| Basic Information | |
|---|---|
| Family ID | F097277 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LLAPDGLLVYETSGREDPPDVPGLEVRTSRKYGSARLTLFEH |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.04 % |
| % of genes from short scaffolds (< 2000 bps) | 95.19 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.923 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.539 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.577 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.038 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 30.00% Coil/Unstructured: 70.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF01467 | CTP_transf_like | 91.35 |
| PF03602 | Cons_hypoth95 | 2.88 |
| PF02620 | YceD | 1.92 |
| PF07883 | Cupin_2 | 0.96 |
| PF01609 | DDE_Tnp_1 | 0.96 |
| PF00171 | Aldedh | 0.96 |
| PF00583 | Acetyltransf_1 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 2.88 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 2.88 |
| COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 2.88 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 2.88 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 2.88 |
| COG1399 | 23S rRNA accumulation protein YceD (essential in plants, uncharacterized in bacteria) | Translation, ribosomal structure and biogenesis [J] | 1.92 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.96 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.96 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.96 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.96 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.96 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.96 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.92 % |
| Unclassified | root | N/A | 48.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309009|GPKNP_GG3DY5401EULG0 | Not Available | 512 | Open in IMG/M |
| 2170459008|GA8OVOZ01A3ZP9 | Not Available | 517 | Open in IMG/M |
| 3300000955|JGI1027J12803_109570375 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300001536|A1565W1_11078654 | Not Available | 604 | Open in IMG/M |
| 3300001538|A10PFW1_10073868 | Not Available | 735 | Open in IMG/M |
| 3300003996|Ga0055467_10208541 | Not Available | 605 | Open in IMG/M |
| 3300004157|Ga0062590_100756296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 886 | Open in IMG/M |
| 3300005093|Ga0062594_101233784 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300005181|Ga0066678_10161508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1409 | Open in IMG/M |
| 3300005329|Ga0070683_100542807 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300005337|Ga0070682_101790640 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005365|Ga0070688_101194316 | Not Available | 611 | Open in IMG/M |
| 3300005366|Ga0070659_102051209 | Not Available | 514 | Open in IMG/M |
| 3300005437|Ga0070710_10745612 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300005438|Ga0070701_10452200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 825 | Open in IMG/M |
| 3300005445|Ga0070708_100900145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 831 | Open in IMG/M |
