NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097277

Metagenome / Metatranscriptome Family F097277

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097277
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 44 residues
Representative Sequence LLAPDGLLVYETSGREDPPDVPGLEVRTSRKYGSARLTLFEH
Number of Associated Samples 99
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.04 %
% of genes from short scaffolds (< 2000 bps) 95.19 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.67

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (51.923 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.539 % of family members)
Environment Ontology (ENVO) Unclassified
(35.577 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(49.038 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 30.00%    Coil/Unstructured: 70.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.67
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF01467CTP_transf_like 91.35
PF03602Cons_hypoth95 2.88
PF02620YceD 1.92
PF07883Cupin_2 0.96
PF01609DDE_Tnp_1 0.96
PF00171Aldedh 0.96
PF00583Acetyltransf_1 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG074216S rRNA G966 N2-methylase RsmDTranslation, ribosomal structure and biogenesis [J] 2.88
COG109223S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmITranslation, ribosomal structure and biogenesis [J] 2.88
COG2242Precorrin-6B methylase 2Coenzyme transport and metabolism [H] 2.88
COG2265tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD familyTranslation, ribosomal structure and biogenesis [J] 2.88
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 2.88
COG139923S rRNA accumulation protein YceD (essential in plants, uncharacterized in bacteria)Translation, ribosomal structure and biogenesis [J] 1.92
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.96
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.96
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.96
COG3293TransposaseMobilome: prophages, transposons [X] 0.96
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.96
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.96
COG5421TransposaseMobilome: prophages, transposons [X] 0.96
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.96
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms51.92 %
UnclassifiedrootN/A48.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2070309009|GPKNP_GG3DY5401EULG0Not Available512Open in IMG/M
2170459008|GA8OVOZ01A3ZP9Not Available517Open in IMG/M
3300000955|JGI1027J12803_109570375All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300001536|A1565W1_11078654Not Available604Open in IMG/M
3300001538|A10PFW1_10073868Not Available735Open in IMG/M
3300003996|Ga0055467_10208541Not Available605Open in IMG/M
3300004157|Ga0062590_100756296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria886Open in IMG/M
3300005093|Ga0062594_101233784All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300005181|Ga0066678_10161508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1409Open in IMG/M
3300005329|Ga0070683_100542807All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300005337|Ga0070682_101790640All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300005365|Ga0070688_101194316Not Available611Open in IMG/M
3300005366|Ga0070659_102051209Not Available514Open in IMG/M
3300005437|Ga0070710_10745612All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300005438|Ga0070701_10452200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria825Open in IMG/M
3300005445|Ga0070708_100900145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales831Open in IMG/M
