ga0070744_102501052 | 3300006484 | Estuarine | MGKMKELYTEIINCDLCNGKGWLFAGNATDYDVESCICNP |
| Ga0102875_11249142 | 3300007547 | Estuarine | MSKMKQLLDEIINCDLCNGKGWLFAGNAIDYDVEACECNPNELEVNY* |
| Ga0102828_10032899 | 3300007559 | Estuarine | MGKMKELFTEIINCDLCNGKGWLFAGNATDYDVESCECNPKELEINY* |
| Ga0102915_11503541 | 3300007562 | Estuarine | RKTKMGKMKELYTEIINCDLCNGKGWLFAGNSIEYDVEACECNPHSLEVNN* |
| Ga0102916_11749971 | 3300007585 | Estuarine | ELYTEIINCDLCNGKGWLFAGNSIEYDVEACECNPHSLEVNN* |
| Ga0102923_10282067 | 3300007606 | Estuarine | MAKMKELLDEILNCDLCNGKGWLFAGNSIEYDVEACECNPHSLEVNN* |
| Ga0102872_10966642 | 3300007621 | Estuarine | MGKMKELFTEIINCDLCNGKGWLFAGNAIDYDVEACECNPNELEVNY* |
| Ga0102872_11810343 | 3300007621 | Estuarine | ERKTKMGKMKELYTEIINCDLCNGKGWLFAGNSIEYDVEACECNPHSLEVNN* |
| Ga0102869_12115114 | 3300007627 | Estuarine | MSKMKQLLDEIINCDLCNGKGWLFAGNAIDYDVEACE |
| Ga0102898_11627363 | 3300007658 | Estuarine | MSKMKELLDEIINCDNCNGKGWLFAGNSIEYDVEACECNPHSLEVNN* |
| Ga0102893_10311094 | 3300008052 | Estuarine | MSKMKELLDEILNCDLCNGKSWVFFGNAKEYDVESCECNPNELEVNY* |
| Ga0114340_12111512 | 3300008107 | Freshwater, Plankton | MSKMKQLLDEIINCDLCNGKGWQFFGNAKEYDVESCECNPNELEVNY* |
| Ga0114350_11539382 | 3300008116 | Freshwater, Plankton | MGKMKELITEIVNCDLCNGKGWLFFGDATNYDVESCECNPKELEINY* |
| Ga0114337_10895211 | 3300008262 | Freshwater, Plankton | KMKQLLDEIINCDLCNGKGWQFFGNATEYDVEACECNPNELEVNY* |
| Ga0114337_11598391 | 3300008262 | Freshwater, Plankton | MSKMKQLLDEIINCDLCNGKGWQFFGNATEYDVEACECNP |
| Ga0102891_10858901 | 3300008950 | Estuarine | EIINCDLCNGKGWLFAGNSIEYDVEACECNPHSLEVNN* |
| Ga0102831_11714881 | 3300008996 | Estuarine | IINCDLCNGKGWLFAGNAIDYDVEACECNPNELEVNY* |
| Ga0102816_11327933 | 3300008999 | Estuarine | MGKMKELFTEIINCDLCNGKGWLFAGNAKDYDVEACECNPHNLEVNN* |
| Ga0102810_12178871 | 3300009002 | Estuarine | TKMGKMKELYTEIINCDLCNGNGWLFAGNSIEYDVEACECNPHSLEVNN* |
| Ga0102829_10529022 | 3300009026 | Estuarine | MGKMKELYTEIINCDLCNGKGWLFAGNATDYDVESCICNPQELEINY* |
| Ga0102829_11924203 | 3300009026 | Estuarine | MSKMKELLDEIINCDNCNGKGWLFAGNTLDYDVEACECNPNELEVNN* |
| Ga0114973_103820531 | 3300009068 | Freshwater Lake | LLDEILNCDLCNGKGWVFFGNAKEYDVESCECNPNELEVNY* |
| Ga0114980_108132811 | 3300009152 | Freshwater Lake | MGKMKELISEIVNCDLCNGKGWLFFGDATNYDVESCECNPKELEINY* |
| Ga0114968_102169764 | 3300009155 | Freshwater Lake | NYNSTKRKGKPKMSKMKQLLDEILNCDLCNGKGWVFFGNAKEYDVESCECNPNELDVNY* |
| Ga0114966_104475813 | 3300009161 | Freshwater Lake | MSKMKQLLDEILNCDLCNGKGWVFFGNAKEYDVESCECNPNELDVNY* |
| Ga0114972_102798472 | 3300009187 | Freshwater Lake | MSKMKQLLDEILNCDLCNGKGWVFFGNAKEYDVESCECNPNELEVNY* |