| 3300005455|Ga0070663_102137090 | Not Available | 505 | Open in IMG/M |
| 3300005535|Ga0070684_100128523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2284 | Open in IMG/M |
| 3300005616|Ga0068852_101171014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
| 3300005617|Ga0068859_100722905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1086 | Open in IMG/M |
| 3300005888|Ga0075289_1017006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1017 | Open in IMG/M |
| 3300006605|Ga0074057_12141648 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300006871|Ga0075434_101049489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 829 | Open in IMG/M |
| 3300007076|Ga0075435_100840944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 800 | Open in IMG/M |
| 3300009147|Ga0114129_12073556 | Not Available | 686 | Open in IMG/M |
| 3300009176|Ga0105242_10860899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 903 | Open in IMG/M |
| 3300010046|Ga0126384_10611012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 956 | Open in IMG/M |
| 3300010337|Ga0134062_10506529 | Not Available | 608 | Open in IMG/M |
| 3300010361|Ga0126378_11733391 | Not Available | 710 | Open in IMG/M |
| 3300010362|Ga0126377_11022690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 893 | Open in IMG/M |
| 3300010366|Ga0126379_13704178 | Not Available | 512 | Open in IMG/M |
| 3300010373|Ga0134128_12624780 | Not Available | 555 | Open in IMG/M |
| 3300011270|Ga0137391_10286189 | Not Available | 1423 | Open in IMG/M |
| 3300012200|Ga0137382_10466439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 895 | Open in IMG/M |
| 3300012202|Ga0137363_10818141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 790 | Open in IMG/M |
| 3300012209|Ga0137379_11051450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 719 | Open in IMG/M |
| 3300012356|Ga0137371_11198149 | Not Available | 567 | Open in IMG/M |
| 3300012476|Ga0157344_1022433 | Not Available | 554 | Open in IMG/M |
| 3300012918|Ga0137396_10495402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 906 | Open in IMG/M |
| 3300012957|Ga0164303_11492346 | Not Available | 510 | Open in IMG/M |
| 3300012960|Ga0164301_10573350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 828 | Open in IMG/M |
| 3300012961|Ga0164302_10695943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 752 | Open in IMG/M |
| 3300012961|Ga0164302_11022479 | Not Available | 646 | Open in IMG/M |
| 3300012986|Ga0164304_10661912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 788 | Open in IMG/M |
| 3300013105|Ga0157369_11329614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 732 | Open in IMG/M |
| 3300013296|Ga0157374_12870061 | Not Available | 509 | Open in IMG/M |
| 3300013296|Ga0157374_12877855 | Not Available | 509 | Open in IMG/M |
| 3300013307|Ga0157372_12449241 | Not Available | 599 | Open in IMG/M |
| 3300013772|Ga0120158_10362605 | Not Available | 678 | Open in IMG/M |
| 3300014166|Ga0134079_10726101 | Not Available | 510 | Open in IMG/M |
| 3300014502|Ga0182021_11759188 | Not Available | 746 | Open in IMG/M |
| 3300014827|Ga0120171_1024806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2223 | Open in IMG/M |