3300005455|Ga0070663_102137090Not Available505Open in IMG/M
3300005535|Ga0070684_100128523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2284Open in IMG/M
3300005616|Ga0068852_101171014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria790Open in IMG/M
3300005617|Ga0068859_100722905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1086Open in IMG/M
3300005888|Ga0075289_1017006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1017Open in IMG/M
3300006605|Ga0074057_12141648All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300006871|Ga0075434_101049489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria829Open in IMG/M
3300007076|Ga0075435_100840944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria800Open in IMG/M
3300009147|Ga0114129_12073556Not Available686Open in IMG/M
3300009176|Ga0105242_10860899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium903Open in IMG/M
3300010046|Ga0126384_10611012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales956Open in IMG/M
3300010337|Ga0134062_10506529Not Available608Open in IMG/M
3300010361|Ga0126378_11733391Not Available710Open in IMG/M
3300010362|Ga0126377_11022690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales893Open in IMG/M
3300010366|Ga0126379_13704178Not Available512Open in IMG/M
3300010373|Ga0134128_12624780Not Available555Open in IMG/M
3300011270|Ga0137391_10286189Not Available1423Open in IMG/M
3300012200|Ga0137382_10466439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter895Open in IMG/M
3300012202|Ga0137363_10818141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia790Open in IMG/M
3300012209|Ga0137379_11051450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales719Open in IMG/M
3300012356|Ga0137371_11198149Not Available567Open in IMG/M
3300012476|Ga0157344_1022433Not Available554Open in IMG/M
3300012918|Ga0137396_10495402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales906Open in IMG/M
3300012957|Ga0164303_11492346Not Available510Open in IMG/M
3300012960|Ga0164301_10573350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia828Open in IMG/M
3300012961|Ga0164302_10695943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia752Open in IMG/M
3300012961|Ga0164302_11022479Not Available646Open in IMG/M
3300012986|Ga0164304_10661912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia788Open in IMG/M
3300013105|Ga0157369_11329614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales732Open in IMG/M
3300013296|Ga0157374_12870061Not Available509Open in IMG/M
3300013296|Ga0157374_12877855Not Available509Open in IMG/M
3300013307|Ga0157372_12449241Not Available599Open in IMG/M
3300013772|Ga0120158_10362605Not Available678Open in IMG/M
3300014166|Ga0134079_10726101Not Available510Open in IMG/M
3300014502|Ga0182021_11759188Not Available746Open in IMG/M
3300014827|Ga0120171_1024806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2223Open in IMG/M
3300014968|Ga0157379_11304791Not Available701Open in IMG/M
3300015358|Ga0134089_10508870Not Available528Open in IMG/M
3300017937|Ga0187809_10438599Not Available503Open in IMG/M
3300017939|Ga0187775_10143938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia843Open in IMG/M
3300017974|Ga0187777_10766635Not Available687Open in IMG/M
3300018476|Ga0190274_13695046Not Available517Open in IMG/M
3300020080|Ga0206350_11347931Not Available583Open in IMG/M
3300020082|Ga0206353_11030393Not Available585Open in IMG/M
3300024055|Ga0247794_10273042Not Available563Open in IMG/M