| Ga0157203_100115310 | 3300012663 | Freshwater | MGKVKQLLDEILNCDLCNGKGWLFAGNTLDYDVEACECNPNEFEVNY* |
| Ga0177922_111710583 | 3300013372 | Freshwater | VSAICYNYNSTKRKGKPKMSKMKQLLDEIINCDNCNGKGWLFAGNTLDYDVEACECNPNELEVNY* |
| Ga0181359_11233001 | 3300019784 | Freshwater Lake | MGKMKELFTEIANCDLCNGKGWLFFGDATNYDVESCECNPKELEINY |
| Ga0211736_102273622 | 3300020151 | Freshwater | MKQLLDEIINCDLCNGKGWLFAGNAIDYDVEACECNPNELEVNY |
| Ga0211733_100191212 | 3300020160 | Freshwater | MSKMKQLLDEIINCDNCNGKGWLFAGNTLDYDVEACECNPNELEVNY |
| Ga0211726_105605243 | 3300020161 | Freshwater | MGKMKELFTEIISCDLCNGKGWLFFGDATNYDVESCECNPKELEINY |
| Ga0194055_101827823 | 3300021079 | Anoxic Zone Freshwater | MGKMKELFTEIINCDLCNGKGWLFAGNATDYDVESCECNPKELEINY |
| Ga0194048_100070537 | 3300021519 | Anoxic Zone Freshwater | MSKMKELLDEIINCDLCNGKGWLFAGNAIDYDVESCECNPNELEVNY |
| Ga0194060_100537467 | 3300021602 | Anoxic Zone Freshwater | MKELLDEIINCDLCNGKGWLFAGNAIDYDVESCECNPNELEVNY |
| Ga0222713_102892534 | 3300021962 | Estuarine Water | MSKMKQLLDEIINCDLCNGKGWQFFGNAEEYDVESCECNPNELEVNY |
| Ga0214917_1000604731 | 3300022752 | Freshwater | MSKMKELLDEILNCDLCNGKGWVFFGNATEYDVESCECNPNELEVNY |
| Ga0214921_104698592 | 3300023174 | Freshwater | MGKMKELFTEIINCDLCNGKGWLFAGNAKDYDVEACECNPHSIEVNN |
| Ga0244777_103984254 | 3300024343 | Estuarine | MAKMKELLDEILNCDLCNGKGWVFFGNAKEYDVESCECNPNELEVNY |
| Ga0244775_101977464 | 3300024346 | Estuarine | MGKMKELFTEIINCDLCNGKGWLFAGNAKDYDVEACECNPHNLEVNN |
| Ga0244775_102769614 | 3300024346 | Estuarine | MSKMKQLLDEIINCDLCNGKGWLFAGNAIDYDVEACECNPNELEVNY |
| Ga0244775_106377171 | 3300024346 | Estuarine | MGKMKELFTEIINCDLCNGKGWLFAGNAKDYDVEACECNPHKLEVNN |
| Ga0244775_112721023 | 3300024346 | Estuarine | MSKMKQLLDEIINCDLCNGKGWQFFGNATDYDVEACECNPNELEVNY |
| Ga0244776_102369603 | 3300024348 | Estuarine | MSKMKELLDEIINCDNCNGKGWLFAGNTLDYDVEACECNPNELEVNN |
| Ga0256318_11025131 | 3300024485 | Freshwater | KMKQLLDEIINCDLCNGKGWQFFGNATEYDVEACECNPNELEVNY |
| Ga0255228_11255691 | 3300024531 | Freshwater | KMKELLDEILNCDLCNGKGWVFFGNAKEYDVESCECNPNELEVNY |
| Ga0256298_10520882 | 3300026415 | Freshwater | MKQLLDEIINCDLCNGKGWQFFGNATEYDVEACECNPNELEVNY |
| Ga0256300_10390181 | 3300026425 | Freshwater | MGKMKELFTEIINCDLCNGKGWLFAGNAKDYDVEACECNPHSLEVNN |
| Ga0255253_10677613 | 3300026429 | Freshwater | MAKMKQLLDEIINCDLCNGKGWQFFGNATEYDVEACECNPNELE |
| Ga0256297_10486292 | 3300026435 | Freshwater | MAKMKQLLDEIINCDLCNGKGWQFFGNAEEYDVESCECNPNELEVNY |
| Ga0208167_10665222 | 3300027219 | Estuarine | MSKMKQLLDEIINCDLCNGKGWLFAGNSIEYDVEACECNPHSLEVNN |