| 3300014968|Ga0157379_11304791 | Not Available | 701 | Open in IMG/M |
| 3300015358|Ga0134089_10508870 | Not Available | 528 | Open in IMG/M |
| 3300017937|Ga0187809_10438599 | Not Available | 503 | Open in IMG/M |
| 3300017939|Ga0187775_10143938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 843 | Open in IMG/M |
| 3300017974|Ga0187777_10766635 | Not Available | 687 | Open in IMG/M |
| 3300018476|Ga0190274_13695046 | Not Available | 517 | Open in IMG/M |
| 3300020080|Ga0206350_11347931 | Not Available | 583 | Open in IMG/M |
| 3300020082|Ga0206353_11030393 | Not Available | 585 | Open in IMG/M |
| 3300024055|Ga0247794_10273042 | Not Available | 563 | Open in IMG/M |
| 3300024288|Ga0179589_10538615 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300024290|Ga0247667_1033982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 968 | Open in IMG/M |
| 3300024331|Ga0247668_1025233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1224 | Open in IMG/M |
| 3300025509|Ga0208848_1112849 | Not Available | 540 | Open in IMG/M |
| 3300025898|Ga0207692_10898753 | Not Available | 582 | Open in IMG/M |
| 3300025898|Ga0207692_11173363 | Not Available | 510 | Open in IMG/M |
| 3300025911|Ga0207654_10490864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 866 | Open in IMG/M |
| 3300025912|Ga0207707_10745001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 820 | Open in IMG/M |
| 3300025913|Ga0207695_11221096 | Not Available | 632 | Open in IMG/M |
| 3300025913|Ga0207695_11461211 | Not Available | 564 | Open in IMG/M |
| 3300025915|Ga0207693_10904746 | Not Available | 677 | Open in IMG/M |
| 3300025916|Ga0207663_11163599 | Not Available | 621 | Open in IMG/M |
| 3300025917|Ga0207660_10562410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 928 | Open in IMG/M |
| 3300025919|Ga0207657_11255917 | Not Available | 561 | Open in IMG/M |
| 3300025927|Ga0207687_10234929 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300025929|Ga0207664_10865032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 812 | Open in IMG/M |
| 3300025931|Ga0207644_10634923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 888 | Open in IMG/M |
| 3300025933|Ga0207706_10912835 | Not Available | 741 | Open in IMG/M |
| 3300026067|Ga0207678_10496568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1063 | Open in IMG/M |
| 3300026116|Ga0207674_11087492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 769 | Open in IMG/M |
| 3300026142|Ga0207698_10072939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2731 | Open in IMG/M |
| 3300026142|Ga0207698_12026334 | Not Available | 590 | Open in IMG/M |
| 3300027821|Ga0209811_10432042 | Not Available | 511 | Open in IMG/M |
| 3300028281|Ga0247689_1034313 | Not Available | 696 | Open in IMG/M |
| 3300028577|Ga0265318_10150599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 853 | Open in IMG/M |
| 3300028755|Ga0307316_10104667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 989 | Open in IMG/M |
| 3300028800|Ga0265338_10468430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 890 | Open in IMG/M |