3300024288|Ga0179589_10538615All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300024290|Ga0247667_1033982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales968Open in IMG/M
3300024331|Ga0247668_1025233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1224Open in IMG/M
3300025509|Ga0208848_1112849Not Available540Open in IMG/M
3300025898|Ga0207692_10898753Not Available582Open in IMG/M
3300025898|Ga0207692_11173363Not Available510Open in IMG/M
3300025911|Ga0207654_10490864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia866Open in IMG/M
3300025912|Ga0207707_10745001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia820Open in IMG/M
3300025913|Ga0207695_11221096Not Available632Open in IMG/M
3300025913|Ga0207695_11461211Not Available564Open in IMG/M
3300025915|Ga0207693_10904746Not Available677Open in IMG/M
3300025916|Ga0207663_11163599Not Available621Open in IMG/M
3300025917|Ga0207660_10562410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales928Open in IMG/M
3300025919|Ga0207657_11255917Not Available561Open in IMG/M
3300025927|Ga0207687_10234929All Organisms → cellular organisms → Bacteria1450Open in IMG/M
3300025929|Ga0207664_10865032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales812Open in IMG/M
3300025931|Ga0207644_10634923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia888Open in IMG/M
3300025933|Ga0207706_10912835Not Available741Open in IMG/M
3300026067|Ga0207678_10496568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1063Open in IMG/M
3300026116|Ga0207674_11087492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia769Open in IMG/M
3300026142|Ga0207698_10072939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2731Open in IMG/M
3300026142|Ga0207698_12026334Not Available590Open in IMG/M
3300027821|Ga0209811_10432042Not Available511Open in IMG/M
3300028281|Ga0247689_1034313Not Available696Open in IMG/M
3300028577|Ga0265318_10150599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales853Open in IMG/M
3300028755|Ga0307316_10104667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia989Open in IMG/M
3300028800|Ga0265338_10468430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei890Open in IMG/M
3300031366|Ga0307506_10091938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia978Open in IMG/M
3300031668|Ga0318542_10253914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales895Open in IMG/M
3300031716|Ga0310813_10558118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1008Open in IMG/M
3300031747|Ga0318502_10371870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter848Open in IMG/M
3300031770|Ga0318521_10639760Not Available644Open in IMG/M
3300031778|Ga0318498_10032799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2261Open in IMG/M
3300031792|Ga0318529_10264033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter801Open in IMG/M
3300031835|Ga0318517_10143030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1067Open in IMG/M
3300031846|Ga0318512_10673304Not Available530Open in IMG/M
3300031897|Ga0318520_10117125Not Available1513Open in IMG/M
3300031939|Ga0308174_10707778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales841Open in IMG/M
3300031996|Ga0308176_10354045Not Available1450Open in IMG/M
3300032829|Ga0335070_10740227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales917Open in IMG/M
3300032892|Ga0335081_10284408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2203Open in IMG/M
3300033551|Ga0247830_10980414Not Available674Open in IMG/M