| Ga0208558_10512181 | 3300027258 | Estuarine | KELYTEIINCDLCNGKGWLFAGNSIEYDVEACECNPHSLEVNN |
| Ga0208439_10938914 | 3300027278 | Estuarine | MSKMKQLLDEIINCDLCNGKGWLFAGNAIDYDVEACECN |
| Ga0208441_10286254 | 3300027294 | Estuarine | MGKMKELYTEIINCDLCNGKGWLFAGNSIEYDVEACECNPHS |
| Ga0255096_100102831 | 3300027302 | Freshwater | MAKMKQLLDEIINCDLCNGKGWQFYGNATEYDVEACECNPNELEVNY |
| Ga0209247_10182444 | 3300027468 | Freshwater Lake | MGKMKELFTEIINCDLCNGKGWLFAGNAIDYDVESCECNPKELEVNY |
| Ga0255125_10904111 | 3300027534 | Freshwater | AKMKQLLDEIINCDLCNGKGWQFFGNATEYDVEACECNPNELEVNY |
| Ga0209552_10002099 | 3300027563 | Freshwater Lake | MSKMKELLDEILNCDLCNGKGWVFFGNATEYDVEACECNPNELEVNY |
| Ga0209552_10387443 | 3300027563 | Freshwater Lake | MGKMKQLFTEIANCDLCNGKGWLFFGDATNYDVESCECNPKELEINY |
| Ga0209552_10698222 | 3300027563 | Freshwater Lake | MAKVKQLLDEILNCDLCNGKGWQFFGNAIEYDVEACECNPNELEVDF |
| Ga0208966_10304753 | 3300027586 | Freshwater Lentic | MGKMKELFTEIVNCDLCNGKGWLFFGDATNYDVESCECNPKELEINY |
| Ga0208951_10424564 | 3300027621 | Freshwater Lentic | MAKMKELLDEILNCDLCNGKGWLFFGDATNYDVESCECNPKELETNY |
| Ga0208951_10828444 | 3300027621 | Freshwater Lentic | MGKMKELFTEIINCDLCNGKGWLFAGNAVEYDVEACECNPHSLEVNN |
| Ga0208942_11159592 | 3300027627 | Freshwater Lentic | MGKMKELFTEIINCDLCNGKGWLFAGNAIDYDVEVCECNPKELEVNY |
| Ga0209769_11481924 | 3300027679 | Freshwater Lake | MGKMKELFTEIANCDLCNGKGWLFFGDATNYDVESCECNPK |
| Ga0209443_10611303 | 3300027707 | Freshwater Lake | MGKMKELFTEIVNCDLCNGKGWLFFGNATNYDVESCECNPKELEINY |
| Ga0209444_100406899 | 3300027756 | Freshwater Lake | MAKVKQLLDEILNCDLCNGKGWQFFGNAIEYDVEACECNPNELEVNY |
| Ga0209598_101712346 | 3300027760 | Freshwater Lake | MSKMKELLDEILNCDLCNGKGWVFFGNAKEYDVESCECNPNELEVNY |
| Ga0209134_101316891 | 3300027764 | Freshwater Lake | MAKVKQLLDEILNCDLCNGKGWLFAGNTLDYDVEACECNPNELEVNY |
| Ga0209768_104117792 | 3300027772 | Freshwater Lake | MKELFTEIANCDLCNGKGWLFFGDATNYDVESCECNPKELEINY |
| Ga0209358_101464704 | 3300027804 | Freshwater Lake | MSKMKQLLDEIINCDLCNGKGWQFFGNATEYDVEACECNPNDLEVNY |
| Ga0209358_102606882 | 3300027804 | Freshwater Lake | MGRMKQLLDEIINCDLCNGKGWQFFGNATEYDVEACECNPNGLEVNY |
| Ga0209550_101962556 | 3300027892 | Freshwater Lake | MAKVKQLLDEILNCDLCNGKGWLFAGNALDYDVESCECNPNELEVNY |
| Ga0209400_100532223 | 3300027963 | Freshwater Lake | MSKMKQLLDEILNCDLCNGKGWVFFGNAKEYDVESCECNPNELDVNY |
| Ga0209401_11301082 | 3300027971 | Freshwater Lake | MSKMKQLLDEILNCDLCNGKGWVFFGNAKEYDVESCECNPNELEVNY |
| Ga0315901_112464744 | 3300031963 | Freshwater | MAKMKQLLDEIINCDLCNGKGWHFFGNATEYDVEACECNPNELEVNY |
| ⦗Top⦘ |