| 3300031366|Ga0307506_10091938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 978 | Open in IMG/M |
| 3300031668|Ga0318542_10253914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 895 | Open in IMG/M |
| 3300031716|Ga0310813_10558118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1008 | Open in IMG/M |
| 3300031747|Ga0318502_10371870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 848 | Open in IMG/M |
| 3300031770|Ga0318521_10639760 | Not Available | 644 | Open in IMG/M |
| 3300031778|Ga0318498_10032799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2261 | Open in IMG/M |
| 3300031792|Ga0318529_10264033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 801 | Open in IMG/M |
| 3300031835|Ga0318517_10143030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1067 | Open in IMG/M |
| 3300031846|Ga0318512_10673304 | Not Available | 530 | Open in IMG/M |
| 3300031897|Ga0318520_10117125 | Not Available | 1513 | Open in IMG/M |
| 3300031939|Ga0308174_10707778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 841 | Open in IMG/M |
| 3300031996|Ga0308176_10354045 | Not Available | 1450 | Open in IMG/M |
| 3300032829|Ga0335070_10740227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 917 | Open in IMG/M |
| 3300032892|Ga0335081_10284408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2203 | Open in IMG/M |
| 3300033551|Ga0247830_10980414 | Not Available | 674 | Open in IMG/M |
| 3300034268|Ga0372943_0425705 | Not Available | 859 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.73% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.85% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.96% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.96% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.96% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.96% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309009 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459008 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028281 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30 | Environmental | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPKNP_05389490 | 2070309009 | Soil | AGDGLVVYETGAKTQPEIEGLETRTSRKYGSARITLFEH |
| F48_00054560 | 2170459008 | Grass Soil | LLVYQTAARTEPAIEGLEVRTSRKYGSARLTLFEH |
| JGI1027J12803_1095703752 | 3300000955 | Soil | LARDGVLVYQTAARTEPEIEGLHVRTSRKYGSARLTLF |
| A1565W1_110786541 | 3300001536 | Permafrost | VYESSGREDPPEVPGLDQRTSRKYGSARLTLFDK* |
| A10PFW1_100738681 | 3300001538 | Permafrost | APHLAKVLTDAGVLVWESSSRLPAPEVQGLQQRTTRTFGSARLTLLET* |
| Ga0055467_102085411 | 3300003996 | Natural And Restored Wetlands | RIVSPDGLLVYESAAADEPAVEGLRVRTSRRYGSAQLTLFES* |
| Ga0062590_1007562963 | 3300004157 | Soil | AEDGLLVYETTSRREPVLDGLRVRTSRTYGSARLTLFEHES* |
| Ga0062594_1012337841 | 3300005093 | Soil | CDPPYGYDGRRLAPHLAKLLTDDGVLVWESSSREPPPEAPGLEQRTTRTYGSARLTLLER |
| Ga0066678_101615081 | 3300005181 | Soil | RLLADDGLLVWESSSRLPPPTVPGLSERTSRTYGSARLTLFET* |
| Ga0070683_1005428071 | 3300005329 | Corn Rhizosphere | PYGFDPSRLVPHLSRLLRDDGLLVWETSGREPPPEVPGLVQRTSRRYGSARLTLLEL* |
| Ga0070682_1017906402 | 3300005337 | Corn Rhizosphere | CDPPYDYDRRRLVPHLARLLTDDGVLVWETSSREPAPEVPGLRERTARKYGSARLTLFDR |