3300034268|Ga0372943_0425705Not Available859Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.65%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.73%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.73%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.85%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.85%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.92%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.92%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.96%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.96%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.96%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.96%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.96%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.96%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2070309009Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
2170459008Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect DNA Tissue lysis 0-10cmEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005888Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012476Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610Host-AssociatedOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014827Permafrost microbial communities from Nunavut, Canada - A3_80cm_18MEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025509Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028281Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30EnvironmentalOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPKNP_053894902070309009SoilAGDGLVVYETGAKTQPEIEGLETRTSRKYGSARITLFEH
F48_000545602170459008Grass SoilLLVYQTAARTEPAIEGLEVRTSRKYGSARLTLFEH
JGI1027J12803_10957037523300000955SoilLARDGVLVYQTAARTEPEIEGLHVRTSRKYGSARLTLF
A1565W1_1107865413300001536PermafrostVYESSGREDPPEVPGLDQRTSRKYGSARLTLFDK*
A10PFW1_1007386813300001538PermafrostAPHLAKVLTDAGVLVWESSSRLPAPEVQGLQQRTTRTFGSARLTLLET*
Ga0055467_1020854113300003996Natural And Restored WetlandsRIVSPDGLLVYESAAADEPAVEGLRVRTSRRYGSAQLTLFES*
Ga0062590_10075629633300004157SoilAEDGLLVYETTSRREPVLDGLRVRTSRTYGSARLTLFEHES*
Ga0062594_10123378413300005093SoilCDPPYGYDGRRLAPHLAKLLTDDGVLVWESSSREPPPEAPGLEQRTTRTYGSARLTLLER
Ga0066678_1016150813300005181SoilRLLADDGLLVWESSSRLPPPTVPGLSERTSRTYGSARLTLFET*
Ga0070683_10054280713300005329Corn RhizospherePYGFDPSRLVPHLSRLLRDDGLLVWETSGREPPPEVPGLVQRTSRRYGSARLTLLEL*
Ga0070682_10179064023300005337Corn RhizosphereCDPPYDYDRRRLVPHLARLLTDDGVLVWETSSREPAPEVPGLRERTARKYGSARLTLFDR
Ga0070688_10119431623300005365Switchgrass RhizospherePYLGAKLARDGVVVYETGVREEPEIQGLRVRTSRTYGSARLTLFEH*
Ga0070659_10205120923300005366Corn RhizosphereYLGAKLARDGLVVYETGVREEPEIQGLRVRTSRTYGSARLTLFEH*
Ga0070710_1074561213300005437Corn, Switchgrass And Miscanthus RhizospherePLLAPDGLLVLETAGRESPPDIPGLQVRTTRRYGAARLTLFEL*
Ga0070701_1045220013300005438Corn, Switchgrass And Miscanthus RhizosphereAPDGLLVYETGAREEPQIQGLRVRTSRTYGSARLTLFRY*
Ga0070708_10090014533300005445Corn, Switchgrass And Miscanthus RhizosphereTDEGVLVYETAGRADPPDLPGLEVRTSRKYGSARLTLYET*
Ga0070663_10213709023300005455Corn RhizosphereAPDGVLAYESSGRDDPPQVPGLRERTSRKYGSARVTLFDL*
Ga0070684_10012852313300005535Corn RhizosphereKLLTDDGVLVWESSSREPPPEAPGLEQRTTRTYGSARLTLLER*
Ga0068852_10117101433300005616Corn RhizosphereVLVYESSGREPPPQVPGLAERTSRRYGSARLTLFEL*
Ga0068859_10072290513300005617Switchgrass RhizosphereLAQDGLVVYETGAREELEIQGLRVRTSRTYGSARLTLFEH*
Ga0075289_101700613300005888Rice Paddy SoilPDGLLVYETRARTEPTIDGLTLRTSRTYGSARLTLFQH*
Ga0074057_1214164813300006605SoilLVKALAPDGLLVYETGAREEPQIQGLRVRTSRTYGSARLTLFGHES*
Ga0075434_10104948933300006871Populus RhizosphereLVPDGLLVYETGARDEPTVEGLRTRTSRTYGSARLTLFEH*
Ga0075435_10084094413300007076Populus RhizosphereLVYETSARREPALEGLRVRTSRTYGSARLTLFEH*
Ga0114129_1207355623300009147Populus RhizospherePDGLLVYETGARDEPTVEGLGTRISRTYGSARLTLFEH*
Ga0105242_1086089923300009176Miscanthus RhizosphereDGLLVYETGAREEPEIQGLSTRTSRTYGSARLTLFEHES*
Ga0126384_1061101213300010046Tropical Forest SoilAHEGLLVYQSGARTEPEIDGLRVRTSRKYGSSRLTLFEK*
Ga0134062_1050652913300010337Grasslands SoilLLTDDGLLVWESSSRLSAPIVPGLSERTSRTYGSARLTLFET*
Ga0126378_1173339113300010361Tropical Forest SoilNVAPDGLLVYESSKRAAPPEPPGLEQTTSRTYGSARLTLFRP*
Ga0126377_1102269033300010362Tropical Forest SoilLASEGLLVYQSDARTEPEIDGLRVRTSRKYGSARLTLFEQ*
Ga0126379_1370417813300010366Tropical Forest SoilDGGLLVYETAARDEPEVAGLAVRTSRRYGSARLTLFER*
Ga0134128_1262478023300010373Terrestrial SoilCDPPYDYDPSRLAPHLADLLTDDGLLVWETSSRATAPQVTGLRERRTRMYGSAGLTLLDR
Ga0137391_1028618943300011270Vadose Zone SoilAPQLARMLSPDGVLVWESSGRDEPPQVPGLTERTSRKYGSARLTLFEL*
Ga0137382_1046643933300012200Vadose Zone SoilARLLSGDGVLVYESAGREDPPEVPGLEVRTSRRYGSARLTLFEAP*
Ga0137363_1081814113300012202Vadose Zone SoilLGRLLNEDGVLVYESAGREDPPEIPGLEQRTSRKYGSARLTLFEK*
Ga0137379_1105145013300012209Vadose Zone SoilDGLLVYQTDTRTEPEIDGLEIRTSRKYGSARLTLFEAQ*
Ga0137371_1119814923300012356Vadose Zone SoilSEHGLLVYESSGRADPPEVPGLTQQTSRTYGSARLTLFTK*
Ga0157344_102243313300012476Arabidopsis RhizosphereRLVAPDGLLVYESSKRDDPPEPPGLGQTTSRTYGSARLTLFRP*
Ga0137396_1049540233300012918Vadose Zone SoilDGLLVYESAGREDPPEVPGLELRTSRKYGAARLTLFDR*
Ga0164303_1149234623300012957SoilDGVLVYESSGREEPPEVPGLEQRTSRKYGSARLTLFDR*
Ga0164301_1057335033300012960SoilLVYETGAREEPQIQGLRVRTSRTYGSARLTLFQHES*
Ga0164302_1069594333300012961SoilVYESSGREEPPEVPGLEQRTSRKYGSARLTLFDT*
Ga0164302_1102247923300012961SoilAGLLVYETGAREEPQIQGLRVRTSRTYGSARLTLFET*
Ga0164304_1066191213300012986SoilYLVKALAPDGLLVYETGVREKPQIQGLRVRTSRTYGSARLTLFGY*
Ga0157369_1132961433300013105Corn RhizosphereLLNEDGVLVYESSGREDPPEVPGLEQRTSRKYGSARLTLFDK*
Ga0157374_1287006113300013296Miscanthus RhizosphereDDGVLVWESSSREPPPEVPGLEQRTTRTYGSARLTLLER*
Ga0157374_1287785513300013296Miscanthus RhizospherePHLARLLNEDGVLVYESSGREDPPEVPGLEQRTSRKYGSARLTLFDK*
Ga0157372_1244924123300013307Corn RhizosphereDGVLAYESSGRDDPPQVPGLRERTSRKYGSARVTLFDL*
Ga0120158_1036260523300013772PermafrostPHLARLLKEDGVLVYESSGREDPPEVPGLEQRTSRKYGSTRLTLFDK*
Ga0134079_1072610113300014166Grasslands SoilYDYDHARLVPQLGRLVAEDGLLVYESAGREDPPEVPGLELRTSRKYGAARLTLFDR*
Ga0182021_1175918823300014502FenPYGFAEAGRLAPHLARVLAEDGLVVFESSSRMPPPELEGLAERTSRTYGSARITLFAR*
Ga0120171_102480613300014827PermafrostLLAPDGLLVYETSGREDPPDVPGLEVRTSRKYGSARLTLFEH*
Ga0157379_1130479133300014968Switchgrass RhizosphereDGLLVWETSGREPAPEAPGLRERTTRRYGAARLTLLEH*
Ga0134089_1050887023300015358Grasslands SoilLVYQTDARAEPEVEGLGIRTSRKYGSARLTLFEP*
Ga0187809_1043859913300017937Freshwater SedimentPGTLPGQLARLVRDDGLLVWESSSREPPPEVPGLAERTSRTYGSARLTLFEQ
Ga0187775_1014393833300017939Tropical PeatlandVIVYETGGKVELAIEGLVARTSRAYGSARLTLFQHE
Ga0187777_1076663513300017974Tropical PeatlandESAALLPRLAGLLSERGVLVWESAGAAPAPSVPGLRERTSRRYGSARLTLFEK
Ga0190274_1369504623300018476SoilGLLVYETPARLEPKIDGLEVRTSRKYGSARLTLFER
Ga0206350_1134793113300020080Corn, Switchgrass And Miscanthus RhizosphereLAPHLAKLLTPDGLLVWETSSRADPPEVPGLRQRTTRTYGSARLTLYET
Ga0206353_1103039323300020082Corn, Switchgrass And Miscanthus RhizosphereRRLVPHLARLLTDDGVLVWETSSREPAPEVPGLEQRTTRTYGSARLTLLET
Ga0247794_1027304223300024055SoilKALAPDGLLVYETGAREEPQIQGLRVRTSRTYGSARLTLFRY
Ga0179589_1053861513300024288Vadose Zone SoilPYGYDHAKVTPHLARLLNEDGVLVYESSGREDPPEIPGLEQRTSRKYGSARLTLFDK
Ga0247667_103398233300024290SoilRITPHLARLLNEDGVLVYESSGREDPPEVPGLEQRTSRKYGSARLTLFDK
Ga0247668_102523313300024331SoilLNEDGVLVYESSGREDPPEVPGLEQRTSRKYGSARLTLFDK