| Ga0070688_1011943162 | 3300005365 | Switchgrass Rhizosphere | PYLGAKLARDGVVVYETGVREEPEIQGLRVRTSRTYGSARLTLFEH* |
| Ga0070659_1020512092 | 3300005366 | Corn Rhizosphere | YLGAKLARDGLVVYETGVREEPEIQGLRVRTSRTYGSARLTLFEH* |
| Ga0070710_107456121 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | PLLAPDGLLVLETAGRESPPDIPGLQVRTTRRYGAARLTLFEL* |
| Ga0070701_104522001 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | APDGLLVYETGAREEPQIQGLRVRTSRTYGSARLTLFRY* |
| Ga0070708_1009001453 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TDEGVLVYETAGRADPPDLPGLEVRTSRKYGSARLTLYET* |
| Ga0070663_1021370902 | 3300005455 | Corn Rhizosphere | APDGVLAYESSGRDDPPQVPGLRERTSRKYGSARVTLFDL* |
| Ga0070684_1001285231 | 3300005535 | Corn Rhizosphere | KLLTDDGVLVWESSSREPPPEAPGLEQRTTRTYGSARLTLLER* |
| Ga0068852_1011710143 | 3300005616 | Corn Rhizosphere | VLVYESSGREPPPQVPGLAERTSRRYGSARLTLFEL* |
| Ga0068859_1007229051 | 3300005617 | Switchgrass Rhizosphere | LAQDGLVVYETGAREELEIQGLRVRTSRTYGSARLTLFEH* |
| Ga0075289_10170061 | 3300005888 | Rice Paddy Soil | PDGLLVYETRARTEPTIDGLTLRTSRTYGSARLTLFQH* |
| Ga0074057_121416481 | 3300006605 | Soil | LVKALAPDGLLVYETGAREEPQIQGLRVRTSRTYGSARLTLFGHES* |
| Ga0075434_1010494893 | 3300006871 | Populus Rhizosphere | LVPDGLLVYETGARDEPTVEGLRTRTSRTYGSARLTLFEH* |
| Ga0075435_1008409441 | 3300007076 | Populus Rhizosphere | LVYETSARREPALEGLRVRTSRTYGSARLTLFEH* |
| Ga0114129_120735562 | 3300009147 | Populus Rhizosphere | PDGLLVYETGARDEPTVEGLGTRISRTYGSARLTLFEH* |
| Ga0105242_108608992 | 3300009176 | Miscanthus Rhizosphere | DGLLVYETGAREEPEIQGLSTRTSRTYGSARLTLFEHES* |
| Ga0126384_106110121 | 3300010046 | Tropical Forest Soil | AHEGLLVYQSGARTEPEIDGLRVRTSRKYGSSRLTLFEK* |
| Ga0134062_105065291 | 3300010337 | Grasslands Soil | LLTDDGLLVWESSSRLSAPIVPGLSERTSRTYGSARLTLFET* |
| Ga0126378_117333911 | 3300010361 | Tropical Forest Soil | NVAPDGLLVYESSKRAAPPEPPGLEQTTSRTYGSARLTLFRP* |
| Ga0126377_110226903 | 3300010362 | Tropical Forest Soil | LASEGLLVYQSDARTEPEIDGLRVRTSRKYGSARLTLFEQ* |
| Ga0126379_137041781 | 3300010366 | Tropical Forest Soil | DGGLLVYETAARDEPEVAGLAVRTSRRYGSARLTLFER* |
| Ga0134128_126247802 | 3300010373 | Terrestrial Soil | CDPPYDYDPSRLAPHLADLLTDDGLLVWETSSRATAPQVTGLRERRTRMYGSAGLTLLDR |
| Ga0137391_102861894 | 3300011270 | Vadose Zone Soil | APQLARMLSPDGVLVWESSGRDEPPQVPGLTERTSRKYGSARLTLFEL* |
| Ga0137382_104664393 | 3300012200 | Vadose Zone Soil | ARLLSGDGVLVYESAGREDPPEVPGLEVRTSRRYGSARLTLFEAP* |
| Ga0137363_108181411 | 3300012202 | Vadose Zone Soil | LGRLLNEDGVLVYESAGREDPPEIPGLEQRTSRKYGSARLTLFEK* |
| Ga0137379_110514501 | 3300012209 | Vadose Zone Soil | DGLLVYQTDTRTEPEIDGLEIRTSRKYGSARLTLFEAQ* |
| Ga0137371_111981492 | 3300012356 | Vadose Zone Soil | SEHGLLVYESSGRADPPEVPGLTQQTSRTYGSARLTLFTK* |
| Ga0157344_10224331 | 3300012476 | Arabidopsis Rhizosphere | RLVAPDGLLVYESSKRDDPPEPPGLGQTTSRTYGSARLTLFRP* |
| Ga0137396_104954023 | 3300012918 | Vadose Zone Soil | DGLLVYESAGREDPPEVPGLELRTSRKYGAARLTLFDR* |
| Ga0164303_114923462 | 3300012957 | Soil | DGVLVYESSGREEPPEVPGLEQRTSRKYGSARLTLFDR* |
| Ga0164301_105733503 | 3300012960 | Soil | LVYETGAREEPQIQGLRVRTSRTYGSARLTLFQHES* |