Ga0208848_111284923300025509Arctic Peat SoilLARLVAEDGLLVYESSSRGEPPEVPPLDVRTSRVYGSARLTLFTR
Ga0207692_1089875323300025898Corn, Switchgrass And Miscanthus RhizosphereEDGVLVWESAGREPPPAIPGLQERTSRRYGSARLTLFEL
Ga0207692_1117336323300025898Corn, Switchgrass And Miscanthus RhizosphereDGLLVWESSSRRPAPTVPGLSERTSRTYGSARLTLFET
Ga0207654_1049086413300025911Corn RhizosphereRLLADDGLLVWESSSRRPAPTVPGLSERTSRTYGSARLTLFET
Ga0207707_1074500113300025912Corn RhizosphereLARLLTPAGVLVYESSGREPPPQVPGLAERTSRRYGSARLTLFEL
Ga0207695_1122109623300025913Corn RhizosphereRLAPHLARLVSPDGLLVWESSGRADPPEVEGLAQRTSRKYGSARLTLFEQ
Ga0207695_1146121113300025913Corn RhizosphereLLTEVGVLVYESNGREEAPQIEGLAERTSRKYGSARLTLFTR
Ga0207693_1090474613300025915Corn, Switchgrass And Miscanthus RhizosphereLAPDGLIVYETGAREEPQIQGLSTRTSRTYGSARLTLFEH
Ga0207663_1116359923300025916Corn, Switchgrass And Miscanthus RhizosphereLGALLAPDEVLVLETAGREDAPAIPELRERTSRRYGAARLTLFEL
Ga0207660_1056241013300025917Corn RhizosphereLCDPPYDYDGTRLARHLARVLTDDGLLVWESSSREPAPEVPGLRERTTRTYGSARLTLLETC
Ga0207657_1125591723300025919Corn RhizosphereDPPYDYDASRLAPHLARLLTDDGLLVWESSSREPAPEVPGLAQRTTRTYGSARLTLLER
Ga0207687_1023492913300025927Miscanthus RhizosphereYLVKALAPDGLLVYETGAREEPQIQGLRVRTSRTYGSARLTLFRY
Ga0207664_1086503233300025929Agricultural SoilNEDGVLVYESSGREDPPEVPGLEQRTSRKYGSARLTLFDK
Ga0207644_1063492313300025931Switchgrass RhizosphereAAKLAPGGLVVYETGAKETPEIQGLSVRTSRTYGSARLTLFEL
Ga0207706_1091283513300025933Corn RhizospherePHLARLLTDDGVLVWESSSREPAPAAPGLRERTTRKYGSARLTLLER
Ga0207678_1049656833300026067Corn RhizosphereAPDGVLAYESSGRDDPPQVPGLRERTSRKYGSARVTLFDL
Ga0207674_1108749213300026116Corn RhizosphereLAYESSGRDDPPQVPGLRERTSRKYGSARVTLFDL
Ga0207698_1007293913300026142Corn RhizosphereDGRRLAPHLAKLLTDDGVLVWESSSREPPPEAPGLEQRTTRTYGSARLTLLER
Ga0207698_1202633413300026142Corn RhizosphereTPAGVLVYESSGREPPPQVPGLAERTSRRYGSARLTLFEL
Ga0209811_1043204213300027821Surface SoilVLCDPPYEFDPARLAPQLARLLADDGLLVWESSSRRPAPTVPGLSERTSRTYGSARLTLFET
Ga0247689_103431313300028281SoilLARDGVVVYETGVREEPEIQGLRVRTSRTYGSARLTLFEH
Ga0265318_1015059933300028577RhizosphereDGLLVYESSSRGEPPEVPPLDVRTSRVYGSARLTLFTR
Ga0307316_1010466713300028755SoilRLVPHLPRLLREDGLLVWETAGREPAPEVPGLEQRTSRKYGSARLTLLQL
Ga0265338_1046843013300028800RhizosphereGLLVYESSSRGEPPEVPPLDVRTSRVYGSARLTLFTR
Ga0307506_1009193833300031366SoilLVVYETAKRREPELEGLNVRTSRTYGSARLTLFQH
Ga0318542_1025391433300031668SoilPDGLLVYESAGREPPPELPLLTEQTSRKYGSARLTLYRR
Ga0310813_1055811813300031716SoilDYDGSRLAPHLAKLLTDDGLLVWETSGREPAPEAPGLRERTTRRYGAARLTLLEH
Ga0318502_1037187033300031747SoilPDGLLVFESSARGQGPAVEGLAVRTSRRYGSARLTLFER
Ga0318521_1063976013300031770SoilGLLVYESPARGDGPAVEGLAVRTSRRYGSARLTLFER
Ga0318498_1003279963300031778SoilVDATRLPFARLLADDGLLVYESSGRADPPQVDGLAQRTSRKYGSARLTLFEQ
Ga0318529_1026403313300031792SoilHPDGLLVYESAGREPPPELPLLTEQTSRKYGSARLTLYRR
Ga0318517_1014303013300031835SoilATRLPFARLLADDGLLVYESSGRADPPQVDGLAQRTSRKYGSARLTLFEQ
Ga0318512_1067330423300031846SoilDRERLALHLARLVHPDGLLVYESAGREPPPELPLLTEQTSRKYGSARLTLYRR
Ga0318520_1011712543300031897SoilDDGLLVYESSGRADPPQVDGLAQRTSRKYGSARLTLFEQ
Ga0308174_1070777813300031939SoilRVLTDDGLLVWESSSREPAPEVPGLRERTTRTYGSARLTLLETC
Ga0308176_1035404513300031996SoilAGLLTDDGLLVWETSSRAGPPEVPGLAQRTSRTYGSARLTLYETT
Ga0335070_1074022733300032829SoilDGLLVLESTGREDAPELAGLAVRTSRRYGSARLTLYES
Ga0335081_1028440813300032892SoilAELVRADGLLVLESSSREEPPALDGLEIRTSRKYGSARLTLYEA
Ga0247830_1098041423300033551SoilLVRSLAPDGLLVYETSAREEPAVQGLTPRTSRTYGSARLTLFGHEP
Ga0372943_0425705_2_1663300034268SoilYDHARLSPHLAGLLTDDGVLVYETAGRADPPVVPGLAQRTSRKYGAARLTLYET


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.