| Ga0164302_106959433 | 3300012961 | Soil | VYESSGREEPPEVPGLEQRTSRKYGSARLTLFDT* |
| Ga0164302_110224792 | 3300012961 | Soil | AGLLVYETGAREEPQIQGLRVRTSRTYGSARLTLFET* |
| Ga0164304_106619121 | 3300012986 | Soil | YLVKALAPDGLLVYETGVREKPQIQGLRVRTSRTYGSARLTLFGY* |
| Ga0157369_113296143 | 3300013105 | Corn Rhizosphere | LLNEDGVLVYESSGREDPPEVPGLEQRTSRKYGSARLTLFDK* |
| Ga0157374_128700611 | 3300013296 | Miscanthus Rhizosphere | DDGVLVWESSSREPPPEVPGLEQRTTRTYGSARLTLLER* |
| Ga0157374_128778551 | 3300013296 | Miscanthus Rhizosphere | PHLARLLNEDGVLVYESSGREDPPEVPGLEQRTSRKYGSARLTLFDK* |
| Ga0157372_124492412 | 3300013307 | Corn Rhizosphere | DGVLAYESSGRDDPPQVPGLRERTSRKYGSARVTLFDL* |
| Ga0120158_103626052 | 3300013772 | Permafrost | PHLARLLKEDGVLVYESSGREDPPEVPGLEQRTSRKYGSTRLTLFDK* |
| Ga0134079_107261011 | 3300014166 | Grasslands Soil | YDYDHARLVPQLGRLVAEDGLLVYESAGREDPPEVPGLELRTSRKYGAARLTLFDR* |
| Ga0182021_117591882 | 3300014502 | Fen | PYGFAEAGRLAPHLARVLAEDGLVVFESSSRMPPPELEGLAERTSRTYGSARITLFAR* |
| Ga0120171_10248061 | 3300014827 | Permafrost | LLAPDGLLVYETSGREDPPDVPGLEVRTSRKYGSARLTLFEH* |
| Ga0157379_113047913 | 3300014968 | Switchgrass Rhizosphere | DGLLVWETSGREPAPEAPGLRERTTRRYGAARLTLLEH* |
| Ga0134089_105088702 | 3300015358 | Grasslands Soil | LVYQTDARAEPEVEGLGIRTSRKYGSARLTLFEP* |
| Ga0187809_104385991 | 3300017937 | Freshwater Sediment | PGTLPGQLARLVRDDGLLVWESSSREPPPEVPGLAERTSRTYGSARLTLFEQ |
| Ga0187775_101439383 | 3300017939 | Tropical Peatland | VIVYETGGKVELAIEGLVARTSRAYGSARLTLFQHE |
| Ga0187777_107666351 | 3300017974 | Tropical Peatland | ESAALLPRLAGLLSERGVLVWESAGAAPAPSVPGLRERTSRRYGSARLTLFEK |
| Ga0190274_136950462 | 3300018476 | Soil | GLLVYETPARLEPKIDGLEVRTSRKYGSARLTLFER |
| Ga0206350_113479311 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | LAPHLAKLLTPDGLLVWETSSRADPPEVPGLRQRTTRTYGSARLTLYET |
| Ga0206353_110303932 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | RRLVPHLARLLTDDGVLVWETSSREPAPEVPGLEQRTTRTYGSARLTLLET |
| Ga0247794_102730422 | 3300024055 | Soil | KALAPDGLLVYETGAREEPQIQGLRVRTSRTYGSARLTLFRY |
| Ga0179589_105386151 | 3300024288 | Vadose Zone Soil | PYGYDHAKVTPHLARLLNEDGVLVYESSGREDPPEIPGLEQRTSRKYGSARLTLFDK |
| Ga0247667_10339823 | 3300024290 | Soil | RITPHLARLLNEDGVLVYESSGREDPPEVPGLEQRTSRKYGSARLTLFDK |
| Ga0247668_10252331 | 3300024331 | Soil | LNEDGVLVYESSGREDPPEVPGLEQRTSRKYGSARLTLFDK |
| Ga0208848_11128492 | 3300025509 | Arctic Peat Soil | LARLVAEDGLLVYESSSRGEPPEVPPLDVRTSRVYGSARLTLFTR |
| Ga0207692_108987532 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | EDGVLVWESAGREPPPAIPGLQERTSRRYGSARLTLFEL |
| Ga0207692_111733632 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | DGLLVWESSSRRPAPTVPGLSERTSRTYGSARLTLFET |
| Ga0207654_104908641 | 3300025911 | Corn Rhizosphere | RLLADDGLLVWESSSRRPAPTVPGLSERTSRTYGSARLTLFET |
| Ga0207707_107450011 | 3300025912 | Corn Rhizosphere | LARLLTPAGVLVYESSGREPPPQVPGLAERTSRRYGSARLTLFEL |
| Ga0207695_112210962 | 3300025913 | Corn Rhizosphere | RLAPHLARLVSPDGLLVWESSGRADPPEVEGLAQRTSRKYGSARLTLFEQ |
| Ga0207695_114612111 | 3300025913 | Corn Rhizosphere | LLTEVGVLVYESNGREEAPQIEGLAERTSRKYGSARLTLFTR |
| Ga0207693_109047461 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LAPDGLIVYETGAREEPQIQGLSTRTSRTYGSARLTLFEH |
| Ga0207663_111635992 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LGALLAPDEVLVLETAGREDAPAIPELRERTSRRYGAARLTLFEL |
| Ga0207660_105624101 | 3300025917 | Corn Rhizosphere | LCDPPYDYDGTRLARHLARVLTDDGLLVWESSSREPAPEVPGLRERTTRTYGSARLTLLETC |
| Ga0207657_112559172 | 3300025919 | Corn Rhizosphere | DPPYDYDASRLAPHLARLLTDDGLLVWESSSREPAPEVPGLAQRTTRTYGSARLTLLER |
| Ga0207687_102349291 | 3300025927 | Miscanthus Rhizosphere | YLVKALAPDGLLVYETGAREEPQIQGLRVRTSRTYGSARLTLFRY |
| Ga0207664_108650323 | 3300025929 | Agricultural Soil | NEDGVLVYESSGREDPPEVPGLEQRTSRKYGSARLTLFDK |
| Ga0207644_106349231 | 3300025931 | Switchgrass Rhizosphere | AAKLAPGGLVVYETGAKETPEIQGLSVRTSRTYGSARLTLFEL |
| Ga0207706_109128351 | 3300025933 | Corn Rhizosphere | PHLARLLTDDGVLVWESSSREPAPAAPGLRERTTRKYGSARLTLLER |
| Ga0207678_104965683 | 3300026067 | Corn Rhizosphere | APDGVLAYESSGRDDPPQVPGLRERTSRKYGSARVTLFDL |
| Ga0207674_110874921 | 3300026116 | Corn Rhizosphere | LAYESSGRDDPPQVPGLRERTSRKYGSARVTLFDL |
| Ga0207698_100729391 | 3300026142 | Corn Rhizosphere | DGRRLAPHLAKLLTDDGVLVWESSSREPPPEAPGLEQRTTRTYGSARLTLLER |
| Ga0207698_120263341 | 3300026142 | Corn Rhizosphere | TPAGVLVYESSGREPPPQVPGLAERTSRRYGSARLTLFEL |
| Ga0209811_104320421 | 3300027821 | Surface Soil | VLCDPPYEFDPARLAPQLARLLADDGLLVWESSSRRPAPTVPGLSERTSRTYGSARLTLFET |
| Ga0247689_10343131 | 3300028281 | Soil | LARDGVVVYETGVREEPEIQGLRVRTSRTYGSARLTLFEH |
| Ga0265318_101505993 | 3300028577 | Rhizosphere | DGLLVYESSSRGEPPEVPPLDVRTSRVYGSARLTLFTR |
| Ga0307316_101046671 | 3300028755 | Soil | RLVPHLPRLLREDGLLVWETAGREPAPEVPGLEQRTSRKYGSARLTLLQL |
| Ga0265338_104684301 | 3300028800 | Rhizosphere | GLLVYESSSRGEPPEVPPLDVRTSRVYGSARLTLFTR |
| Ga0307506_100919383 | 3300031366 | Soil | LVVYETAKRREPELEGLNVRTSRTYGSARLTLFQH |
| Ga0318542_102539143 | 3300031668 | Soil | PDGLLVYESAGREPPPELPLLTEQTSRKYGSARLTLYRR |
| Ga0310813_105581181 | 3300031716 | Soil | DYDGSRLAPHLAKLLTDDGLLVWETSGREPAPEAPGLRERTTRRYGAARLTLLEH |
| Ga0318502_103718703 | 3300031747 | Soil | PDGLLVFESSARGQGPAVEGLAVRTSRRYGSARLTLFER |
| Ga0318521_106397601 | 3300031770 | Soil | GLLVYESPARGDGPAVEGLAVRTSRRYGSARLTLFER |
| Ga0318498_100327996 | 3300031778 | Soil | VDATRLPFARLLADDGLLVYESSGRADPPQVDGLAQRTSRKYGSARLTLFEQ |
| Ga0318529_102640331 | 3300031792 | Soil | HPDGLLVYESAGREPPPELPLLTEQTSRKYGSARLTLYRR |
| Ga0318517_101430301 | 3300031835 | Soil | ATRLPFARLLADDGLLVYESSGRADPPQVDGLAQRTSRKYGSARLTLFEQ |
| Ga0318512_106733042 | 3300031846 | Soil | DRERLALHLARLVHPDGLLVYESAGREPPPELPLLTEQTSRKYGSARLTLYRR |
| Ga0318520_101171254 | 3300031897 | Soil | DDGLLVYESSGRADPPQVDGLAQRTSRKYGSARLTLFEQ |
| Ga0308174_107077781 | 3300031939 | Soil | RVLTDDGLLVWESSSREPAPEVPGLRERTTRTYGSARLTLLETC |
| Ga0308176_103540451 | 3300031996 | Soil | AGLLTDDGLLVWETSSRAGPPEVPGLAQRTSRTYGSARLTLYETT |
| Ga0335070_107402273 | 3300032829 | Soil | DGLLVLESTGREDAPELAGLAVRTSRRYGSARLTLYES |
| Ga0335081_102844081 | 3300032892 | Soil | AELVRADGLLVLESSSREEPPALDGLEIRTSRKYGSARLTLYEA |
| Ga0247830_109804142 | 3300033551 | Soil | LVRSLAPDGLLVYETSAREEPAVQGLTPRTSRTYGSARLTLFGHEP |
| Ga0372943_0425705_2_166 | 3300034268 | Soil | YDHARLSPHLAGLLTDDGVLVYETAGRADPPVVPGLAQRTSRKYGAARLTLYET |
| ⦗Top⦘ |